data_3CYO
# 
_entry.id   3CYO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.377 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3CYO         pdb_00003cyo 10.2210/pdb3cyo/pdb 
RCSB  RCSB047374   ?            ?                   
WWPDB D_1000047374 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3CP1 
_pdbx_database_related.details        
'Structure of a longer thermalstable core domain of HIV-1 GP41 containing the enfuvirtide resistance mutation N43D' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3CYO 
_pdbx_database_status.recvd_initial_deposition_date   2008-04-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, Z.M.'  1 
'Dwyer, J.J.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Impact of the enfuvirtide resistance mutation N43D and the associated baseline polymorphism E137K on peptide sensitivity and six-helix bundle structure.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            47 
_citation.page_first                6662 
_citation.page_last                 6670 
_citation.year                      2008 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18507398 
_citation.pdbx_database_id_DOI      10.1021/bi702509d 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bai, X.'                1  ? 
primary 'Wilson, K.L.'           2  ? 
primary 'Seedorff, J.E.'         3  ? 
primary 'Ahrens, D.'             4  ? 
primary 'Green, J.'              5  ? 
primary 'Davison, D.K.'          6  ? 
primary 'Jin, L.'                7  ? 
primary 'Stanfield-Oakley, S.A.' 8  ? 
primary 'Mosier, S.M.'           9  ? 
primary 'Melby, T.E.'            10 ? 
primary 'Cammack, N.'            11 ? 
primary 'Wang, Z.'               12 ? 
primary 'Greenberg, M.L.'        13 ? 
primary 'Dwyer, J.J.'            14 ? 
# 
_cell.entry_id           3CYO 
_cell.length_a           59.290 
_cell.length_b           59.290 
_cell.length_c           59.290 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3CYO 
_symmetry.space_group_name_H-M             'P 21 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                198 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Transmembrane protein' 9975.190 1  ? N554D,E648K 
'FUSION PROTEIN OF UNP RESIDUES 536-579, LINKER, AND UNP RESIDUES 628-663' ? 
2 water   nat water                   18.015   27 ? ?           ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TM, GLYCOPROTEIN41, GP41' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TLTVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEKSQNQQEKNE
QELLEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TLTVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEKSQNQQEKNE
QELLEL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  THR n 
1 2  LEU n 
1 3  THR n 
1 4  VAL n 
1 5  GLN n 
1 6  ALA n 
1 7  ARG n 
1 8  GLN n 
1 9  LEU n 
1 10 LEU n 
1 11 SER n 
1 12 GLY n 
1 13 ILE n 
1 14 VAL n 
1 15 GLN n 
1 16 GLN n 
1 17 GLN n 
1 18 ASN n 
1 19 ASP n 
1 20 LEU n 
1 21 LEU n 
1 22 ARG n 
1 23 ALA n 
1 24 ILE n 
1 25 GLU n 
1 26 ALA n 
1 27 GLN n 
1 28 GLN n 
1 29 HIS n 
1 30 LEU n 
1 31 LEU n 
1 32 GLN n 
1 33 LEU n 
1 34 THR n 
1 35 VAL n 
1 36 TRP n 
1 37 GLY n 
1 38 ILE n 
1 39 LYS n 
1 40 GLN n 
1 41 LEU n 
1 42 GLN n 
1 43 ALA n 
1 44 ARG n 
1 45 SER n 
1 46 GLY n 
1 47 GLY n 
1 48 ARG n 
1 49 GLY n 
1 50 GLY n 
1 51 TRP n 
1 52 MET n 
1 53 GLU n 
1 54 TRP n 
1 55 ASP n 
1 56 ARG n 
1 57 GLU n 
1 58 ILE n 
1 59 ASN n 
1 60 ASN n 
1 61 TYR n 
1 62 THR n 
1 63 SER n 
1 64 LEU n 
1 65 ILE n 
1 66 HIS n 
1 67 SER n 
1 68 LEU n 
1 69 ILE n 
1 70 GLU n 
1 71 LYS n 
1 72 SER n 
1 73 GLN n 
1 74 ASN n 
1 75 GLN n 
1 76 GLN n 
1 77 GLU n 
1 78 LYS n 
1 79 ASN n 
1 80 GLU n 
1 81 GLN n 
1 82 GLU n 
1 83 LEU n 
1 84 LEU n 
1 85 GLU n 
1 86 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 1  44 ? ? env ? ? ? ? ? ? 'Human immunodeficiency virus type 1' ? ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'BL21(DE3)PLYSS' ? ? ? ? ? ? ? PLASMID ? ? ? PET41A ? ? 
1 2 sample ? 51 86 ? ? env ? ? ? ? ? ? 'Human immunodeficiency virus type 1' ? ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'BL21(DE3)PLYSS' ? ? ? ? ? ? ? PLASMID ? ? ? PET41A ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ENV_HV1LW Q70626 1 TLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQAR 536 ? 
2 UNP ENV_HV1LW Q70626 1 WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEL         628 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3CYO A 1  ? 44 ? Q70626 536 ? 579 ? 1  44 
2 2 3CYO A 51 ? 86 ? Q70626 628 ? 663 ? 51 86 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3CYO ASP A 19 ? UNP Q70626 ASN 554 'engineered mutation' 19 1 
1 3CYO SER A 45 ? UNP Q70626 ?   ?   linker                45 2 
1 3CYO GLY A 46 ? UNP Q70626 ?   ?   linker                46 3 
1 3CYO GLY A 47 ? UNP Q70626 ?   ?   linker                47 4 
1 3CYO ARG A 48 ? UNP Q70626 ?   ?   linker                48 5 
1 3CYO GLY A 49 ? UNP Q70626 ?   ?   linker                49 6 
1 3CYO GLY A 50 ? UNP Q70626 ?   ?   linker                50 7 
2 3CYO LYS A 71 ? UNP Q70626 GLU 648 'engineered mutation' 71 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3CYO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.74 
_exptl_crystal.density_percent_sol   29.35 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_details    
'25-40% ETHYLENE GLYCOL, 0.2 M MGCL2 AND 0.1 M HEPES PH 7.5, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 295K, pH 7.50' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2007-11-01 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3CYO 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   4263 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.096 
_reflns.pdbx_netI_over_sigmaI        9.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   88.3 
_reflns_shell.Rmerge_I_obs           0.879 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3CYO 
_refine.ls_number_reflns_obs                     3876 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    91.8 
_refine.ls_R_factor_obs                          0.242 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.242 
_refine.ls_R_factor_R_free                       0.332 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  396 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            0.00000 
_refine.aniso_B[2][2]                            0.00000 
_refine.aniso_B[3][3]                            0.00000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1ENV' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ANISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        605 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             27 
_refine_hist.number_atoms_total               632 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        50 
# 
_struct.entry_id                  3CYO 
_struct.title                     
;Structure of a longer thermalstable core domain of HIV-1 GP41 containing the enfuvirtide resistance mutation N43D and complementary mutation E137K
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CYO 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
_struct_keywords.text            
;HIV-1 ENVELOPE GLYCOPROTEIN, 6-HELIX BUNDLE, GP41, N43D, E137K, AIDS, APOPTOSIS, COILED COIL, ENVELOPE PROTEIN, FUSION PROTEIN, HOST-VIRUS INTERACTION, MEMBRANE, TRANSMEMBRANE, VIRION, VIRAL PROTEIN, Cleavage on pair of basic residues, Lipoprotein, Palmitate, Viral immunoevasion
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 3  ? LEU A 41 ? THR A 3  LEU A 41 1 ? 39 
HELX_P HELX_P2 2 GLU A 53 ? LEU A 84 ? GLU A 53 LEU A 84 1 ? 32 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          3CYO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3CYO 
_atom_sites.fract_transf_matrix[1][1]   0.016866 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016866 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016866 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  THR 1  1  ?  ?   ?   A . n 
A 1 2  LEU 2  2  ?  ?   ?   A . n 
A 1 3  THR 3  3  3  THR THR A . n 
A 1 4  VAL 4  4  4  VAL VAL A . n 
A 1 5  GLN 5  5  5  GLN GLN A . n 
A 1 6  ALA 6  6  6  ALA ALA A . n 
A 1 7  ARG 7  7  7  ARG ARG A . n 
A 1 8  GLN 8  8  8  GLN GLN A . n 
A 1 9  LEU 9  9  9  LEU LEU A . n 
A 1 10 LEU 10 10 10 LEU LEU A . n 
A 1 11 SER 11 11 11 SER SER A . n 
A 1 12 GLY 12 12 12 GLY GLY A . n 
A 1 13 ILE 13 13 13 ILE ILE A . n 
A 1 14 VAL 14 14 14 VAL VAL A . n 
A 1 15 GLN 15 15 15 GLN GLN A . n 
A 1 16 GLN 16 16 16 GLN GLN A . n 
A 1 17 GLN 17 17 17 GLN GLN A . n 
A 1 18 ASN 18 18 18 ASN ASN A . n 
A 1 19 ASP 19 19 19 ASP ASP A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 LEU 21 21 21 LEU LEU A . n 
A 1 22 ARG 22 22 22 ARG ARG A . n 
A 1 23 ALA 23 23 23 ALA ALA A . n 
A 1 24 ILE 24 24 24 ILE ILE A . n 
A 1 25 GLU 25 25 25 GLU GLU A . n 
A 1 26 ALA 26 26 26 ALA ALA A . n 
A 1 27 GLN 27 27 27 GLN GLN A . n 
A 1 28 GLN 28 28 28 GLN GLN A . n 
A 1 29 HIS 29 29 29 HIS HIS A . n 
A 1 30 LEU 30 30 30 LEU LEU A . n 
A 1 31 LEU 31 31 31 LEU LEU A . n 
A 1 32 GLN 32 32 32 GLN GLN A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 THR 34 34 34 THR THR A . n 
A 1 35 VAL 35 35 35 VAL VAL A . n 
A 1 36 TRP 36 36 36 TRP TRP A . n 
A 1 37 GLY 37 37 37 GLY GLY A . n 
A 1 38 ILE 38 38 38 ILE ILE A . n 
A 1 39 LYS 39 39 39 LYS LYS A . n 
A 1 40 GLN 40 40 40 GLN GLN A . n 
A 1 41 LEU 41 41 41 LEU LEU A . n 
A 1 42 GLN 42 42 ?  ?   ?   A . n 
A 1 43 ALA 43 43 ?  ?   ?   A . n 
A 1 44 ARG 44 44 ?  ?   ?   A . n 
A 1 45 SER 45 45 ?  ?   ?   A . n 
A 1 46 GLY 46 46 ?  ?   ?   A . n 
A 1 47 GLY 47 47 ?  ?   ?   A . n 
A 1 48 ARG 48 48 ?  ?   ?   A . n 
A 1 49 GLY 49 49 ?  ?   ?   A . n 
A 1 50 GLY 50 50 ?  ?   ?   A . n 
A 1 51 TRP 51 51 ?  ?   ?   A . n 
A 1 52 MET 52 52 52 MET MET A . n 
A 1 53 GLU 53 53 53 GLU GLU A . n 
A 1 54 TRP 54 54 54 TRP TRP A . n 
A 1 55 ASP 55 55 55 ASP ASP A . n 
A 1 56 ARG 56 56 56 ARG ARG A . n 
A 1 57 GLU 57 57 57 GLU GLU A . n 
A 1 58 ILE 58 58 58 ILE ILE A . n 
A 1 59 ASN 59 59 59 ASN ASN A . n 
A 1 60 ASN 60 60 60 ASN ASN A . n 
A 1 61 TYR 61 61 61 TYR TYR A . n 
A 1 62 THR 62 62 62 THR THR A . n 
A 1 63 SER 63 63 63 SER SER A . n 
A 1 64 LEU 64 64 64 LEU LEU A . n 
A 1 65 ILE 65 65 65 ILE ILE A . n 
A 1 66 HIS 66 66 66 HIS HIS A . n 
A 1 67 SER 67 67 67 SER SER A . n 
A 1 68 LEU 68 68 68 LEU LEU A . n 
A 1 69 ILE 69 69 69 ILE ILE A . n 
A 1 70 GLU 70 70 70 GLU GLU A . n 
A 1 71 LYS 71 71 71 LYS LYS A . n 
A 1 72 SER 72 72 72 SER SER A . n 
A 1 73 GLN 73 73 73 GLN GLN A . n 
A 1 74 ASN 74 74 74 ASN ASN A . n 
A 1 75 GLN 75 75 75 GLN GLN A . n 
A 1 76 GLN 76 76 76 GLN GLN A . n 
A 1 77 GLU 77 77 77 GLU GLU A . n 
A 1 78 LYS 78 78 78 LYS LYS A . n 
A 1 79 ASN 79 79 79 ASN ASN A . n 
A 1 80 GLU 80 80 80 GLU GLU A . n 
A 1 81 GLN 81 81 81 GLN GLN A . n 
A 1 82 GLU 82 82 82 GLU GLU A . n 
A 1 83 LEU 83 83 83 LEU LEU A . n 
A 1 84 LEU 84 84 84 LEU LEU A . n 
A 1 85 GLU 85 85 85 GLU GLU A . n 
A 1 86 LEU 86 86 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  101 101 HOH HOH A . 
B 2 HOH 2  102 102 HOH HOH A . 
B 2 HOH 3  103 103 HOH HOH A . 
B 2 HOH 4  104 104 HOH HOH A . 
B 2 HOH 5  105 105 HOH HOH A . 
B 2 HOH 6  106 106 HOH HOH A . 
B 2 HOH 7  107 107 HOH HOH A . 
B 2 HOH 8  108 108 HOH HOH A . 
B 2 HOH 9  109 109 HOH HOH A . 
B 2 HOH 10 110 110 HOH HOH A . 
B 2 HOH 11 111 111 HOH HOH A . 
B 2 HOH 12 112 112 HOH HOH A . 
B 2 HOH 13 113 113 HOH HOH A . 
B 2 HOH 14 114 114 HOH HOH A . 
B 2 HOH 15 115 115 HOH HOH A . 
B 2 HOH 16 116 116 HOH HOH A . 
B 2 HOH 17 117 117 HOH HOH A . 
B 2 HOH 18 118 118 HOH HOH A . 
B 2 HOH 19 119 119 HOH HOH A . 
B 2 HOH 20 120 120 HOH HOH A . 
B 2 HOH 21 121 121 HOH HOH A . 
B 2 HOH 22 122 122 HOH HOH A . 
B 2 HOH 23 123 123 HOH HOH A . 
B 2 HOH 24 124 124 HOH HOH A . 
B 2 HOH 25 125 125 HOH HOH A . 
B 2 HOH 26 126 126 HOH HOH A . 
B 2 HOH 27 127 127 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7410  ? 
1 MORE         -63.7 ? 
1 'SSA (A^2)'  11280 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 
3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 101 ? B HOH . 
2 1 A HOH 102 ? B HOH . 
3 1 A HOH 103 ? B HOH . 
4 1 A HOH 104 ? B HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-06-17 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-08-16 
4 'Structure model' 1 3 2021-10-20 
5 'Structure model' 1 4 2023-08-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
3 3 'Structure model' 'Source and taxonomy'       
4 4 'Structure model' 'Database references'       
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen                
2 3 'Structure model' software                      
3 4 'Structure model' database_2                    
4 4 'Structure model' struct_ref_seq_dif            
5 5 'Structure model' chem_comp_atom                
6 5 'Structure model' chem_comp_bond                
7 5 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     THR 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      3 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     OG1 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    A 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    THR 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     3 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    OG1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A THR 1  ? A THR 1  
2  1 Y 1 A LEU 2  ? A LEU 2  
3  1 Y 1 A GLN 42 ? A GLN 42 
4  1 Y 1 A ALA 43 ? A ALA 43 
5  1 Y 1 A ARG 44 ? A ARG 44 
6  1 Y 1 A SER 45 ? A SER 45 
7  1 Y 1 A GLY 46 ? A GLY 46 
8  1 Y 1 A GLY 47 ? A GLY 47 
9  1 Y 1 A ARG 48 ? A ARG 48 
10 1 Y 1 A GLY 49 ? A GLY 49 
11 1 Y 1 A GLY 50 ? A GLY 50 
12 1 Y 1 A TRP 51 ? A TRP 51 
13 1 Y 1 A LEU 86 ? A LEU 86 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
HOH O    O N N 144 
HOH H1   H N N 145 
HOH H2   H N N 146 
ILE N    N N N 147 
ILE CA   C N S 148 
ILE C    C N N 149 
ILE O    O N N 150 
ILE CB   C N S 151 
ILE CG1  C N N 152 
ILE CG2  C N N 153 
ILE CD1  C N N 154 
ILE OXT  O N N 155 
ILE H    H N N 156 
ILE H2   H N N 157 
ILE HA   H N N 158 
ILE HB   H N N 159 
ILE HG12 H N N 160 
ILE HG13 H N N 161 
ILE HG21 H N N 162 
ILE HG22 H N N 163 
ILE HG23 H N N 164 
ILE HD11 H N N 165 
ILE HD12 H N N 166 
ILE HD13 H N N 167 
ILE HXT  H N N 168 
LEU N    N N N 169 
LEU CA   C N S 170 
LEU C    C N N 171 
LEU O    O N N 172 
LEU CB   C N N 173 
LEU CG   C N N 174 
LEU CD1  C N N 175 
LEU CD2  C N N 176 
LEU OXT  O N N 177 
LEU H    H N N 178 
LEU H2   H N N 179 
LEU HA   H N N 180 
LEU HB2  H N N 181 
LEU HB3  H N N 182 
LEU HG   H N N 183 
LEU HD11 H N N 184 
LEU HD12 H N N 185 
LEU HD13 H N N 186 
LEU HD21 H N N 187 
LEU HD22 H N N 188 
LEU HD23 H N N 189 
LEU HXT  H N N 190 
LYS N    N N N 191 
LYS CA   C N S 192 
LYS C    C N N 193 
LYS O    O N N 194 
LYS CB   C N N 195 
LYS CG   C N N 196 
LYS CD   C N N 197 
LYS CE   C N N 198 
LYS NZ   N N N 199 
LYS OXT  O N N 200 
LYS H    H N N 201 
LYS H2   H N N 202 
LYS HA   H N N 203 
LYS HB2  H N N 204 
LYS HB3  H N N 205 
LYS HG2  H N N 206 
LYS HG3  H N N 207 
LYS HD2  H N N 208 
LYS HD3  H N N 209 
LYS HE2  H N N 210 
LYS HE3  H N N 211 
LYS HZ1  H N N 212 
LYS HZ2  H N N 213 
LYS HZ3  H N N 214 
LYS HXT  H N N 215 
MET N    N N N 216 
MET CA   C N S 217 
MET C    C N N 218 
MET O    O N N 219 
MET CB   C N N 220 
MET CG   C N N 221 
MET SD   S N N 222 
MET CE   C N N 223 
MET OXT  O N N 224 
MET H    H N N 225 
MET H2   H N N 226 
MET HA   H N N 227 
MET HB2  H N N 228 
MET HB3  H N N 229 
MET HG2  H N N 230 
MET HG3  H N N 231 
MET HE1  H N N 232 
MET HE2  H N N 233 
MET HE3  H N N 234 
MET HXT  H N N 235 
SER N    N N N 236 
SER CA   C N S 237 
SER C    C N N 238 
SER O    O N N 239 
SER CB   C N N 240 
SER OG   O N N 241 
SER OXT  O N N 242 
SER H    H N N 243 
SER H2   H N N 244 
SER HA   H N N 245 
SER HB2  H N N 246 
SER HB3  H N N 247 
SER HG   H N N 248 
SER HXT  H N N 249 
THR N    N N N 250 
THR CA   C N S 251 
THR C    C N N 252 
THR O    O N N 253 
THR CB   C N R 254 
THR OG1  O N N 255 
THR CG2  C N N 256 
THR OXT  O N N 257 
THR H    H N N 258 
THR H2   H N N 259 
THR HA   H N N 260 
THR HB   H N N 261 
THR HG1  H N N 262 
THR HG21 H N N 263 
THR HG22 H N N 264 
THR HG23 H N N 265 
THR HXT  H N N 266 
TRP N    N N N 267 
TRP CA   C N S 268 
TRP C    C N N 269 
TRP O    O N N 270 
TRP CB   C N N 271 
TRP CG   C Y N 272 
TRP CD1  C Y N 273 
TRP CD2  C Y N 274 
TRP NE1  N Y N 275 
TRP CE2  C Y N 276 
TRP CE3  C Y N 277 
TRP CZ2  C Y N 278 
TRP CZ3  C Y N 279 
TRP CH2  C Y N 280 
TRP OXT  O N N 281 
TRP H    H N N 282 
TRP H2   H N N 283 
TRP HA   H N N 284 
TRP HB2  H N N 285 
TRP HB3  H N N 286 
TRP HD1  H N N 287 
TRP HE1  H N N 288 
TRP HE3  H N N 289 
TRP HZ2  H N N 290 
TRP HZ3  H N N 291 
TRP HH2  H N N 292 
TRP HXT  H N N 293 
TYR N    N N N 294 
TYR CA   C N S 295 
TYR C    C N N 296 
TYR O    O N N 297 
TYR CB   C N N 298 
TYR CG   C Y N 299 
TYR CD1  C Y N 300 
TYR CD2  C Y N 301 
TYR CE1  C Y N 302 
TYR CE2  C Y N 303 
TYR CZ   C Y N 304 
TYR OH   O N N 305 
TYR OXT  O N N 306 
TYR H    H N N 307 
TYR H2   H N N 308 
TYR HA   H N N 309 
TYR HB2  H N N 310 
TYR HB3  H N N 311 
TYR HD1  H N N 312 
TYR HD2  H N N 313 
TYR HE1  H N N 314 
TYR HE2  H N N 315 
TYR HH   H N N 316 
TYR HXT  H N N 317 
VAL N    N N N 318 
VAL CA   C N S 319 
VAL C    C N N 320 
VAL O    O N N 321 
VAL CB   C N N 322 
VAL CG1  C N N 323 
VAL CG2  C N N 324 
VAL OXT  O N N 325 
VAL H    H N N 326 
VAL H2   H N N 327 
VAL HA   H N N 328 
VAL HB   H N N 329 
VAL HG11 H N N 330 
VAL HG12 H N N 331 
VAL HG13 H N N 332 
VAL HG21 H N N 333 
VAL HG22 H N N 334 
VAL HG23 H N N 335 
VAL HXT  H N N 336 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
HOH O   H1   sing N N 137 
HOH O   H2   sing N N 138 
ILE N   CA   sing N N 139 
ILE N   H    sing N N 140 
ILE N   H2   sing N N 141 
ILE CA  C    sing N N 142 
ILE CA  CB   sing N N 143 
ILE CA  HA   sing N N 144 
ILE C   O    doub N N 145 
ILE C   OXT  sing N N 146 
ILE CB  CG1  sing N N 147 
ILE CB  CG2  sing N N 148 
ILE CB  HB   sing N N 149 
ILE CG1 CD1  sing N N 150 
ILE CG1 HG12 sing N N 151 
ILE CG1 HG13 sing N N 152 
ILE CG2 HG21 sing N N 153 
ILE CG2 HG22 sing N N 154 
ILE CG2 HG23 sing N N 155 
ILE CD1 HD11 sing N N 156 
ILE CD1 HD12 sing N N 157 
ILE CD1 HD13 sing N N 158 
ILE OXT HXT  sing N N 159 
LEU N   CA   sing N N 160 
LEU N   H    sing N N 161 
LEU N   H2   sing N N 162 
LEU CA  C    sing N N 163 
LEU CA  CB   sing N N 164 
LEU CA  HA   sing N N 165 
LEU C   O    doub N N 166 
LEU C   OXT  sing N N 167 
LEU CB  CG   sing N N 168 
LEU CB  HB2  sing N N 169 
LEU CB  HB3  sing N N 170 
LEU CG  CD1  sing N N 171 
LEU CG  CD2  sing N N 172 
LEU CG  HG   sing N N 173 
LEU CD1 HD11 sing N N 174 
LEU CD1 HD12 sing N N 175 
LEU CD1 HD13 sing N N 176 
LEU CD2 HD21 sing N N 177 
LEU CD2 HD22 sing N N 178 
LEU CD2 HD23 sing N N 179 
LEU OXT HXT  sing N N 180 
LYS N   CA   sing N N 181 
LYS N   H    sing N N 182 
LYS N   H2   sing N N 183 
LYS CA  C    sing N N 184 
LYS CA  CB   sing N N 185 
LYS CA  HA   sing N N 186 
LYS C   O    doub N N 187 
LYS C   OXT  sing N N 188 
LYS CB  CG   sing N N 189 
LYS CB  HB2  sing N N 190 
LYS CB  HB3  sing N N 191 
LYS CG  CD   sing N N 192 
LYS CG  HG2  sing N N 193 
LYS CG  HG3  sing N N 194 
LYS CD  CE   sing N N 195 
LYS CD  HD2  sing N N 196 
LYS CD  HD3  sing N N 197 
LYS CE  NZ   sing N N 198 
LYS CE  HE2  sing N N 199 
LYS CE  HE3  sing N N 200 
LYS NZ  HZ1  sing N N 201 
LYS NZ  HZ2  sing N N 202 
LYS NZ  HZ3  sing N N 203 
LYS OXT HXT  sing N N 204 
MET N   CA   sing N N 205 
MET N   H    sing N N 206 
MET N   H2   sing N N 207 
MET CA  C    sing N N 208 
MET CA  CB   sing N N 209 
MET CA  HA   sing N N 210 
MET C   O    doub N N 211 
MET C   OXT  sing N N 212 
MET CB  CG   sing N N 213 
MET CB  HB2  sing N N 214 
MET CB  HB3  sing N N 215 
MET CG  SD   sing N N 216 
MET CG  HG2  sing N N 217 
MET CG  HG3  sing N N 218 
MET SD  CE   sing N N 219 
MET CE  HE1  sing N N 220 
MET CE  HE2  sing N N 221 
MET CE  HE3  sing N N 222 
MET OXT HXT  sing N N 223 
SER N   CA   sing N N 224 
SER N   H    sing N N 225 
SER N   H2   sing N N 226 
SER CA  C    sing N N 227 
SER CA  CB   sing N N 228 
SER CA  HA   sing N N 229 
SER C   O    doub N N 230 
SER C   OXT  sing N N 231 
SER CB  OG   sing N N 232 
SER CB  HB2  sing N N 233 
SER CB  HB3  sing N N 234 
SER OG  HG   sing N N 235 
SER OXT HXT  sing N N 236 
THR N   CA   sing N N 237 
THR N   H    sing N N 238 
THR N   H2   sing N N 239 
THR CA  C    sing N N 240 
THR CA  CB   sing N N 241 
THR CA  HA   sing N N 242 
THR C   O    doub N N 243 
THR C   OXT  sing N N 244 
THR CB  OG1  sing N N 245 
THR CB  CG2  sing N N 246 
THR CB  HB   sing N N 247 
THR OG1 HG1  sing N N 248 
THR CG2 HG21 sing N N 249 
THR CG2 HG22 sing N N 250 
THR CG2 HG23 sing N N 251 
THR OXT HXT  sing N N 252 
TRP N   CA   sing N N 253 
TRP N   H    sing N N 254 
TRP N   H2   sing N N 255 
TRP CA  C    sing N N 256 
TRP CA  CB   sing N N 257 
TRP CA  HA   sing N N 258 
TRP C   O    doub N N 259 
TRP C   OXT  sing N N 260 
TRP CB  CG   sing N N 261 
TRP CB  HB2  sing N N 262 
TRP CB  HB3  sing N N 263 
TRP CG  CD1  doub Y N 264 
TRP CG  CD2  sing Y N 265 
TRP CD1 NE1  sing Y N 266 
TRP CD1 HD1  sing N N 267 
TRP CD2 CE2  doub Y N 268 
TRP CD2 CE3  sing Y N 269 
TRP NE1 CE2  sing Y N 270 
TRP NE1 HE1  sing N N 271 
TRP CE2 CZ2  sing Y N 272 
TRP CE3 CZ3  doub Y N 273 
TRP CE3 HE3  sing N N 274 
TRP CZ2 CH2  doub Y N 275 
TRP CZ2 HZ2  sing N N 276 
TRP CZ3 CH2  sing Y N 277 
TRP CZ3 HZ3  sing N N 278 
TRP CH2 HH2  sing N N 279 
TRP OXT HXT  sing N N 280 
TYR N   CA   sing N N 281 
TYR N   H    sing N N 282 
TYR N   H2   sing N N 283 
TYR CA  C    sing N N 284 
TYR CA  CB   sing N N 285 
TYR CA  HA   sing N N 286 
TYR C   O    doub N N 287 
TYR C   OXT  sing N N 288 
TYR CB  CG   sing N N 289 
TYR CB  HB2  sing N N 290 
TYR CB  HB3  sing N N 291 
TYR CG  CD1  doub Y N 292 
TYR CG  CD2  sing Y N 293 
TYR CD1 CE1  sing Y N 294 
TYR CD1 HD1  sing N N 295 
TYR CD2 CE2  doub Y N 296 
TYR CD2 HD2  sing N N 297 
TYR CE1 CZ   doub Y N 298 
TYR CE1 HE1  sing N N 299 
TYR CE2 CZ   sing Y N 300 
TYR CE2 HE2  sing N N 301 
TYR CZ  OH   sing N N 302 
TYR OH  HH   sing N N 303 
TYR OXT HXT  sing N N 304 
VAL N   CA   sing N N 305 
VAL N   H    sing N N 306 
VAL N   H2   sing N N 307 
VAL CA  C    sing N N 308 
VAL CA  CB   sing N N 309 
VAL CA  HA   sing N N 310 
VAL C   O    doub N N 311 
VAL C   OXT  sing N N 312 
VAL CB  CG1  sing N N 313 
VAL CB  CG2  sing N N 314 
VAL CB  HB   sing N N 315 
VAL CG1 HG11 sing N N 316 
VAL CG1 HG12 sing N N 317 
VAL CG1 HG13 sing N N 318 
VAL CG2 HG21 sing N N 319 
VAL CG2 HG22 sing N N 320 
VAL CG2 HG23 sing N N 321 
VAL OXT HXT  sing N N 322 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   1ENV 
_pdbx_initial_refinement_model.details          'PDB ENTRY 1ENV' 
#