data_3E2I # _entry.id 3E2I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3E2I pdb_00003e2i 10.2210/pdb3e2i/pdb RCSB RCSB048792 ? ? WWPDB D_1000048792 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-08-11 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 4 'Structure model' 1 3 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' chem_comp_atom 3 4 'Structure model' chem_comp_bond 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_entry_details 6 4 'Structure model' pdbx_modification_feature 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 3E2I _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-08-05 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lam, R.' 1 'Johns, K.' 2 'Battaile, K.P.' 3 'Romanov, V.' 4 'Lam, K.' 5 'Pai, E.F.' 6 'Chirgadze, N.Y.' 7 # _citation.id primary _citation.title 'Crystal structure of Thymidine Kinase from S. aureus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lam, R.' 1 ? primary 'Johns, K.' 2 ? primary 'Battaile, K.P.' 3 ? primary 'Romanov, V.' 4 ? primary 'Lam, K.' 5 ? primary 'Pai, E.F.' 6 ? primary 'Chirgadze, N.Y.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thymidine kinase' 24745.010 1 2.7.1.21 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 58 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GSSHHHHHHSSGLVPRGSH(MSE)YETYHSGWIECITGS(MSE)FSGKSEELIRRLRRGIYAKQKVVVFKPAIDD RYHKEKVVSHNGNAIEAINISKASEI(MSE)THDLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLD(MSE)DF RGEPFEP(MSE)PKL(MSE)AVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYEPRCRAHHIVAPS DNNKEEL ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG NAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMAVSEQVTK LQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYEPRCRAHHIVAPSDNNKEEL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 GLYCEROL GOL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MSE n 1 22 TYR n 1 23 GLU n 1 24 THR n 1 25 TYR n 1 26 HIS n 1 27 SER n 1 28 GLY n 1 29 TRP n 1 30 ILE n 1 31 GLU n 1 32 CYS n 1 33 ILE n 1 34 THR n 1 35 GLY n 1 36 SER n 1 37 MSE n 1 38 PHE n 1 39 SER n 1 40 GLY n 1 41 LYS n 1 42 SER n 1 43 GLU n 1 44 GLU n 1 45 LEU n 1 46 ILE n 1 47 ARG n 1 48 ARG n 1 49 LEU n 1 50 ARG n 1 51 ARG n 1 52 GLY n 1 53 ILE n 1 54 TYR n 1 55 ALA n 1 56 LYS n 1 57 GLN n 1 58 LYS n 1 59 VAL n 1 60 VAL n 1 61 VAL n 1 62 PHE n 1 63 LYS n 1 64 PRO n 1 65 ALA n 1 66 ILE n 1 67 ASP n 1 68 ASP n 1 69 ARG n 1 70 TYR n 1 71 HIS n 1 72 LYS n 1 73 GLU n 1 74 LYS n 1 75 VAL n 1 76 VAL n 1 77 SER n 1 78 HIS n 1 79 ASN n 1 80 GLY n 1 81 ASN n 1 82 ALA n 1 83 ILE n 1 84 GLU n 1 85 ALA n 1 86 ILE n 1 87 ASN n 1 88 ILE n 1 89 SER n 1 90 LYS n 1 91 ALA n 1 92 SER n 1 93 GLU n 1 94 ILE n 1 95 MSE n 1 96 THR n 1 97 HIS n 1 98 ASP n 1 99 LEU n 1 100 THR n 1 101 ASN n 1 102 VAL n 1 103 ASP n 1 104 VAL n 1 105 ILE n 1 106 GLY n 1 107 ILE n 1 108 ASP n 1 109 GLU n 1 110 VAL n 1 111 GLN n 1 112 PHE n 1 113 PHE n 1 114 ASP n 1 115 ASP n 1 116 GLU n 1 117 ILE n 1 118 VAL n 1 119 SER n 1 120 ILE n 1 121 VAL n 1 122 GLU n 1 123 LYS n 1 124 LEU n 1 125 SER n 1 126 ALA n 1 127 ASP n 1 128 GLY n 1 129 HIS n 1 130 ARG n 1 131 VAL n 1 132 ILE n 1 133 VAL n 1 134 ALA n 1 135 GLY n 1 136 LEU n 1 137 ASP n 1 138 MSE n 1 139 ASP n 1 140 PHE n 1 141 ARG n 1 142 GLY n 1 143 GLU n 1 144 PRO n 1 145 PHE n 1 146 GLU n 1 147 PRO n 1 148 MSE n 1 149 PRO n 1 150 LYS n 1 151 LEU n 1 152 MSE n 1 153 ALA n 1 154 VAL n 1 155 SER n 1 156 GLU n 1 157 GLN n 1 158 VAL n 1 159 THR n 1 160 LYS n 1 161 LEU n 1 162 GLN n 1 163 ALA n 1 164 VAL n 1 165 CYS n 1 166 ALA n 1 167 VAL n 1 168 CYS n 1 169 GLY n 1 170 SER n 1 171 SER n 1 172 SER n 1 173 SER n 1 174 ARG n 1 175 THR n 1 176 GLN n 1 177 ARG n 1 178 LEU n 1 179 ILE n 1 180 ASN n 1 181 GLY n 1 182 LYS n 1 183 PRO n 1 184 ALA n 1 185 LYS n 1 186 ILE n 1 187 ASP n 1 188 ASP n 1 189 PRO n 1 190 ILE n 1 191 ILE n 1 192 LEU n 1 193 VAL n 1 194 GLY n 1 195 ALA n 1 196 ASN n 1 197 GLU n 1 198 SER n 1 199 TYR n 1 200 GLU n 1 201 PRO n 1 202 ARG n 1 203 CYS n 1 204 ARG n 1 205 ALA n 1 206 HIS n 1 207 HIS n 1 208 ILE n 1 209 VAL n 1 210 ALA n 1 211 PRO n 1 212 SER n 1 213 ASP n 1 214 ASN n 1 215 ASN n 1 216 LYS n 1 217 GLU n 1 218 GLU n 1 219 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene tdk _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)CodonPlus RIPL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MSE 21 1 ? ? ? A . n A 1 22 TYR 22 2 ? ? ? A . n A 1 23 GLU 23 3 ? ? ? A . n A 1 24 THR 24 4 ? ? ? A . n A 1 25 TYR 25 5 ? ? ? A . n A 1 26 HIS 26 6 ? ? ? A . n A 1 27 SER 27 7 7 SER SER A . n A 1 28 GLY 28 8 8 GLY GLY A . n A 1 29 TRP 29 9 9 TRP TRP A . n A 1 30 ILE 30 10 10 ILE ILE A . n A 1 31 GLU 31 11 11 GLU GLU A . n A 1 32 CYS 32 12 12 CYS CYS A . n A 1 33 ILE 33 13 13 ILE ILE A . n A 1 34 THR 34 14 14 THR THR A . n A 1 35 GLY 35 15 15 GLY GLY A . n A 1 36 SER 36 16 16 SER SER A . n A 1 37 MSE 37 17 17 MSE MSE A . n A 1 38 PHE 38 18 18 PHE PHE A . n A 1 39 SER 39 19 19 SER SER A . n A 1 40 GLY 40 20 20 GLY GLY A . n A 1 41 LYS 41 21 21 LYS LYS A . n A 1 42 SER 42 22 22 SER SER A . n A 1 43 GLU 43 23 23 GLU GLU A . n A 1 44 GLU 44 24 24 GLU GLU A . n A 1 45 LEU 45 25 25 LEU LEU A . n A 1 46 ILE 46 26 26 ILE ILE A . n A 1 47 ARG 47 27 27 ARG ARG A . n A 1 48 ARG 48 28 28 ARG ARG A . n A 1 49 LEU 49 29 29 LEU LEU A . n A 1 50 ARG 50 30 30 ARG ARG A . n A 1 51 ARG 51 31 31 ARG ARG A . n A 1 52 GLY 52 32 32 GLY GLY A . n A 1 53 ILE 53 33 33 ILE ILE A . n A 1 54 TYR 54 34 34 TYR TYR A . n A 1 55 ALA 55 35 35 ALA ALA A . n A 1 56 LYS 56 36 36 LYS LYS A . n A 1 57 GLN 57 37 37 GLN GLN A . n A 1 58 LYS 58 38 38 LYS LYS A . n A 1 59 VAL 59 39 39 VAL VAL A . n A 1 60 VAL 60 40 40 VAL VAL A . n A 1 61 VAL 61 41 41 VAL VAL A . n A 1 62 PHE 62 42 42 PHE PHE A . n A 1 63 LYS 63 43 43 LYS LYS A . n A 1 64 PRO 64 44 44 PRO PRO A . n A 1 65 ALA 65 45 45 ALA ALA A . n A 1 66 ILE 66 46 ? ? ? A . n A 1 67 ASP 67 47 ? ? ? A . n A 1 68 ASP 68 48 ? ? ? A . n A 1 69 ARG 69 49 ? ? ? A . n A 1 70 TYR 70 50 ? ? ? A . n A 1 71 HIS 71 51 ? ? ? A . n A 1 72 LYS 72 52 ? ? ? A . n A 1 73 GLU 73 53 ? ? ? A . n A 1 74 LYS 74 54 ? ? ? A . n A 1 75 VAL 75 55 ? ? ? A . n A 1 76 VAL 76 56 ? ? ? A . n A 1 77 SER 77 57 57 SER SER A . n A 1 78 HIS 78 58 58 HIS HIS A . n A 1 79 ASN 79 59 59 ASN ASN A . n A 1 80 GLY 80 60 60 GLY GLY A . n A 1 81 ASN 81 61 61 ASN ASN A . n A 1 82 ALA 82 62 62 ALA ALA A . n A 1 83 ILE 83 63 63 ILE ILE A . n A 1 84 GLU 84 64 64 GLU GLU A . n A 1 85 ALA 85 65 65 ALA ALA A . n A 1 86 ILE 86 66 66 ILE ILE A . n A 1 87 ASN 87 67 67 ASN ASN A . n A 1 88 ILE 88 68 68 ILE ILE A . n A 1 89 SER 89 69 69 SER SER A . n A 1 90 LYS 90 70 70 LYS LYS A . n A 1 91 ALA 91 71 71 ALA ALA A . n A 1 92 SER 92 72 72 SER SER A . n A 1 93 GLU 93 73 73 GLU GLU A . n A 1 94 ILE 94 74 74 ILE ILE A . n A 1 95 MSE 95 75 75 MSE MSE A . n A 1 96 THR 96 76 76 THR THR A . n A 1 97 HIS 97 77 77 HIS HIS A . n A 1 98 ASP 98 78 78 ASP ASP A . n A 1 99 LEU 99 79 79 LEU LEU A . n A 1 100 THR 100 80 80 THR THR A . n A 1 101 ASN 101 81 81 ASN ASN A . n A 1 102 VAL 102 82 82 VAL VAL A . n A 1 103 ASP 103 83 83 ASP ASP A . n A 1 104 VAL 104 84 84 VAL VAL A . n A 1 105 ILE 105 85 85 ILE ILE A . n A 1 106 GLY 106 86 86 GLY GLY A . n A 1 107 ILE 107 87 87 ILE ILE A . n A 1 108 ASP 108 88 88 ASP ASP A . n A 1 109 GLU 109 89 89 GLU GLU A . n A 1 110 VAL 110 90 90 VAL VAL A . n A 1 111 GLN 111 91 91 GLN GLN A . n A 1 112 PHE 112 92 92 PHE PHE A . n A 1 113 PHE 113 93 93 PHE PHE A . n A 1 114 ASP 114 94 94 ASP ASP A . n A 1 115 ASP 115 95 95 ASP ASP A . n A 1 116 GLU 116 96 96 GLU GLU A . n A 1 117 ILE 117 97 97 ILE ILE A . n A 1 118 VAL 118 98 98 VAL VAL A . n A 1 119 SER 119 99 99 SER SER A . n A 1 120 ILE 120 100 100 ILE ILE A . n A 1 121 VAL 121 101 101 VAL VAL A . n A 1 122 GLU 122 102 102 GLU GLU A . n A 1 123 LYS 123 103 103 LYS LYS A . n A 1 124 LEU 124 104 104 LEU LEU A . n A 1 125 SER 125 105 105 SER SER A . n A 1 126 ALA 126 106 106 ALA ALA A . n A 1 127 ASP 127 107 107 ASP ASP A . n A 1 128 GLY 128 108 108 GLY GLY A . n A 1 129 HIS 129 109 109 HIS HIS A . n A 1 130 ARG 130 110 110 ARG ARG A . n A 1 131 VAL 131 111 111 VAL VAL A . n A 1 132 ILE 132 112 112 ILE ILE A . n A 1 133 VAL 133 113 113 VAL VAL A . n A 1 134 ALA 134 114 114 ALA ALA A . n A 1 135 GLY 135 115 115 GLY GLY A . n A 1 136 LEU 136 116 116 LEU LEU A . n A 1 137 ASP 137 117 117 ASP ASP A . n A 1 138 MSE 138 118 118 MSE MSE A . n A 1 139 ASP 139 119 119 ASP ASP A . n A 1 140 PHE 140 120 120 PHE PHE A . n A 1 141 ARG 141 121 121 ARG ARG A . n A 1 142 GLY 142 122 122 GLY GLY A . n A 1 143 GLU 143 123 123 GLU GLU A . n A 1 144 PRO 144 124 124 PRO PRO A . n A 1 145 PHE 145 125 125 PHE PHE A . n A 1 146 GLU 146 126 126 GLU GLU A . n A 1 147 PRO 147 127 127 PRO PRO A . n A 1 148 MSE 148 128 128 MSE MSE A . n A 1 149 PRO 149 129 129 PRO PRO A . n A 1 150 LYS 150 130 130 LYS LYS A . n A 1 151 LEU 151 131 131 LEU LEU A . n A 1 152 MSE 152 132 132 MSE MSE A . n A 1 153 ALA 153 133 133 ALA ALA A . n A 1 154 VAL 154 134 134 VAL VAL A . n A 1 155 SER 155 135 135 SER SER A . n A 1 156 GLU 156 136 136 GLU GLU A . n A 1 157 GLN 157 137 137 GLN GLN A . n A 1 158 VAL 158 138 138 VAL VAL A . n A 1 159 THR 159 139 139 THR THR A . n A 1 160 LYS 160 140 140 LYS LYS A . n A 1 161 LEU 161 141 141 LEU LEU A . n A 1 162 GLN 162 142 142 GLN GLN A . n A 1 163 ALA 163 143 143 ALA ALA A . n A 1 164 VAL 164 144 144 VAL VAL A . n A 1 165 CYS 165 145 145 CYS CYS A . n A 1 166 ALA 166 146 146 ALA ALA A . n A 1 167 VAL 167 147 147 VAL VAL A . n A 1 168 CYS 168 148 148 CYS CYS A . n A 1 169 GLY 169 149 149 GLY GLY A . n A 1 170 SER 170 150 150 SER SER A . n A 1 171 SER 171 151 151 SER SER A . n A 1 172 SER 172 152 152 SER SER A . n A 1 173 SER 173 153 153 SER SER A . n A 1 174 ARG 174 154 154 ARG ARG A . n A 1 175 THR 175 155 155 THR THR A . n A 1 176 GLN 176 156 156 GLN GLN A . n A 1 177 ARG 177 157 157 ARG ARG A . n A 1 178 LEU 178 158 158 LEU LEU A . n A 1 179 ILE 179 159 159 ILE ILE A . n A 1 180 ASN 180 160 160 ASN ASN A . n A 1 181 GLY 181 161 161 GLY GLY A . n A 1 182 LYS 182 162 162 LYS LYS A . n A 1 183 PRO 183 163 163 PRO PRO A . n A 1 184 ALA 184 164 164 ALA ALA A . n A 1 185 LYS 185 165 165 LYS LYS A . n A 1 186 ILE 186 166 166 ILE ILE A . n A 1 187 ASP 187 167 167 ASP ASP A . n A 1 188 ASP 188 168 168 ASP ASP A . n A 1 189 PRO 189 169 169 PRO PRO A . n A 1 190 ILE 190 170 170 ILE ILE A . n A 1 191 ILE 191 171 171 ILE ILE A . n A 1 192 LEU 192 172 172 LEU LEU A . n A 1 193 VAL 193 173 173 VAL VAL A . n A 1 194 GLY 194 174 174 GLY GLY A . n A 1 195 ALA 195 175 175 ALA ALA A . n A 1 196 ASN 196 176 176 ASN ASN A . n A 1 197 GLU 197 177 177 GLU GLU A . n A 1 198 SER 198 178 178 SER SER A . n A 1 199 TYR 199 179 179 TYR TYR A . n A 1 200 GLU 200 180 180 GLU GLU A . n A 1 201 PRO 201 181 181 PRO PRO A . n A 1 202 ARG 202 182 182 ARG ARG A . n A 1 203 CYS 203 183 183 CYS CYS A . n A 1 204 ARG 204 184 184 ARG ARG A . n A 1 205 ALA 205 185 185 ALA ALA A . n A 1 206 HIS 206 186 186 HIS HIS A . n A 1 207 HIS 207 187 187 HIS HIS A . n A 1 208 ILE 208 188 188 ILE ILE A . n A 1 209 VAL 209 189 189 VAL VAL A . n A 1 210 ALA 210 190 190 ALA ALA A . n A 1 211 PRO 211 191 191 PRO PRO A . n A 1 212 SER 212 192 192 SER SER A . n A 1 213 ASP 213 193 ? ? ? A . n A 1 214 ASN 214 194 ? ? ? A . n A 1 215 ASN 215 195 ? ? ? A . n A 1 216 LYS 216 196 ? ? ? A . n A 1 217 GLU 217 197 ? ? ? A . n A 1 218 GLU 218 198 ? ? ? A . n A 1 219 LEU 219 199 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 200 1 ZN ZN A . C 3 GOL 1 201 100 GOL GOL A . D 4 HOH 1 202 1 HOH HOH A . D 4 HOH 2 203 2 HOH HOH A . D 4 HOH 3 204 3 HOH HOH A . D 4 HOH 4 205 4 HOH HOH A . D 4 HOH 5 206 5 HOH HOH A . D 4 HOH 6 207 6 HOH HOH A . D 4 HOH 7 208 7 HOH HOH A . D 4 HOH 8 209 8 HOH HOH A . D 4 HOH 9 210 9 HOH HOH A . D 4 HOH 10 211 10 HOH HOH A . D 4 HOH 11 212 11 HOH HOH A . D 4 HOH 12 213 12 HOH HOH A . D 4 HOH 13 214 13 HOH HOH A . D 4 HOH 14 215 14 HOH HOH A . D 4 HOH 15 216 15 HOH HOH A . D 4 HOH 16 217 16 HOH HOH A . D 4 HOH 17 218 17 HOH HOH A . D 4 HOH 18 219 18 HOH HOH A . D 4 HOH 19 220 19 HOH HOH A . D 4 HOH 20 221 20 HOH HOH A . D 4 HOH 21 222 21 HOH HOH A . D 4 HOH 22 223 22 HOH HOH A . D 4 HOH 23 224 23 HOH HOH A . D 4 HOH 24 225 24 HOH HOH A . D 4 HOH 25 226 25 HOH HOH A . D 4 HOH 26 227 26 HOH HOH A . D 4 HOH 27 228 27 HOH HOH A . D 4 HOH 28 229 28 HOH HOH A . D 4 HOH 29 230 29 HOH HOH A . D 4 HOH 30 231 30 HOH HOH A . D 4 HOH 31 232 31 HOH HOH A . D 4 HOH 32 233 32 HOH HOH A . D 4 HOH 33 234 33 HOH HOH A . D 4 HOH 34 235 34 HOH HOH A . D 4 HOH 35 236 35 HOH HOH A . D 4 HOH 36 237 36 HOH HOH A . D 4 HOH 37 238 37 HOH HOH A . D 4 HOH 38 239 38 HOH HOH A . D 4 HOH 39 240 39 HOH HOH A . D 4 HOH 40 241 40 HOH HOH A . D 4 HOH 41 242 41 HOH HOH A . D 4 HOH 42 243 42 HOH HOH A . D 4 HOH 43 244 43 HOH HOH A . D 4 HOH 44 245 44 HOH HOH A . D 4 HOH 45 246 45 HOH HOH A . D 4 HOH 46 247 46 HOH HOH A . D 4 HOH 47 248 47 HOH HOH A . D 4 HOH 48 249 48 HOH HOH A . D 4 HOH 49 250 49 HOH HOH A . D 4 HOH 50 251 50 HOH HOH A . D 4 HOH 51 252 51 HOH HOH A . D 4 HOH 52 253 52 HOH HOH A . D 4 HOH 53 254 53 HOH HOH A . D 4 HOH 54 255 54 HOH HOH A . D 4 HOH 55 256 55 HOH HOH A . D 4 HOH 56 257 56 HOH HOH A . D 4 HOH 57 258 57 HOH HOH A . D 4 HOH 58 259 58 HOH HOH A . # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 2 SHARP . ? package 'Eric de La Fortelle' sharp-develop@globalphasing.com phasing http://www.globalphasing.com/sharp/ ? ? 3 DM 5.0 ? program 'Kevin Cowtan' kowtan@ysbl.york.ac.uk phasing http://www.ccp4.ac.uk/dist/html/dm.html Fortran_77 ? 4 REFMAC refmac_5.5.0043 24/04/2001 program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 5 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 JDirector . ? ? ? ? 'data collection' ? ? ? 7 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 8 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? 9 # _cell.length_a 71.621 _cell.length_b 71.621 _cell.length_c 96.144 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3E2I _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 42 2 2' _symmetry.entry_id 3E2I _symmetry.Int_Tables_number 93 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 3E2I _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 50.63 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.temp 298.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '0.1M succinic acid pH 7.0, 15% PEG3350, cryo-protected using 20% glycerol, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2007-03-17 _diffrn_detector.details 'Si(111) double-crystal monochromator' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si(111) double-crystal monochromator' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979331 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.979331 _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 17-ID # _reflns.entry_id 3E2I _reflns.d_resolution_high 2.010 _reflns.d_resolution_low 50.000 _reflns.number_obs 17226 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_chi_squared 1.687 _reflns.pdbx_redundancy 24.500 _reflns.percent_possible_obs 99.700 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.01 2.08 ? ? ? 0.183 ? ? 0.836 22.90 ? 1649 97.90 1 1 2.08 2.17 ? ? ? 0.157 ? ? 0.920 25.20 ? 1684 100.00 2 1 2.17 2.26 ? ? ? 0.123 ? ? 1.025 25.20 ? 1687 100.00 3 1 2.26 2.38 ? ? ? 0.105 ? ? 1.135 25.20 ? 1695 100.00 4 1 2.38 2.53 ? ? ? 0.093 ? ? 1.285 25.10 ? 1710 100.00 5 1 2.53 2.73 ? ? ? 0.082 ? ? 1.591 25.10 ? 1702 100.00 6 1 2.73 3.00 ? ? ? 0.070 ? ? 1.762 24.90 ? 1716 100.00 7 1 3.00 3.44 ? ? ? 0.059 ? ? 1.972 24.80 ? 1736 100.00 8 1 3.44 4.33 ? ? ? 0.048 ? ? 2.431 24.50 ? 1762 100.00 9 1 4.33 50.00 ? ? ? 0.053 ? ? 3.813 22.60 ? 1885 99.30 10 1 # _refine.entry_id 3E2I _refine.ls_d_res_high 2.010 _refine.ls_d_res_low 44.810 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 99.920 _refine.ls_number_reflns_obs 17194 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : RESIDUAL ONLY ; _refine.ls_R_factor_obs 0.203 _refine.ls_R_factor_R_work 0.202 _refine.ls_wR_factor_R_work 0.203 _refine.ls_R_factor_R_free 0.237 _refine.ls_wR_factor_R_free 0.241 _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 871 _refine.B_iso_mean 17.265 _refine.aniso_B[1][1] 0.030 _refine.aniso_B[2][2] 0.030 _refine.aniso_B[3][3] -0.060 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.942 _refine.correlation_coeff_Fo_to_Fc_free 0.929 _refine.pdbx_overall_ESU_R 0.151 _refine.pdbx_overall_ESU_R_Free 0.143 _refine.overall_SU_ML 0.088 _refine.overall_SU_B 6.633 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.B_iso_max 40.04 _refine.B_iso_min 6.41 _refine.occupancy_max 1.00 _refine.occupancy_min 0.30 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1341 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 58 _refine_hist.number_atoms_total 1406 _refine_hist.d_res_high 2.010 _refine_hist.d_res_low 44.810 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1377 0.012 0.022 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1858 1.228 1.964 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 177 4.989 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 58 32.164 24.138 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 250 14.375 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 10 14.378 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 213 0.079 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 1016 0.005 0.021 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 875 0.681 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1419 1.309 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 502 2.255 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 437 3.701 4.500 ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_low _refine_ls_shell.d_res_high _refine_ls_shell.number_reflns_all _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free _refine_ls_shell.number_reflns_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.R_factor_all _refine_ls_shell.pdbx_refine_id 20 2.066 2.014 1232 99.919 1176 0.202 55 0.279 . . . . . 'X-RAY DIFFRACTION' 20 2.122 2.066 1218 100.000 1145 0.200 73 0.232 . . . . . 'X-RAY DIFFRACTION' 20 2.184 2.122 1188 100.000 1123 0.194 65 0.192 . . . . . 'X-RAY DIFFRACTION' 20 2.251 2.184 1143 100.000 1072 0.191 71 0.270 . . . . . 'X-RAY DIFFRACTION' 20 2.324 2.251 1100 100.000 1052 0.179 48 0.211 . . . . . 'X-RAY DIFFRACTION' 20 2.406 2.324 1078 100.000 1024 0.193 54 0.202 . . . . . 'X-RAY DIFFRACTION' 20 2.496 2.406 1044 100.000 991 0.197 53 0.234 . . . . . 'X-RAY DIFFRACTION' 20 2.598 2.496 999 100.000 941 0.231 58 0.295 . . . . . 'X-RAY DIFFRACTION' 20 2.713 2.598 964 100.000 919 0.234 45 0.253 . . . . . 'X-RAY DIFFRACTION' 20 2.845 2.713 936 100.000 888 0.223 48 0.306 . . . . . 'X-RAY DIFFRACTION' 20 2.998 2.845 887 100.000 840 0.226 47 0.309 . . . . . 'X-RAY DIFFRACTION' 20 3.179 2.998 839 100.000 788 0.213 51 0.266 . . . . . 'X-RAY DIFFRACTION' 20 3.397 3.179 810 100.000 773 0.215 37 0.269 . . . . . 'X-RAY DIFFRACTION' 20 3.668 3.397 738 100.000 696 0.194 42 0.188 . . . . . 'X-RAY DIFFRACTION' 20 4.015 3.668 694 100.000 665 0.181 29 0.211 . . . . . 'X-RAY DIFFRACTION' 20 4.484 4.015 624 100.000 600 0.174 24 0.140 . . . . . 'X-RAY DIFFRACTION' 20 5.170 4.484 574 100.000 551 0.164 23 0.254 . . . . . 'X-RAY DIFFRACTION' 20 6.310 5.170 488 100.000 468 0.220 20 0.208 . . . . . 'X-RAY DIFFRACTION' 20 8.837 6.310 394 99.746 377 0.208 16 0.201 . . . . . 'X-RAY DIFFRACTION' 20 44.811 8.837 258 95.349 234 0.260 12 0.286 . . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 3E2I _struct.title 'Crystal structure of Thymidine Kinase from S. aureus' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3E2I _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'ZN-BINDING, ATP-binding, DNA synthesis, Kinase, Nucleotide-binding, Transferase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q0H0G9_STAAU _struct_ref.pdbx_db_accession Q0H0G9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNGNAIEAINISKASEIMTHDLT NVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLIN GKPAKIDDPIILVGANESYEPRCRAHHIVAPSDNNKEEL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3E2I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 219 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q0H0G9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 199 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 199 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3E2I MSE A 1 ? UNP Q0H0G9 ? ? 'expression tag' -19 1 1 3E2I GLY A 2 ? UNP Q0H0G9 ? ? 'expression tag' -18 2 1 3E2I SER A 3 ? UNP Q0H0G9 ? ? 'expression tag' -17 3 1 3E2I SER A 4 ? UNP Q0H0G9 ? ? 'expression tag' -16 4 1 3E2I HIS A 5 ? UNP Q0H0G9 ? ? 'expression tag' -15 5 1 3E2I HIS A 6 ? UNP Q0H0G9 ? ? 'expression tag' -14 6 1 3E2I HIS A 7 ? UNP Q0H0G9 ? ? 'expression tag' -13 7 1 3E2I HIS A 8 ? UNP Q0H0G9 ? ? 'expression tag' -12 8 1 3E2I HIS A 9 ? UNP Q0H0G9 ? ? 'expression tag' -11 9 1 3E2I HIS A 10 ? UNP Q0H0G9 ? ? 'expression tag' -10 10 1 3E2I SER A 11 ? UNP Q0H0G9 ? ? 'expression tag' -9 11 1 3E2I SER A 12 ? UNP Q0H0G9 ? ? 'expression tag' -8 12 1 3E2I GLY A 13 ? UNP Q0H0G9 ? ? 'expression tag' -7 13 1 3E2I LEU A 14 ? UNP Q0H0G9 ? ? 'expression tag' -6 14 1 3E2I VAL A 15 ? UNP Q0H0G9 ? ? 'expression tag' -5 15 1 3E2I PRO A 16 ? UNP Q0H0G9 ? ? 'expression tag' -4 16 1 3E2I ARG A 17 ? UNP Q0H0G9 ? ? 'expression tag' -3 17 1 3E2I GLY A 18 ? UNP Q0H0G9 ? ? 'expression tag' -2 18 1 3E2I SER A 19 ? UNP Q0H0G9 ? ? 'expression tag' -1 19 1 3E2I HIS A 20 ? UNP Q0H0G9 ? ? 'expression tag' 0 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7300 ? 1 MORE -20 ? 1 'SSA (A^2)' 29300 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 71.6210000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 5_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 71.6210000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 6_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 40 ? ALA A 55 ? GLY A 20 ALA A 35 1 ? 16 HELX_P HELX_P2 2 LYS A 90 ? HIS A 97 ? LYS A 70 HIS A 77 5 ? 8 HELX_P HELX_P3 3 GLU A 109 ? ASP A 114 ? GLU A 89 ASP A 94 5 ? 6 HELX_P HELX_P4 4 ASP A 115 ? ASP A 127 ? ASP A 95 ASP A 107 1 ? 13 HELX_P HELX_P5 5 PRO A 147 ? SER A 155 ? PRO A 127 SER A 135 1 ? 9 HELX_P HELX_P6 6 CYS A 203 ? HIS A 207 ? CYS A 183 HIS A 187 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SER 36 C ? ? ? 1_555 A MSE 37 N ? ? A SER 16 A MSE 17 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? A MSE 37 C ? ? ? 1_555 A PHE 38 N ? ? A MSE 17 A PHE 18 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale3 covale both ? A ILE 94 C ? ? ? 1_555 A MSE 95 N ? ? A ILE 74 A MSE 75 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale4 covale both ? A MSE 95 C ? ? ? 1_555 A THR 96 N ? ? A MSE 75 A THR 76 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale5 covale both ? A ASP 137 C ? ? ? 1_555 A MSE 138 N ? ? A ASP 117 A MSE 118 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale6 covale both ? A MSE 138 C ? ? ? 1_555 A ASP 139 N ? ? A MSE 118 A ASP 119 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale7 covale both ? A PRO 147 C ? ? ? 1_555 A MSE 148 N ? ? A PRO 127 A MSE 128 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale8 covale both ? A MSE 148 C ? ? ? 1_555 A PRO 149 N ? ? A MSE 128 A PRO 129 1_555 ? ? ? ? ? ? ? 1.351 ? ? covale9 covale both ? A LEU 151 C ? ? ? 1_555 A MSE 152 N ? ? A LEU 131 A MSE 132 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale10 covale both ? A MSE 152 C ? ? ? 1_555 A ALA 153 N ? ? A MSE 132 A ALA 133 1_555 ? ? ? ? ? ? ? 1.329 ? ? metalc1 metalc ? ? A CYS 165 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 145 A ZN 200 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc2 metalc ? ? A CYS 168 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 148 A ZN 200 1_555 ? ? ? ? ? ? ? 2.311 ? ? metalc3 metalc ? ? A CYS 203 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 183 A ZN 200 1_555 ? ? ? ? ? ? ? 2.220 ? ? metalc4 metalc ? ? A HIS 206 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 186 A ZN 200 1_555 ? ? ? ? ? ? ? 2.253 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 165 ? A CYS 145 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 168 ? A CYS 148 ? 1_555 109.5 ? 2 SG ? A CYS 165 ? A CYS 145 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 203 ? A CYS 183 ? 1_555 113.9 ? 3 SG ? A CYS 168 ? A CYS 148 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 203 ? A CYS 183 ? 1_555 116.6 ? 4 SG ? A CYS 165 ? A CYS 145 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 ND1 ? A HIS 206 ? A HIS 186 ? 1_555 115.9 ? 5 SG ? A CYS 168 ? A CYS 148 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 ND1 ? A HIS 206 ? A HIS 186 ? 1_555 111.0 ? 6 SG ? A CYS 203 ? A CYS 183 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 ND1 ? A HIS 206 ? A HIS 186 ? 1_555 88.8 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 37 ? . . . . MSE A 17 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 95 ? . . . . MSE A 75 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 138 ? . . . . MSE A 118 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 148 ? . . . . MSE A 128 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 152 ? . . . . MSE A 132 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 146 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 126 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 147 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 127 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.30 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 84 ? ILE A 88 ? GLU A 64 ILE A 68 A 2 VAL A 59 ? PRO A 64 ? VAL A 39 PRO A 44 A 3 VAL A 104 ? ILE A 107 ? VAL A 84 ILE A 87 A 4 ARG A 130 ? LEU A 136 ? ARG A 110 LEU A 116 A 5 TRP A 29 ? GLY A 35 ? TRP A 9 GLY A 15 A 6 GLN A 157 ? LEU A 161 ? GLN A 137 LEU A 141 B 1 ALA A 163 ? VAL A 164 ? ALA A 143 VAL A 144 B 2 SER A 171 ? SER A 172 ? SER A 151 SER A 152 C 1 LYS A 182 ? PRO A 183 ? LYS A 162 PRO A 163 C 2 ARG A 174 ? ILE A 179 ? ARG A 154 ILE A 159 C 3 GLU A 197 ? ARG A 202 ? GLU A 177 ARG A 182 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 86 ? O ILE A 66 N VAL A 61 ? N VAL A 41 A 2 3 N VAL A 60 ? N VAL A 40 O GLY A 106 ? O GLY A 86 A 3 4 N ILE A 105 ? N ILE A 85 O ARG A 130 ? O ARG A 110 A 4 5 O VAL A 133 ? O VAL A 113 N ILE A 33 ? N ILE A 13 A 5 6 N THR A 34 ? N THR A 14 O LEU A 161 ? O LEU A 141 B 1 2 N ALA A 163 ? N ALA A 143 O SER A 172 ? O SER A 152 C 1 2 O LYS A 182 ? O LYS A 162 N ILE A 179 ? N ILE A 159 C 2 3 N LEU A 178 ? N LEU A 158 O SER A 198 ? O SER A 178 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 200 ? 4 'BINDING SITE FOR RESIDUE ZN A 200' AC2 Software A GOL 201 ? 9 'BINDING SITE FOR RESIDUE GOL A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 165 ? CYS A 145 . ? 1_555 ? 2 AC1 4 CYS A 168 ? CYS A 148 . ? 1_555 ? 3 AC1 4 CYS A 203 ? CYS A 183 . ? 1_555 ? 4 AC1 4 HIS A 206 ? HIS A 186 . ? 1_555 ? 5 AC2 9 SER A 36 ? SER A 16 . ? 1_555 ? 6 AC2 9 MSE A 37 ? MSE A 17 . ? 1_555 ? 7 AC2 9 PHE A 38 ? PHE A 18 . ? 1_555 ? 8 AC2 9 SER A 39 ? SER A 19 . ? 1_555 ? 9 AC2 9 GLY A 40 ? GLY A 20 . ? 1_555 ? 10 AC2 9 LYS A 41 ? LYS A 21 . ? 1_555 ? 11 AC2 9 SER A 42 ? SER A 22 . ? 1_555 ? 12 AC2 9 ARG A 51 ? ARG A 31 . ? 2_655 ? 13 AC2 9 HOH D . ? HOH A 227 . ? 1_555 ? # _pdbx_entry_details.entry_id 3E2I _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 CYS _pdbx_validate_rmsd_bond.auth_seq_id_1 12 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 SG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 CYS _pdbx_validate_rmsd_bond.auth_seq_id_2 12 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.710 _pdbx_validate_rmsd_bond.bond_target_value 1.812 _pdbx_validate_rmsd_bond.bond_deviation -0.102 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.016 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ALA _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 143 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -105.75 _pdbx_validate_torsion.psi -160.53 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 37 A MSE 17 ? MET SELENOMETHIONINE 2 A MSE 95 A MSE 75 ? MET SELENOMETHIONINE 3 A MSE 138 A MSE 118 ? MET SELENOMETHIONINE 4 A MSE 148 A MSE 128 ? MET SELENOMETHIONINE 5 A MSE 152 A MSE 132 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 225 ? D HOH . 2 1 A HOH 247 ? D HOH . # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 35.9370 _pdbx_refine_tls.origin_y 13.4810 _pdbx_refine_tls.origin_z 12.5360 _pdbx_refine_tls.T[1][1] 0.1067 _pdbx_refine_tls.T[2][2] 0.0441 _pdbx_refine_tls.T[3][3] 0.0789 _pdbx_refine_tls.T[1][2] 0.0002 _pdbx_refine_tls.T[1][3] -0.0117 _pdbx_refine_tls.T[2][3] -0.0359 _pdbx_refine_tls.L[1][1] 1.8770 _pdbx_refine_tls.L[2][2] 0.7463 _pdbx_refine_tls.L[3][3] 1.8932 _pdbx_refine_tls.L[1][2] -0.2124 _pdbx_refine_tls.L[1][3] -0.0657 _pdbx_refine_tls.L[2][3] -0.2179 _pdbx_refine_tls.S[1][1] 0.0030 _pdbx_refine_tls.S[2][2] -0.0289 _pdbx_refine_tls.S[3][3] 0.0258 _pdbx_refine_tls.S[1][2] -0.0797 _pdbx_refine_tls.S[1][3] 0.1575 _pdbx_refine_tls.S[2][3] -0.0553 _pdbx_refine_tls.S[2][1] 0.1532 _pdbx_refine_tls.S[3][1] -0.3488 _pdbx_refine_tls.S[3][2] -0.0403 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 192 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.beg_auth_seq_id 7 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 27 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 212 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _pdbx_phasing_MAD_set.id _pdbx_phasing_MAD_set.d_res_low _pdbx_phasing_MAD_set.d_res_high _pdbx_phasing_MAD_set.reflns_acentric _pdbx_phasing_MAD_set.reflns_centric _pdbx_phasing_MAD_set.R_cullis_acentric _pdbx_phasing_MAD_set.R_cullis_centric ISO_1 44.81 2.01 14469 2733 0.000 0.000 ANO_1 44.81 2.01 14468 0 0.431 0.000 # loop_ _pdbx_phasing_MAD_set_shell.id _pdbx_phasing_MAD_set_shell.d_res_low _pdbx_phasing_MAD_set_shell.d_res_high _pdbx_phasing_MAD_set_shell.reflns_acentric _pdbx_phasing_MAD_set_shell.reflns_centric _pdbx_phasing_MAD_set_shell.R_cullis_acentric _pdbx_phasing_MAD_set_shell.R_cullis_centric ISO_1 44.81 8.83 122 124 0.000 0.000 ISO_1 8.83 6.31 259 135 0.000 0.000 ISO_1 6.31 5.17 353 134 0.000 0.000 ISO_1 5.17 4.48 436 138 0.000 0.000 ISO_1 4.48 4.01 491 133 0.000 0.000 ISO_1 4.01 3.67 556 142 0.000 0.000 ISO_1 3.67 3.40 604 135 0.000 0.000 ISO_1 3.40 3.18 667 140 0.000 0.000 ISO_1 3.18 3.00 707 134 0.000 0.000 ISO_1 3.00 2.84 748 143 0.000 0.000 ISO_1 2.84 2.71 792 141 0.000 0.000 ISO_1 2.71 2.60 833 132 0.000 0.000 ISO_1 2.60 2.50 858 141 0.000 0.000 ISO_1 2.50 2.41 914 130 0.000 0.000 ISO_1 2.41 2.32 942 143 0.000 0.000 ISO_1 2.32 2.25 961 140 0.000 0.000 ISO_1 2.25 2.18 1007 133 0.000 0.000 ISO_1 2.18 2.12 1048 139 0.000 0.000 ISO_1 2.12 2.07 1075 141 0.000 0.000 ISO_1 2.07 2.01 1096 135 0.000 0.000 ANO_1 44.81 8.83 122 0 0.252 0.000 ANO_1 8.83 6.31 259 0 0.272 0.000 ANO_1 6.31 5.17 353 0 0.279 0.000 ANO_1 5.17 4.48 436 0 0.319 0.000 ANO_1 4.48 4.01 491 0 0.321 0.000 ANO_1 4.01 3.67 556 0 0.342 0.000 ANO_1 3.67 3.40 604 0 0.359 0.000 ANO_1 3.40 3.18 667 0 0.377 0.000 ANO_1 3.18 3.00 707 0 0.380 0.000 ANO_1 3.00 2.84 748 0 0.386 0.000 ANO_1 2.84 2.71 792 0 0.440 0.000 ANO_1 2.71 2.60 833 0 0.448 0.000 ANO_1 2.60 2.50 858 0 0.485 0.000 ANO_1 2.50 2.41 914 0 0.520 0.000 ANO_1 2.41 2.32 942 0 0.554 0.000 ANO_1 2.32 2.25 961 0 0.597 0.000 ANO_1 2.25 2.18 1007 0 0.648 0.000 ANO_1 2.18 2.12 1048 0 0.670 0.000 ANO_1 2.12 2.07 1075 0 0.715 0.000 ANO_1 2.07 2.01 1095 0 0.810 0.000 # loop_ _pdbx_phasing_MAD_set_site.id _pdbx_phasing_MAD_set_site.atom_type_symbol _pdbx_phasing_MAD_set_site.Cartn_x _pdbx_phasing_MAD_set_site.Cartn_y _pdbx_phasing_MAD_set_site.Cartn_z _pdbx_phasing_MAD_set_site.occupancy _pdbx_phasing_MAD_set_site.b_iso 1 SE 46.030 55.078 3.726 0.81 23.31 2 SE 36.775 57.097 2.459 0.80 24.91 3 SE 46.323 57.238 16.471 0.86 33.68 4 SE 34.161 56.851 6.515 0.50 24.66 5 SE 18.527 51.139 13.257 0.75 48.97 6 SE 56.566 64.910 6.367 0.43 33.06 # _pdbx_phasing_dm.entry_id 3E2I _pdbx_phasing_dm.method 'Solvent flattening and Histogram matching' _pdbx_phasing_dm.reflns 17202 # loop_ _pdbx_phasing_dm_shell.d_res_high _pdbx_phasing_dm_shell.d_res_low _pdbx_phasing_dm_shell.delta_phi_final _pdbx_phasing_dm_shell.delta_phi_initial _pdbx_phasing_dm_shell.fom_acentric _pdbx_phasing_dm_shell.fom_centric _pdbx_phasing_dm_shell.fom _pdbx_phasing_dm_shell.reflns_acentric _pdbx_phasing_dm_shell.reflns_centric _pdbx_phasing_dm_shell.reflns 6.860 100.000 66.400 ? ? ? 0.819 ? ? 506 5.380 6.860 60.200 ? ? ? 0.895 ? ? 503 4.670 5.380 60.500 ? ? ? 0.932 ? ? 510 4.210 4.670 53.400 ? ? ? 0.929 ? ? 506 3.900 4.210 55.000 ? ? ? 0.932 ? ? 506 3.660 3.900 57.200 ? ? ? 0.938 ? ? 504 3.470 3.660 59.200 ? ? ? 0.923 ? ? 515 3.310 3.470 58.500 ? ? ? 0.916 ? ? 523 3.170 3.310 55.100 ? ? ? 0.921 ? ? 539 3.040 3.170 58.200 ? ? ? 0.918 ? ? 585 2.930 3.040 62.700 ? ? ? 0.918 ? ? 588 2.830 2.930 56.200 ? ? ? 0.916 ? ? 610 2.740 2.830 53.600 ? ? ? 0.912 ? ? 620 2.660 2.740 58.300 ? ? ? 0.907 ? ? 663 2.580 2.660 58.400 ? ? ? 0.897 ? ? 676 2.510 2.580 59.000 ? ? ? 0.892 ? ? 691 2.450 2.510 60.200 ? ? ? 0.895 ? ? 701 2.390 2.450 57.100 ? ? ? 0.896 ? ? 707 2.330 2.390 59.100 ? ? ? 0.886 ? ? 739 2.280 2.330 59.900 ? ? ? 0.892 ? ? 770 2.230 2.280 63.300 ? ? ? 0.907 ? ? 748 2.190 2.230 63.300 ? ? ? 0.888 ? ? 788 2.140 2.190 59.000 ? ? ? 0.887 ? ? 804 2.100 2.140 63.000 ? ? ? 0.891 ? ? 791 2.070 2.100 63.300 ? ? ? 0.858 ? ? 853 2.010 2.070 69.700 ? ? ? 0.815 ? ? 1256 # _phasing.method SAD # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE -19 ? A MSE 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 1 Y 1 A MSE 1 ? A MSE 21 22 1 Y 1 A TYR 2 ? A TYR 22 23 1 Y 1 A GLU 3 ? A GLU 23 24 1 Y 1 A THR 4 ? A THR 24 25 1 Y 1 A TYR 5 ? A TYR 25 26 1 Y 1 A HIS 6 ? A HIS 26 27 1 Y 1 A ILE 46 ? A ILE 66 28 1 Y 1 A ASP 47 ? A ASP 67 29 1 Y 1 A ASP 48 ? A ASP 68 30 1 Y 1 A ARG 49 ? A ARG 69 31 1 Y 1 A TYR 50 ? A TYR 70 32 1 Y 1 A HIS 51 ? A HIS 71 33 1 Y 1 A LYS 52 ? A LYS 72 34 1 Y 1 A GLU 53 ? A GLU 73 35 1 Y 1 A LYS 54 ? A LYS 74 36 1 Y 1 A VAL 55 ? A VAL 75 37 1 Y 1 A VAL 56 ? A VAL 76 38 1 Y 1 A ASP 193 ? A ASP 213 39 1 Y 1 A ASN 194 ? A ASN 214 40 1 Y 1 A ASN 195 ? A ASN 215 41 1 Y 1 A LYS 196 ? A LYS 216 42 1 Y 1 A GLU 197 ? A GLU 217 43 1 Y 1 A GLU 198 ? A GLU 218 44 1 Y 1 A LEU 199 ? A LEU 219 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MSE N N N N 244 MSE CA C N S 245 MSE C C N N 246 MSE O O N N 247 MSE OXT O N N 248 MSE CB C N N 249 MSE CG C N N 250 MSE SE SE N N 251 MSE CE C N N 252 MSE H H N N 253 MSE H2 H N N 254 MSE HA H N N 255 MSE HXT H N N 256 MSE HB2 H N N 257 MSE HB3 H N N 258 MSE HG2 H N N 259 MSE HG3 H N N 260 MSE HE1 H N N 261 MSE HE2 H N N 262 MSE HE3 H N N 263 PHE N N N N 264 PHE CA C N S 265 PHE C C N N 266 PHE O O N N 267 PHE CB C N N 268 PHE CG C Y N 269 PHE CD1 C Y N 270 PHE CD2 C Y N 271 PHE CE1 C Y N 272 PHE CE2 C Y N 273 PHE CZ C Y N 274 PHE OXT O N N 275 PHE H H N N 276 PHE H2 H N N 277 PHE HA H N N 278 PHE HB2 H N N 279 PHE HB3 H N N 280 PHE HD1 H N N 281 PHE HD2 H N N 282 PHE HE1 H N N 283 PHE HE2 H N N 284 PHE HZ H N N 285 PHE HXT H N N 286 PRO N N N N 287 PRO CA C N S 288 PRO C C N N 289 PRO O O N N 290 PRO CB C N N 291 PRO CG C N N 292 PRO CD C N N 293 PRO OXT O N N 294 PRO H H N N 295 PRO HA H N N 296 PRO HB2 H N N 297 PRO HB3 H N N 298 PRO HG2 H N N 299 PRO HG3 H N N 300 PRO HD2 H N N 301 PRO HD3 H N N 302 PRO HXT H N N 303 SER N N N N 304 SER CA C N S 305 SER C C N N 306 SER O O N N 307 SER CB C N N 308 SER OG O N N 309 SER OXT O N N 310 SER H H N N 311 SER H2 H N N 312 SER HA H N N 313 SER HB2 H N N 314 SER HB3 H N N 315 SER HG H N N 316 SER HXT H N N 317 THR N N N N 318 THR CA C N S 319 THR C C N N 320 THR O O N N 321 THR CB C N R 322 THR OG1 O N N 323 THR CG2 C N N 324 THR OXT O N N 325 THR H H N N 326 THR H2 H N N 327 THR HA H N N 328 THR HB H N N 329 THR HG1 H N N 330 THR HG21 H N N 331 THR HG22 H N N 332 THR HG23 H N N 333 THR HXT H N N 334 TRP N N N N 335 TRP CA C N S 336 TRP C C N N 337 TRP O O N N 338 TRP CB C N N 339 TRP CG C Y N 340 TRP CD1 C Y N 341 TRP CD2 C Y N 342 TRP NE1 N Y N 343 TRP CE2 C Y N 344 TRP CE3 C Y N 345 TRP CZ2 C Y N 346 TRP CZ3 C Y N 347 TRP CH2 C Y N 348 TRP OXT O N N 349 TRP H H N N 350 TRP H2 H N N 351 TRP HA H N N 352 TRP HB2 H N N 353 TRP HB3 H N N 354 TRP HD1 H N N 355 TRP HE1 H N N 356 TRP HE3 H N N 357 TRP HZ2 H N N 358 TRP HZ3 H N N 359 TRP HH2 H N N 360 TRP HXT H N N 361 TYR N N N N 362 TYR CA C N S 363 TYR C C N N 364 TYR O O N N 365 TYR CB C N N 366 TYR CG C Y N 367 TYR CD1 C Y N 368 TYR CD2 C Y N 369 TYR CE1 C Y N 370 TYR CE2 C Y N 371 TYR CZ C Y N 372 TYR OH O N N 373 TYR OXT O N N 374 TYR H H N N 375 TYR H2 H N N 376 TYR HA H N N 377 TYR HB2 H N N 378 TYR HB3 H N N 379 TYR HD1 H N N 380 TYR HD2 H N N 381 TYR HE1 H N N 382 TYR HE2 H N N 383 TYR HH H N N 384 TYR HXT H N N 385 VAL N N N N 386 VAL CA C N S 387 VAL C C N N 388 VAL O O N N 389 VAL CB C N N 390 VAL CG1 C N N 391 VAL CG2 C N N 392 VAL OXT O N N 393 VAL H H N N 394 VAL H2 H N N 395 VAL HA H N N 396 VAL HB H N N 397 VAL HG11 H N N 398 VAL HG12 H N N 399 VAL HG13 H N N 400 VAL HG21 H N N 401 VAL HG22 H N N 402 VAL HG23 H N N 403 VAL HXT H N N 404 ZN ZN ZN N N 405 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MSE N CA sing N N 231 MSE N H sing N N 232 MSE N H2 sing N N 233 MSE CA C sing N N 234 MSE CA CB sing N N 235 MSE CA HA sing N N 236 MSE C O doub N N 237 MSE C OXT sing N N 238 MSE OXT HXT sing N N 239 MSE CB CG sing N N 240 MSE CB HB2 sing N N 241 MSE CB HB3 sing N N 242 MSE CG SE sing N N 243 MSE CG HG2 sing N N 244 MSE CG HG3 sing N N 245 MSE SE CE sing N N 246 MSE CE HE1 sing N N 247 MSE CE HE2 sing N N 248 MSE CE HE3 sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 THR N CA sing N N 303 THR N H sing N N 304 THR N H2 sing N N 305 THR CA C sing N N 306 THR CA CB sing N N 307 THR CA HA sing N N 308 THR C O doub N N 309 THR C OXT sing N N 310 THR CB OG1 sing N N 311 THR CB CG2 sing N N 312 THR CB HB sing N N 313 THR OG1 HG1 sing N N 314 THR CG2 HG21 sing N N 315 THR CG2 HG22 sing N N 316 THR CG2 HG23 sing N N 317 THR OXT HXT sing N N 318 TRP N CA sing N N 319 TRP N H sing N N 320 TRP N H2 sing N N 321 TRP CA C sing N N 322 TRP CA CB sing N N 323 TRP CA HA sing N N 324 TRP C O doub N N 325 TRP C OXT sing N N 326 TRP CB CG sing N N 327 TRP CB HB2 sing N N 328 TRP CB HB3 sing N N 329 TRP CG CD1 doub Y N 330 TRP CG CD2 sing Y N 331 TRP CD1 NE1 sing Y N 332 TRP CD1 HD1 sing N N 333 TRP CD2 CE2 doub Y N 334 TRP CD2 CE3 sing Y N 335 TRP NE1 CE2 sing Y N 336 TRP NE1 HE1 sing N N 337 TRP CE2 CZ2 sing Y N 338 TRP CE3 CZ3 doub Y N 339 TRP CE3 HE3 sing N N 340 TRP CZ2 CH2 doub Y N 341 TRP CZ2 HZ2 sing N N 342 TRP CZ3 CH2 sing Y N 343 TRP CZ3 HZ3 sing N N 344 TRP CH2 HH2 sing N N 345 TRP OXT HXT sing N N 346 TYR N CA sing N N 347 TYR N H sing N N 348 TYR N H2 sing N N 349 TYR CA C sing N N 350 TYR CA CB sing N N 351 TYR CA HA sing N N 352 TYR C O doub N N 353 TYR C OXT sing N N 354 TYR CB CG sing N N 355 TYR CB HB2 sing N N 356 TYR CB HB3 sing N N 357 TYR CG CD1 doub Y N 358 TYR CG CD2 sing Y N 359 TYR CD1 CE1 sing Y N 360 TYR CD1 HD1 sing N N 361 TYR CD2 CE2 doub Y N 362 TYR CD2 HD2 sing N N 363 TYR CE1 CZ doub Y N 364 TYR CE1 HE1 sing N N 365 TYR CE2 CZ sing Y N 366 TYR CE2 HE2 sing N N 367 TYR CZ OH sing N N 368 TYR OH HH sing N N 369 TYR OXT HXT sing N N 370 VAL N CA sing N N 371 VAL N H sing N N 372 VAL N H2 sing N N 373 VAL CA C sing N N 374 VAL CA CB sing N N 375 VAL CA HA sing N N 376 VAL C O doub N N 377 VAL C OXT sing N N 378 VAL CB CG1 sing N N 379 VAL CB CG2 sing N N 380 VAL CB HB sing N N 381 VAL CG1 HG11 sing N N 382 VAL CG1 HG12 sing N N 383 VAL CG1 HG13 sing N N 384 VAL CG2 HG21 sing N N 385 VAL CG2 HG22 sing N N 386 VAL CG2 HG23 sing N N 387 VAL OXT HXT sing N N 388 # _atom_sites.entry_id 3E2I _atom_sites.fract_transf_matrix[1][1] 0.013962 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013962 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010401 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE ZN # loop_