data_3FGS # _entry.id 3FGS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3FGS pdb_00003fgs 10.2210/pdb3fgs/pdb RCSB RCSB050571 ? ? WWPDB D_1000050571 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2O84 'Crystal structure of K206E mutant of N-lobe human transferrin' unspecified PDB 1a8e 'HUMAN SERUM TRANSFERRIN, RECOMBINANT N-TERMINAL LOBE' unspecified # _pdbx_database_status.entry_id 3FGS _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-12-08 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Halbrooks, P.J.' 1 'Mason, A.B.' 2 'Everse, S.J.' 3 # _citation.id primary _citation.title 'Structural and Functional Consequences of the Substitution of Glycine 65 with Arginine in the N-Lobe of Human Transferrin.' _citation.journal_abbrev Biochemistry _citation.journal_volume 48 _citation.page_first 1945 _citation.page_last 1953 _citation.year 2009 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19219998 _citation.pdbx_database_id_DOI 10.1021/bi802254x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mason, A.B.' 1 ? primary 'Halbrooks, P.J.' 2 ? primary 'James, N.G.' 3 ? primary 'Byrne, S.L.' 4 ? primary 'Grady, J.K.' 5 ? primary 'Chasteen, N.D.' 6 ? primary 'Bobst, C.E.' 7 ? primary 'Kaltashov, I.A.' 8 ? primary 'Smith, V.C.' 9 ? primary 'Macgillivray, R.T.' 10 ? primary 'Everse, S.J.' 11 ? # _cell.length_a 43.347 _cell.length_b 57.056 _cell.length_c 133.737 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3FGS _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.entry_id 3FGS _symmetry.Int_Tables_number 19 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Serotransferrin 37315.344 1 ? 'G65R, K206E' 'Peptidase S60 1 domain' ? 2 non-polymer syn 'CARBONATE ION' 60.009 1 ? ? ? ? 3 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 4 water nat water 18.015 269 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Transferrin, Siderophilin, Beta-1-metal-binding globulin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDARLVYDAYLAPNNLKPV VAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAP CADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKD CHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYV TAIRNLREGTCPEAPTD ; _entity_poly.pdbx_seq_one_letter_code_can ;VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDARLVYDAYLAPNNLKPV VAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAP CADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKD CHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYV TAIRNLREGTCPEAPTD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 PRO n 1 3 ASP n 1 4 LYS n 1 5 THR n 1 6 VAL n 1 7 ARG n 1 8 TRP n 1 9 CYS n 1 10 ALA n 1 11 VAL n 1 12 SER n 1 13 GLU n 1 14 HIS n 1 15 GLU n 1 16 ALA n 1 17 THR n 1 18 LYS n 1 19 CYS n 1 20 GLN n 1 21 SER n 1 22 PHE n 1 23 ARG n 1 24 ASP n 1 25 HIS n 1 26 MET n 1 27 LYS n 1 28 SER n 1 29 VAL n 1 30 ILE n 1 31 PRO n 1 32 SER n 1 33 ASP n 1 34 GLY n 1 35 PRO n 1 36 SER n 1 37 VAL n 1 38 ALA n 1 39 CYS n 1 40 VAL n 1 41 LYS n 1 42 LYS n 1 43 ALA n 1 44 SER n 1 45 TYR n 1 46 LEU n 1 47 ASP n 1 48 CYS n 1 49 ILE n 1 50 ARG n 1 51 ALA n 1 52 ILE n 1 53 ALA n 1 54 ALA n 1 55 ASN n 1 56 GLU n 1 57 ALA n 1 58 ASP n 1 59 ALA n 1 60 VAL n 1 61 THR n 1 62 LEU n 1 63 ASP n 1 64 ALA n 1 65 ARG n 1 66 LEU n 1 67 VAL n 1 68 TYR n 1 69 ASP n 1 70 ALA n 1 71 TYR n 1 72 LEU n 1 73 ALA n 1 74 PRO n 1 75 ASN n 1 76 ASN n 1 77 LEU n 1 78 LYS n 1 79 PRO n 1 80 VAL n 1 81 VAL n 1 82 ALA n 1 83 GLU n 1 84 PHE n 1 85 TYR n 1 86 GLY n 1 87 SER n 1 88 LYS n 1 89 GLU n 1 90 ASP n 1 91 PRO n 1 92 GLN n 1 93 THR n 1 94 PHE n 1 95 TYR n 1 96 TYR n 1 97 ALA n 1 98 VAL n 1 99 ALA n 1 100 VAL n 1 101 VAL n 1 102 LYS n 1 103 LYS n 1 104 ASP n 1 105 SER n 1 106 GLY n 1 107 PHE n 1 108 GLN n 1 109 MET n 1 110 ASN n 1 111 GLN n 1 112 LEU n 1 113 ARG n 1 114 GLY n 1 115 LYS n 1 116 LYS n 1 117 SER n 1 118 CYS n 1 119 HIS n 1 120 THR n 1 121 GLY n 1 122 LEU n 1 123 GLY n 1 124 ARG n 1 125 SER n 1 126 ALA n 1 127 GLY n 1 128 TRP n 1 129 ASN n 1 130 ILE n 1 131 PRO n 1 132 ILE n 1 133 GLY n 1 134 LEU n 1 135 LEU n 1 136 TYR n 1 137 CYS n 1 138 ASP n 1 139 LEU n 1 140 PRO n 1 141 GLU n 1 142 PRO n 1 143 ARG n 1 144 LYS n 1 145 PRO n 1 146 LEU n 1 147 GLU n 1 148 LYS n 1 149 ALA n 1 150 VAL n 1 151 ALA n 1 152 ASN n 1 153 PHE n 1 154 PHE n 1 155 SER n 1 156 GLY n 1 157 SER n 1 158 CYS n 1 159 ALA n 1 160 PRO n 1 161 CYS n 1 162 ALA n 1 163 ASP n 1 164 GLY n 1 165 THR n 1 166 ASP n 1 167 PHE n 1 168 PRO n 1 169 GLN n 1 170 LEU n 1 171 CYS n 1 172 GLN n 1 173 LEU n 1 174 CYS n 1 175 PRO n 1 176 GLY n 1 177 CYS n 1 178 GLY n 1 179 CYS n 1 180 SER n 1 181 THR n 1 182 LEU n 1 183 ASN n 1 184 GLN n 1 185 TYR n 1 186 PHE n 1 187 GLY n 1 188 TYR n 1 189 SER n 1 190 GLY n 1 191 ALA n 1 192 PHE n 1 193 LYS n 1 194 CYS n 1 195 LEU n 1 196 LYS n 1 197 ASP n 1 198 GLY n 1 199 ALA n 1 200 GLY n 1 201 ASP n 1 202 VAL n 1 203 ALA n 1 204 PHE n 1 205 VAL n 1 206 GLU n 1 207 HIS n 1 208 SER n 1 209 THR n 1 210 ILE n 1 211 PHE n 1 212 GLU n 1 213 ASN n 1 214 LEU n 1 215 ALA n 1 216 ASN n 1 217 LYS n 1 218 ALA n 1 219 ASP n 1 220 ARG n 1 221 ASP n 1 222 GLN n 1 223 TYR n 1 224 GLU n 1 225 LEU n 1 226 LEU n 1 227 CYS n 1 228 LEU n 1 229 ASP n 1 230 ASN n 1 231 THR n 1 232 ARG n 1 233 LYS n 1 234 PRO n 1 235 VAL n 1 236 ASP n 1 237 GLU n 1 238 TYR n 1 239 LYS n 1 240 ASP n 1 241 CYS n 1 242 HIS n 1 243 LEU n 1 244 ALA n 1 245 GLN n 1 246 VAL n 1 247 PRO n 1 248 SER n 1 249 HIS n 1 250 THR n 1 251 VAL n 1 252 VAL n 1 253 ALA n 1 254 ARG n 1 255 SER n 1 256 MET n 1 257 GLY n 1 258 GLY n 1 259 LYS n 1 260 GLU n 1 261 ASP n 1 262 LEU n 1 263 ILE n 1 264 TRP n 1 265 GLU n 1 266 LEU n 1 267 LEU n 1 268 ASN n 1 269 GLN n 1 270 ALA n 1 271 GLN n 1 272 GLU n 1 273 HIS n 1 274 PHE n 1 275 GLY n 1 276 LYS n 1 277 ASP n 1 278 LYS n 1 279 SER n 1 280 LYS n 1 281 GLU n 1 282 PHE n 1 283 GLN n 1 284 LEU n 1 285 PHE n 1 286 SER n 1 287 SER n 1 288 PRO n 1 289 HIS n 1 290 GLY n 1 291 LYS n 1 292 ASP n 1 293 LEU n 1 294 LEU n 1 295 PHE n 1 296 LYS n 1 297 ASP n 1 298 SER n 1 299 ALA n 1 300 HIS n 1 301 GLY n 1 302 PHE n 1 303 LEU n 1 304 LYS n 1 305 VAL n 1 306 PRO n 1 307 PRO n 1 308 ARG n 1 309 MET n 1 310 ASP n 1 311 ALA n 1 312 LYS n 1 313 MET n 1 314 TYR n 1 315 LEU n 1 316 GLY n 1 317 TYR n 1 318 GLU n 1 319 TYR n 1 320 VAL n 1 321 THR n 1 322 ALA n 1 323 ILE n 1 324 ARG n 1 325 ASN n 1 326 LEU n 1 327 ARG n 1 328 GLU n 1 329 GLY n 1 330 THR n 1 331 CYS n 1 332 PRO n 1 333 GLU n 1 334 ALA n 1 335 PRO n 1 336 THR n 1 337 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PRO1400, TF, transferrin' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Mesocricetus auratus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10036 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BHK _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNUT _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRFE_HUMAN _struct_ref.pdbx_db_accession P02787 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPV VAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAP CADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKD CHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYV TAIRNLREGTCPEAPTD ; _struct_ref.pdbx_align_begin 20 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3FGS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 337 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02787 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 356 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 337 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3FGS ARG A 65 ? UNP P02787 GLY 84 'engineered mutation' 65 1 1 3FGS GLU A 206 ? UNP P02787 LYS 225 'engineered mutation' 206 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CO3 non-polymer . 'CARBONATE ION' ? 'C O3 -2' 60.009 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3FGS _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 44.49 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.7 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.pdbx_details ;200 mM potassium acetate buffer (pH 7.7) containing 10 mM KCl and 18% polyethylene glycol 3350. Concentration of the mutant was 17.5 mg/mL. Crystals appeared in approximately a week following micro-seeding with wild-type N-lobe, VAPOR DIFFUSION, HANGING DROP, temperature 293K ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'MAR scanner 345 mm plate' _diffrn_detector.pdbx_collection_date 2001-08-07 _diffrn_detector.details 'Xenocs FOX-2D Multilayer Mirrors' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU300' _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.entry_id 3FGS _reflns.d_resolution_high 1.800 _reflns.d_resolution_low 30.000 _reflns.number_obs 29637 _reflns.pdbx_Rmerge_I_obs 0.049 _reflns.pdbx_chi_squared 1.511 _reflns.percent_possible_obs 93.300 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_netI_over_sigmaI ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 1.80 1.86 ? ? ? 0.113 ? ? 1.949 ? ? 2701 87.20 ? 1 1.86 1.94 ? ? ? 0.090 ? ? 1.927 ? ? 2819 90.30 ? 2 1.94 2.03 ? ? ? 0.077 ? ? 1.753 ? ? 2863 91.90 ? 3 2.03 2.13 ? ? ? 0.074 ? ? 1.840 ? ? 2908 92.70 ? 4 2.13 2.27 ? ? ? 0.062 ? ? 1.713 ? ? 2976 94.40 ? 5 2.27 2.44 ? ? ? 0.055 ? ? 1.497 ? ? 2999 95.20 ? 6 2.44 2.69 ? ? ? 0.052 ? ? 1.415 ? ? 3030 95.90 ? 7 2.69 3.08 ? ? ? 0.047 ? ? 1.318 ? ? 3089 96.70 ? 8 3.08 3.88 ? ? ? 0.043 ? ? 1.112 ? ? 3134 97.00 ? 9 3.88 30.00 ? ? ? 0.042 ? ? 1.097 ? ? 3118 91.40 ? 10 # _refine.entry_id 3FGS _refine.ls_d_res_high 1.800 _refine.ls_d_res_low 19.49 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 93.600 _refine.ls_number_reflns_obs 29542 _refine.ls_R_factor_R_work 0.216 _refine.ls_R_factor_R_free 0.246 _refine.ls_percent_reflns_R_free 9.400 _refine.ls_number_reflns_R_free 2976 _refine.B_iso_mean 14.999 _refine.solvent_model_param_bsol 36.137 _refine.aniso_B[1][1] -1.057 _refine.aniso_B[2][2] 0.768 _refine.aniso_B[3][3] 0.288 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.B_iso_max 45.94 _refine.B_iso_min 5.79 _refine.occupancy_max 1.00 _refine.occupancy_min 1.00 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.details ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2557 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 269 _refine_hist.number_atoms_total 2831 _refine_hist.d_res_high 1.800 _refine_hist.d_res_low 19.49 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_mcbond_it ? 0.760 1.500 ? 'X-RAY DIFFRACTION' ? c_scbond_it ? 1.252 2.000 ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? 1.192 2.000 ? 'X-RAY DIFFRACTION' ? c_scangle_it ? 1.852 2.500 ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param ? 'X-RAY DIFFRACTION' 2 water_rep.param ? 'X-RAY DIFFRACTION' 3 fe3.param ? 'X-RAY DIFFRACTION' 4 co3.param ? 'X-RAY DIFFRACTION' # _struct.entry_id 3FGS _struct.title 'Crystal structure of G65R/K206E double mutant of the N-lobe human transferrin' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3FGS _struct_keywords.text ;Human transferrin, Iron binding protein, Dilysine pair, Disease mutation, Glycoprotein, Ion transport, Iron, Iron transport, Metal-binding, Methylation, Phosphoprotein, Polymorphism, Secreted, Transport, METAL TRANSPORT ; _struct_keywords.pdbx_keywords 'METAL TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 12 ? ILE A 30 ? SER A 12 ILE A 30 1 ? 19 HELX_P HELX_P2 2 SER A 44 ? ALA A 54 ? SER A 44 ALA A 54 1 ? 11 HELX_P HELX_P3 3 ASP A 63 ? LEU A 72 ? ASP A 63 LEU A 72 1 ? 10 HELX_P HELX_P4 4 GLN A 108 ? LEU A 112 ? GLN A 108 LEU A 112 5 ? 5 HELX_P HELX_P5 5 TRP A 128 ? TYR A 136 ? TRP A 128 TYR A 136 1 ? 9 HELX_P HELX_P6 6 CYS A 137 ? LEU A 139 ? CYS A 137 LEU A 139 5 ? 3 HELX_P HELX_P7 7 PRO A 145 ? PHE A 154 ? PRO A 145 PHE A 154 1 ? 10 HELX_P HELX_P8 8 PHE A 167 ? GLN A 172 ? PHE A 167 GLN A 172 5 ? 6 HELX_P HELX_P9 9 PHE A 186 ? ASP A 197 ? PHE A 186 ASP A 197 1 ? 12 HELX_P HELX_P10 10 SER A 208 ? LEU A 214 ? SER A 208 LEU A 214 1 ? 7 HELX_P HELX_P11 11 ASN A 216 ? ASP A 221 ? ASN A 216 ASP A 221 1 ? 6 HELX_P HELX_P12 12 GLU A 237 ? CYS A 241 ? GLU A 237 CYS A 241 5 ? 5 HELX_P HELX_P13 13 LYS A 259 ? GLY A 275 ? LYS A 259 GLY A 275 1 ? 17 HELX_P HELX_P14 14 ASP A 310 ? GLY A 316 ? ASP A 310 GLY A 316 1 ? 7 HELX_P HELX_P15 15 GLY A 316 ? GLU A 328 ? GLY A 316 GLU A 328 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 9 A CYS 48 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf2 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 19 A CYS 39 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf3 disulf ? ? A CYS 118 SG ? ? ? 1_555 A CYS 194 SG ? ? A CYS 118 A CYS 194 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf4 disulf ? ? A CYS 137 SG ? ? ? 1_555 A CYS 331 SG ? ? A CYS 137 A CYS 331 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf5 disulf ? ? A CYS 158 SG ? ? ? 1_555 A CYS 174 SG ? ? A CYS 158 A CYS 174 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf6 disulf ? ? A CYS 161 SG ? ? ? 1_555 A CYS 179 SG ? ? A CYS 161 A CYS 179 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf7 disulf ? ? A CYS 171 SG ? ? ? 1_555 A CYS 177 SG ? ? A CYS 171 A CYS 177 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf8 disulf ? ? A CYS 227 SG ? ? ? 1_555 A CYS 241 SG ? ? A CYS 227 A CYS 241 1_555 ? ? ? ? ? ? ? 2.038 ? ? metalc1 metalc ? ? A ASP 63 OD1 ? ? ? 1_555 C FE . FE ? ? A ASP 63 A FE 402 1_555 ? ? ? ? ? ? ? 2.179 ? ? metalc2 metalc ? ? A TYR 95 OH ? ? ? 1_555 C FE . FE ? ? A TYR 95 A FE 402 1_555 ? ? ? ? ? ? ? 2.127 ? ? metalc3 metalc ? ? A TYR 188 OH ? ? ? 1_555 C FE . FE ? ? A TYR 188 A FE 402 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc4 metalc ? ? A HIS 249 NE2 ? ? ? 1_555 C FE . FE ? ? A HIS 249 A FE 402 1_555 ? ? ? ? ? ? ? 2.167 ? ? metalc5 metalc ? ? B CO3 . O1 ? ? ? 1_555 C FE . FE ? ? A CO3 401 A FE 402 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc6 metalc ? ? B CO3 . O2 ? ? ? 1_555 C FE . FE ? ? A CO3 401 A FE 402 1_555 ? ? ? ? ? ? ? 2.412 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 1 0.38 2 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 1 -0.13 3 LYS 144 A . ? LYS 144 A PRO 145 A ? PRO 145 A 1 -0.07 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 4 ? C ? 6 ? D ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? parallel C 2 3 ? parallel C 3 4 ? anti-parallel C 4 5 ? anti-parallel C 5 6 ? anti-parallel D 1 2 ? parallel D 2 3 ? parallel D 3 4 ? anti-parallel D 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 5 ? VAL A 11 ? THR A 5 VAL A 11 A 2 SER A 36 ? LYS A 42 ? SER A 36 LYS A 42 B 1 VAL A 60 ? LEU A 62 ? VAL A 60 LEU A 62 B 2 THR A 250 ? ARG A 254 ? THR A 250 ARG A 254 B 3 LEU A 77 ? PHE A 84 ? LEU A 77 PHE A 84 B 4 GLY A 301 ? LYS A 304 ? GLY A 301 LYS A 304 C 1 SER A 157 ? CYS A 158 ? SER A 157 CYS A 158 C 2 SER A 117 ? HIS A 119 ? SER A 117 HIS A 119 C 3 VAL A 202 ? GLU A 206 ? VAL A 202 GLU A 206 C 4 PHE A 94 ? LYS A 102 ? PHE A 94 LYS A 102 C 5 TYR A 223 ? LEU A 226 ? TYR A 223 LEU A 226 C 6 ARG A 232 ? LYS A 233 ? ARG A 232 LYS A 233 D 1 SER A 157 ? CYS A 158 ? SER A 157 CYS A 158 D 2 SER A 117 ? HIS A 119 ? SER A 117 HIS A 119 D 3 VAL A 202 ? GLU A 206 ? VAL A 202 GLU A 206 D 4 PHE A 94 ? LYS A 102 ? PHE A 94 LYS A 102 D 5 ALA A 244 ? PRO A 247 ? ALA A 244 PRO A 247 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TRP A 8 ? N TRP A 8 O VAL A 40 ? O VAL A 40 B 1 2 N LEU A 62 ? N LEU A 62 O THR A 250 ? O THR A 250 B 2 3 O VAL A 251 ? O VAL A 251 N VAL A 81 ? N VAL A 81 B 3 4 N ALA A 82 ? N ALA A 82 O LEU A 303 ? O LEU A 303 C 1 2 O CYS A 158 ? O CYS A 158 N HIS A 119 ? N HIS A 119 C 2 3 N CYS A 118 ? N CYS A 118 O VAL A 202 ? O VAL A 202 C 3 4 O VAL A 205 ? O VAL A 205 N VAL A 98 ? N VAL A 98 C 4 5 N VAL A 101 ? N VAL A 101 O GLU A 224 ? O GLU A 224 C 5 6 N LEU A 225 ? N LEU A 225 O LYS A 233 ? O LYS A 233 D 1 2 O CYS A 158 ? O CYS A 158 N HIS A 119 ? N HIS A 119 D 2 3 N CYS A 118 ? N CYS A 118 O VAL A 202 ? O VAL A 202 D 3 4 O VAL A 205 ? O VAL A 205 N VAL A 98 ? N VAL A 98 D 4 5 N ALA A 97 ? N ALA A 97 O ALA A 244 ? O ALA A 244 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CO3 401 ? 9 'BINDING SITE FOR RESIDUE CO3 A 401' AC2 Software A FE 402 ? 5 'BINDING SITE FOR RESIDUE FE A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 ASP A 63 ? ASP A 63 . ? 1_555 ? 2 AC1 9 TYR A 95 ? TYR A 95 . ? 1_555 ? 3 AC1 9 THR A 120 ? THR A 120 . ? 1_555 ? 4 AC1 9 ARG A 124 ? ARG A 124 . ? 1_555 ? 5 AC1 9 ALA A 126 ? ALA A 126 . ? 1_555 ? 6 AC1 9 GLY A 127 ? GLY A 127 . ? 1_555 ? 7 AC1 9 TYR A 188 ? TYR A 188 . ? 1_555 ? 8 AC1 9 HIS A 249 ? HIS A 249 . ? 1_555 ? 9 AC1 9 FE C . ? FE A 402 . ? 1_555 ? 10 AC2 5 ASP A 63 ? ASP A 63 . ? 1_555 ? 11 AC2 5 TYR A 95 ? TYR A 95 . ? 1_555 ? 12 AC2 5 TYR A 188 ? TYR A 188 . ? 1_555 ? 13 AC2 5 HIS A 249 ? HIS A 249 . ? 1_555 ? 14 AC2 5 CO3 B . ? CO3 A 401 . ? 1_555 ? # _atom_sites.entry_id 3FGS _atom_sites.fract_transf_matrix[1][1] 0.023070 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017527 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007477 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 CYS 118 118 118 CYS CYS A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 TRP 128 128 128 TRP TRP A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 CYS 137 137 137 CYS CYS A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 CYS 158 158 158 CYS CYS A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 PRO 168 168 168 PRO PRO A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 CYS 171 171 171 CYS CYS A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 CYS 174 174 174 CYS CYS A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 CYS 177 177 177 CYS CYS A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 CYS 179 179 179 CYS CYS A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 ASN 183 183 183 ASN ASN A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 TYR 188 188 188 TYR TYR A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 CYS 194 194 194 CYS CYS A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 PHE 204 204 204 PHE PHE A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 THR 209 209 209 THR THR A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 GLN 222 222 222 GLN GLN A . n A 1 223 TYR 223 223 223 TYR TYR A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 CYS 227 227 227 CYS CYS A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 ASP 229 229 229 ASP ASP A . n A 1 230 ASN 230 230 230 ASN ASN A . n A 1 231 THR 231 231 231 THR THR A . n A 1 232 ARG 232 232 232 ARG ARG A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 PRO 234 234 234 PRO PRO A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 TYR 238 238 238 TYR TYR A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 CYS 241 241 241 CYS CYS A . n A 1 242 HIS 242 242 242 HIS HIS A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 GLN 245 245 245 GLN GLN A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 PRO 247 247 247 PRO PRO A . n A 1 248 SER 248 248 248 SER SER A . n A 1 249 HIS 249 249 249 HIS HIS A . n A 1 250 THR 250 250 250 THR THR A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 VAL 252 252 252 VAL VAL A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 SER 255 255 255 SER SER A . n A 1 256 MET 256 256 256 MET MET A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 GLY 258 258 258 GLY GLY A . n A 1 259 LYS 259 259 259 LYS LYS A . n A 1 260 GLU 260 260 260 GLU GLU A . n A 1 261 ASP 261 261 261 ASP ASP A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 ILE 263 263 263 ILE ILE A . n A 1 264 TRP 264 264 264 TRP TRP A . n A 1 265 GLU 265 265 265 GLU GLU A . n A 1 266 LEU 266 266 266 LEU LEU A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 GLN 269 269 269 GLN GLN A . n A 1 270 ALA 270 270 270 ALA ALA A . n A 1 271 GLN 271 271 271 GLN GLN A . n A 1 272 GLU 272 272 272 GLU GLU A . n A 1 273 HIS 273 273 273 HIS HIS A . n A 1 274 PHE 274 274 274 PHE PHE A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 LYS 276 276 276 LYS LYS A . n A 1 277 ASP 277 277 277 ASP ASP A . n A 1 278 LYS 278 278 278 LYS LYS A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 LYS 280 280 280 LYS LYS A . n A 1 281 GLU 281 281 281 GLU GLU A . n A 1 282 PHE 282 282 282 PHE PHE A . n A 1 283 GLN 283 283 283 GLN GLN A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 PHE 285 285 285 PHE PHE A . n A 1 286 SER 286 286 286 SER SER A . n A 1 287 SER 287 287 287 SER SER A . n A 1 288 PRO 288 288 288 PRO PRO A . n A 1 289 HIS 289 289 289 HIS HIS A . n A 1 290 GLY 290 290 290 GLY GLY A . n A 1 291 LYS 291 291 291 LYS LYS A . n A 1 292 ASP 292 292 292 ASP ASP A . n A 1 293 LEU 293 293 293 LEU LEU A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 PHE 295 295 295 PHE PHE A . n A 1 296 LYS 296 296 296 LYS LYS A . n A 1 297 ASP 297 297 297 ASP ASP A . n A 1 298 SER 298 298 298 SER SER A . n A 1 299 ALA 299 299 299 ALA ALA A . n A 1 300 HIS 300 300 300 HIS HIS A . n A 1 301 GLY 301 301 301 GLY GLY A . n A 1 302 PHE 302 302 302 PHE PHE A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 LYS 304 304 304 LYS LYS A . n A 1 305 VAL 305 305 305 VAL VAL A . n A 1 306 PRO 306 306 306 PRO PRO A . n A 1 307 PRO 307 307 307 PRO PRO A . n A 1 308 ARG 308 308 308 ARG ARG A . n A 1 309 MET 309 309 309 MET MET A . n A 1 310 ASP 310 310 310 ASP ASP A . n A 1 311 ALA 311 311 311 ALA ALA A . n A 1 312 LYS 312 312 312 LYS LYS A . n A 1 313 MET 313 313 313 MET MET A . n A 1 314 TYR 314 314 314 TYR TYR A . n A 1 315 LEU 315 315 315 LEU LEU A . n A 1 316 GLY 316 316 316 GLY GLY A . n A 1 317 TYR 317 317 317 TYR TYR A . n A 1 318 GLU 318 318 318 GLU GLU A . n A 1 319 TYR 319 319 319 TYR TYR A . n A 1 320 VAL 320 320 320 VAL VAL A . n A 1 321 THR 321 321 321 THR THR A . n A 1 322 ALA 322 322 322 ALA ALA A . n A 1 323 ILE 323 323 323 ILE ILE A . n A 1 324 ARG 324 324 324 ARG ARG A . n A 1 325 ASN 325 325 325 ASN ASN A . n A 1 326 LEU 326 326 326 LEU LEU A . n A 1 327 ARG 327 327 327 ARG ARG A . n A 1 328 GLU 328 328 328 GLU GLU A . n A 1 329 GLY 329 329 329 GLY GLY A . n A 1 330 THR 330 330 330 THR THR A . n A 1 331 CYS 331 331 331 CYS CYS A . n A 1 332 PRO 332 332 ? ? ? A . n A 1 333 GLU 333 333 ? ? ? A . n A 1 334 ALA 334 334 ? ? ? A . n A 1 335 PRO 335 335 ? ? ? A . n A 1 336 THR 336 336 ? ? ? A . n A 1 337 ASP 337 337 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CO3 1 401 401 CO3 CO3 A . C 3 FE 1 402 402 FE FE A . D 4 HOH 1 338 338 HOH TIP A . D 4 HOH 2 339 339 HOH TIP A . D 4 HOH 3 340 340 HOH TIP A . D 4 HOH 4 341 341 HOH TIP A . D 4 HOH 5 342 342 HOH TIP A . D 4 HOH 6 343 343 HOH TIP A . D 4 HOH 7 344 344 HOH TIP A . D 4 HOH 8 345 345 HOH TIP A . D 4 HOH 9 346 346 HOH TIP A . D 4 HOH 10 347 347 HOH TIP A . D 4 HOH 11 348 348 HOH TIP A . D 4 HOH 12 349 349 HOH TIP A . D 4 HOH 13 350 350 HOH TIP A . D 4 HOH 14 351 351 HOH TIP A . D 4 HOH 15 352 352 HOH TIP A . D 4 HOH 16 353 353 HOH TIP A . D 4 HOH 17 354 354 HOH TIP A . D 4 HOH 18 355 355 HOH TIP A . D 4 HOH 19 356 356 HOH TIP A . D 4 HOH 20 357 357 HOH TIP A . D 4 HOH 21 358 358 HOH TIP A . D 4 HOH 22 359 359 HOH TIP A . D 4 HOH 23 360 360 HOH TIP A . D 4 HOH 24 361 361 HOH TIP A . D 4 HOH 25 362 362 HOH TIP A . D 4 HOH 26 363 363 HOH TIP A . D 4 HOH 27 364 364 HOH TIP A . D 4 HOH 28 365 365 HOH TIP A . D 4 HOH 29 366 366 HOH TIP A . D 4 HOH 30 367 367 HOH TIP A . D 4 HOH 31 368 368 HOH TIP A . D 4 HOH 32 369 369 HOH TIP A . D 4 HOH 33 370 370 HOH TIP A . D 4 HOH 34 371 371 HOH TIP A . D 4 HOH 35 372 372 HOH TIP A . D 4 HOH 36 373 373 HOH TIP A . D 4 HOH 37 374 374 HOH TIP A . D 4 HOH 38 375 375 HOH TIP A . D 4 HOH 39 376 376 HOH TIP A . D 4 HOH 40 377 377 HOH TIP A . D 4 HOH 41 378 378 HOH TIP A . D 4 HOH 42 379 379 HOH TIP A . D 4 HOH 43 380 380 HOH TIP A . D 4 HOH 44 381 381 HOH TIP A . D 4 HOH 45 382 382 HOH TIP A . D 4 HOH 46 383 383 HOH TIP A . D 4 HOH 47 384 384 HOH TIP A . D 4 HOH 48 385 385 HOH TIP A . D 4 HOH 49 386 386 HOH TIP A . D 4 HOH 50 387 387 HOH TIP A . D 4 HOH 51 388 388 HOH TIP A . D 4 HOH 52 389 389 HOH TIP A . D 4 HOH 53 390 390 HOH TIP A . D 4 HOH 54 391 391 HOH TIP A . D 4 HOH 55 392 392 HOH TIP A . D 4 HOH 56 393 393 HOH TIP A . D 4 HOH 57 394 394 HOH TIP A . D 4 HOH 58 395 395 HOH TIP A . D 4 HOH 59 396 396 HOH TIP A . D 4 HOH 60 397 397 HOH TIP A . D 4 HOH 61 398 398 HOH TIP A . D 4 HOH 62 399 399 HOH TIP A . D 4 HOH 63 400 400 HOH TIP A . D 4 HOH 64 403 403 HOH TIP A . D 4 HOH 65 404 404 HOH TIP A . D 4 HOH 66 405 405 HOH TIP A . D 4 HOH 67 406 406 HOH TIP A . D 4 HOH 68 407 407 HOH TIP A . D 4 HOH 69 408 408 HOH TIP A . D 4 HOH 70 409 409 HOH TIP A . D 4 HOH 71 410 410 HOH TIP A . D 4 HOH 72 411 411 HOH TIP A . D 4 HOH 73 412 412 HOH TIP A . D 4 HOH 74 413 413 HOH TIP A . D 4 HOH 75 414 414 HOH TIP A . D 4 HOH 76 415 415 HOH TIP A . D 4 HOH 77 416 416 HOH TIP A . D 4 HOH 78 417 417 HOH TIP A . D 4 HOH 79 418 418 HOH TIP A . D 4 HOH 80 419 419 HOH TIP A . D 4 HOH 81 420 420 HOH TIP A . D 4 HOH 82 421 421 HOH TIP A . D 4 HOH 83 422 422 HOH TIP A . D 4 HOH 84 423 423 HOH TIP A . D 4 HOH 85 424 424 HOH TIP A . D 4 HOH 86 425 425 HOH TIP A . D 4 HOH 87 426 426 HOH TIP A . D 4 HOH 88 427 427 HOH TIP A . D 4 HOH 89 428 428 HOH TIP A . D 4 HOH 90 429 429 HOH TIP A . D 4 HOH 91 430 430 HOH TIP A . D 4 HOH 92 431 431 HOH TIP A . D 4 HOH 93 432 432 HOH TIP A . D 4 HOH 94 433 433 HOH TIP A . D 4 HOH 95 434 434 HOH TIP A . D 4 HOH 96 435 435 HOH TIP A . D 4 HOH 97 436 436 HOH TIP A . D 4 HOH 98 437 437 HOH TIP A . D 4 HOH 99 438 438 HOH TIP A . D 4 HOH 100 439 439 HOH TIP A . D 4 HOH 101 440 440 HOH TIP A . D 4 HOH 102 441 441 HOH TIP A . D 4 HOH 103 442 442 HOH TIP A . D 4 HOH 104 443 443 HOH TIP A . D 4 HOH 105 444 444 HOH TIP A . D 4 HOH 106 445 445 HOH TIP A . D 4 HOH 107 446 446 HOH TIP A . D 4 HOH 108 447 447 HOH TIP A . D 4 HOH 109 448 448 HOH TIP A . D 4 HOH 110 449 449 HOH TIP A . D 4 HOH 111 450 450 HOH TIP A . D 4 HOH 112 451 451 HOH TIP A . D 4 HOH 113 452 452 HOH TIP A . D 4 HOH 114 453 453 HOH TIP A . D 4 HOH 115 454 454 HOH TIP A . D 4 HOH 116 455 455 HOH TIP A . D 4 HOH 117 456 456 HOH TIP A . D 4 HOH 118 457 457 HOH TIP A . D 4 HOH 119 458 458 HOH TIP A . D 4 HOH 120 459 459 HOH TIP A . D 4 HOH 121 460 460 HOH TIP A . D 4 HOH 122 461 461 HOH TIP A . D 4 HOH 123 462 462 HOH TIP A . D 4 HOH 124 463 463 HOH TIP A . D 4 HOH 125 464 464 HOH TIP A . D 4 HOH 126 465 465 HOH TIP A . D 4 HOH 127 466 466 HOH TIP A . D 4 HOH 128 467 467 HOH TIP A . D 4 HOH 129 468 468 HOH TIP A . D 4 HOH 130 469 469 HOH TIP A . D 4 HOH 131 470 470 HOH TIP A . D 4 HOH 132 471 471 HOH TIP A . D 4 HOH 133 472 472 HOH TIP A . D 4 HOH 134 473 473 HOH TIP A . D 4 HOH 135 474 474 HOH TIP A . D 4 HOH 136 475 475 HOH TIP A . D 4 HOH 137 476 476 HOH TIP A . D 4 HOH 138 477 477 HOH TIP A . D 4 HOH 139 478 478 HOH TIP A . D 4 HOH 140 479 479 HOH TIP A . D 4 HOH 141 480 480 HOH TIP A . D 4 HOH 142 481 481 HOH TIP A . D 4 HOH 143 482 482 HOH TIP A . D 4 HOH 144 483 483 HOH TIP A . D 4 HOH 145 484 484 HOH TIP A . D 4 HOH 146 485 485 HOH TIP A . D 4 HOH 147 486 486 HOH TIP A . D 4 HOH 148 487 487 HOH TIP A . D 4 HOH 149 488 488 HOH TIP A . D 4 HOH 150 489 489 HOH TIP A . D 4 HOH 151 490 490 HOH TIP A . D 4 HOH 152 491 491 HOH TIP A . D 4 HOH 153 492 492 HOH TIP A . D 4 HOH 154 493 493 HOH TIP A . D 4 HOH 155 494 494 HOH TIP A . D 4 HOH 156 495 495 HOH TIP A . D 4 HOH 157 496 496 HOH TIP A . D 4 HOH 158 497 497 HOH TIP A . D 4 HOH 159 498 498 HOH TIP A . D 4 HOH 160 499 499 HOH TIP A . D 4 HOH 161 500 500 HOH TIP A . D 4 HOH 162 501 501 HOH TIP A . D 4 HOH 163 502 502 HOH TIP A . D 4 HOH 164 503 503 HOH TIP A . D 4 HOH 165 504 504 HOH TIP A . D 4 HOH 166 505 505 HOH TIP A . D 4 HOH 167 506 506 HOH TIP A . D 4 HOH 168 507 507 HOH TIP A . D 4 HOH 169 508 508 HOH TIP A . D 4 HOH 170 509 509 HOH TIP A . D 4 HOH 171 510 510 HOH TIP A . D 4 HOH 172 511 511 HOH TIP A . D 4 HOH 173 512 512 HOH TIP A . D 4 HOH 174 513 513 HOH TIP A . D 4 HOH 175 514 514 HOH TIP A . D 4 HOH 176 515 515 HOH TIP A . D 4 HOH 177 516 516 HOH TIP A . D 4 HOH 178 517 517 HOH TIP A . D 4 HOH 179 518 518 HOH TIP A . D 4 HOH 180 519 519 HOH TIP A . D 4 HOH 181 520 520 HOH TIP A . D 4 HOH 182 521 521 HOH TIP A . D 4 HOH 183 522 522 HOH TIP A . D 4 HOH 184 523 523 HOH TIP A . D 4 HOH 185 524 524 HOH TIP A . D 4 HOH 186 525 525 HOH TIP A . D 4 HOH 187 526 526 HOH TIP A . D 4 HOH 188 527 527 HOH TIP A . D 4 HOH 189 528 528 HOH TIP A . D 4 HOH 190 529 529 HOH TIP A . D 4 HOH 191 530 530 HOH TIP A . D 4 HOH 192 531 531 HOH TIP A . D 4 HOH 193 532 532 HOH TIP A . D 4 HOH 194 533 533 HOH TIP A . D 4 HOH 195 534 534 HOH TIP A . D 4 HOH 196 535 535 HOH TIP A . D 4 HOH 197 536 536 HOH TIP A . D 4 HOH 198 537 537 HOH TIP A . D 4 HOH 199 538 538 HOH TIP A . D 4 HOH 200 539 539 HOH TIP A . D 4 HOH 201 540 540 HOH TIP A . D 4 HOH 202 541 541 HOH TIP A . D 4 HOH 203 542 542 HOH TIP A . D 4 HOH 204 543 543 HOH TIP A . D 4 HOH 205 544 544 HOH TIP A . D 4 HOH 206 545 545 HOH TIP A . D 4 HOH 207 546 546 HOH TIP A . D 4 HOH 208 547 547 HOH TIP A . D 4 HOH 209 548 548 HOH TIP A . D 4 HOH 210 549 549 HOH TIP A . D 4 HOH 211 550 550 HOH TIP A . D 4 HOH 212 551 551 HOH TIP A . D 4 HOH 213 552 552 HOH TIP A . D 4 HOH 214 553 553 HOH TIP A . D 4 HOH 215 554 554 HOH TIP A . D 4 HOH 216 555 555 HOH TIP A . D 4 HOH 217 556 556 HOH TIP A . D 4 HOH 218 557 557 HOH TIP A . D 4 HOH 219 558 558 HOH TIP A . D 4 HOH 220 559 559 HOH TIP A . D 4 HOH 221 560 560 HOH TIP A . D 4 HOH 222 561 561 HOH TIP A . D 4 HOH 223 562 562 HOH TIP A . D 4 HOH 224 563 563 HOH TIP A . D 4 HOH 225 564 564 HOH TIP A . D 4 HOH 226 565 565 HOH TIP A . D 4 HOH 227 566 566 HOH TIP A . D 4 HOH 228 567 567 HOH TIP A . D 4 HOH 229 568 568 HOH TIP A . D 4 HOH 230 569 569 HOH TIP A . D 4 HOH 231 570 570 HOH TIP A . D 4 HOH 232 571 571 HOH TIP A . D 4 HOH 233 572 572 HOH TIP A . D 4 HOH 234 573 573 HOH TIP A . D 4 HOH 235 574 574 HOH TIP A . D 4 HOH 236 575 575 HOH TIP A . D 4 HOH 237 576 576 HOH TIP A . D 4 HOH 238 577 577 HOH TIP A . D 4 HOH 239 578 578 HOH TIP A . D 4 HOH 240 579 579 HOH TIP A . D 4 HOH 241 580 580 HOH TIP A . D 4 HOH 242 581 581 HOH TIP A . D 4 HOH 243 582 582 HOH TIP A . D 4 HOH 244 583 583 HOH TIP A . D 4 HOH 245 584 584 HOH TIP A . D 4 HOH 246 585 585 HOH TIP A . D 4 HOH 247 586 586 HOH TIP A . D 4 HOH 248 587 587 HOH TIP A . D 4 HOH 249 588 588 HOH TIP A . D 4 HOH 250 589 589 HOH TIP A . D 4 HOH 251 590 590 HOH TIP A . D 4 HOH 252 591 591 HOH TIP A . D 4 HOH 253 592 592 HOH TIP A . D 4 HOH 254 593 593 HOH TIP A . D 4 HOH 255 594 594 HOH TIP A . D 4 HOH 256 595 595 HOH TIP A . D 4 HOH 257 596 596 HOH TIP A . D 4 HOH 258 597 597 HOH TIP A . D 4 HOH 259 598 598 HOH TIP A . D 4 HOH 260 599 599 HOH TIP A . D 4 HOH 261 600 600 HOH TIP A . D 4 HOH 262 601 601 HOH TIP A . D 4 HOH 263 602 602 HOH TIP A . D 4 HOH 264 603 334 HOH TIP A . D 4 HOH 265 604 335 HOH TIP A . D 4 HOH 266 605 336 HOH TIP A . D 4 HOH 267 606 337 HOH TIP A . D 4 HOH 268 607 401 HOH TIP A . D 4 HOH 269 608 402 HOH TIP A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 OH ? A TYR 95 ? A TYR 95 ? 1_555 83.3 ? 2 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 OH ? A TYR 188 ? A TYR 188 ? 1_555 176.6 ? 3 OH ? A TYR 95 ? A TYR 95 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 OH ? A TYR 188 ? A TYR 188 ? 1_555 93.9 ? 4 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 NE2 ? A HIS 249 ? A HIS 249 ? 1_555 89.8 ? 5 OH ? A TYR 95 ? A TYR 95 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 NE2 ? A HIS 249 ? A HIS 249 ? 1_555 100.7 ? 6 OH ? A TYR 188 ? A TYR 188 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 NE2 ? A HIS 249 ? A HIS 249 ? 1_555 88.9 ? 7 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 O1 ? B CO3 . ? A CO3 401 ? 1_555 88.1 ? 8 OH ? A TYR 95 ? A TYR 95 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 O1 ? B CO3 . ? A CO3 401 ? 1_555 98.9 ? 9 OH ? A TYR 188 ? A TYR 188 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 O1 ? B CO3 . ? A CO3 401 ? 1_555 94.2 ? 10 NE2 ? A HIS 249 ? A HIS 249 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 O1 ? B CO3 . ? A CO3 401 ? 1_555 159.9 ? 11 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 O2 ? B CO3 . ? A CO3 401 ? 1_555 93.8 ? 12 OH ? A TYR 95 ? A TYR 95 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 O2 ? B CO3 . ? A CO3 401 ? 1_555 154.6 ? 13 OH ? A TYR 188 ? A TYR 188 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 O2 ? B CO3 . ? A CO3 401 ? 1_555 89.5 ? 14 NE2 ? A HIS 249 ? A HIS 249 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 O2 ? B CO3 . ? A CO3 401 ? 1_555 104.6 ? 15 O1 ? B CO3 . ? A CO3 401 ? 1_555 FE ? C FE . ? A FE 402 ? 1_555 O2 ? B CO3 . ? A CO3 401 ? 1_555 55.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-05-19 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' database_2 3 4 'Structure model' struct_ref_seq_dif 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_phasing_MR.entry_id 3FGS _pdbx_phasing_MR.method_rotation 'fast direct' _pdbx_phasing_MR.method_translation &STRIP%trans_method _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation ? _pdbx_phasing_MR.d_res_low_rotation ? _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 2 CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns-online.org/ Fortran_77 ? 3 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 MAR345dtb . ? ? ? ? 'data collection' ? ? ? 5 CNS . ? ? ? ? phasing ? ? ? 6 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 194 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 194 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 SG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 194 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 121.37 _pdbx_validate_rmsd_angle.angle_target_value 114.20 _pdbx_validate_rmsd_angle.angle_deviation 7.17 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 4 ? ? 59.52 -163.19 2 1 SER A 12 ? ? 73.36 173.32 3 1 TYR A 85 ? ? -128.08 -169.76 4 1 THR A 93 ? ? -94.45 50.04 5 1 SER A 125 ? ? -44.81 -73.85 6 1 TRP A 128 ? ? -138.49 -71.55 7 1 SER A 155 ? ? -104.34 44.79 8 1 CYS A 161 ? ? 83.98 -10.18 9 1 CYS A 174 ? ? -151.07 76.38 10 1 PRO A 175 ? ? -37.76 132.52 11 1 CYS A 179 ? ? -99.48 39.39 12 1 VAL A 205 ? ? -139.69 -159.26 13 1 ASP A 277 ? ? 57.53 17.16 14 1 SER A 287 ? ? -177.29 147.00 15 1 LEU A 294 ? ? 73.15 -46.79 16 1 ARG A 308 ? ? 53.06 11.37 17 1 GLU A 328 ? ? -108.38 70.58 18 1 THR A 330 ? ? -173.22 140.17 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 1 ? A VAL 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A PRO 332 ? A PRO 332 4 1 Y 1 A GLU 333 ? A GLU 333 5 1 Y 1 A ALA 334 ? A ALA 334 6 1 Y 1 A PRO 335 ? A PRO 335 7 1 Y 1 A THR 336 ? A THR 336 8 1 Y 1 A ASP 337 ? A ASP 337 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CARBONATE ION' CO3 3 'FE (III) ION' FE 4 water HOH #