data_3GHJ # _entry.id 3GHJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3GHJ pdb_00003ghj 10.2210/pdb3ghj/pdb RCSB RCSB051867 ? ? WWPDB D_1000051867 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-03-24 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2021-10-20 5 'Structure model' 1 4 2024-11-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' database_2 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.contact_author' 3 3 'Structure model' '_software.contact_author_email' 4 3 'Structure model' '_software.date' 5 3 'Structure model' '_software.language' 6 3 'Structure model' '_software.location' 7 3 'Structure model' '_software.name' 8 3 'Structure model' '_software.type' 9 3 'Structure model' '_software.version' 10 4 'Structure model' '_database_2.pdbx_DOI' 11 4 'Structure model' '_database_2.pdbx_database_accession' 12 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 13 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.entry_id 3GHJ _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-03-03 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC7777 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sureshan, V.' 1 'Deshpande, C.' 2 'Harrop, S.J.' 3 'Kudritska, M.' 4 'Koenig, J.E.' 5 'Evdokimova, E.' 6 'Kim, Y.' 7 'Edwards, A.M.' 8 'Savchenko, A.' 9 'Joachimiak, A.' 10 'Doolittle, W.F.' 11 'Stokes, H.W.' 12 'Curmi, P.M.G.' 13 'Mabbutt, B.C.' 14 'Midwest Center for Structural Genomics (MCSG)' 15 # _citation.id primary _citation.title 'Structure from the mobile metagenome of Halifax Harbour Sewage Outfall: Integron Cassette Protein HFX_CASS4' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sureshan, V.' 1 ? primary 'Deshpande, C.' 2 ? primary 'Harrop, S.J.' 3 ? primary 'Kudritska, M.' 4 ? primary 'Koenig, J.E.' 5 ? primary 'Evdokimova, E.' 6 ? primary 'Kim, Y.' 7 ? primary 'Edwards, A.M.' 8 ? primary 'Savchenko, A.' 9 ? primary 'Joachimiak, A.' 10 ? primary 'Doolittle, W.F.' 11 ? primary 'Stokes, H.W.' 12 ? primary 'Curmi, P.M.G.' 13 ? primary 'Mabbutt, B.C.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative integron gene cassette protein' 16332.780 1 ? L97Q ? ? 2 water nat water 18.015 68 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GSSHHHHHHSSGRENLYFQGVP(MSE)NIKGLFEVAVKVKNLEKSSQFYTEILGFEAGLLDSARRWNFLWVSGRA G(MSE)VVLQEEKENWQQQHFSFRVEKSEIEPLKKALESKGVSVHGPVNQEW(MSE)QAVSLYFADPNGHALEFTAL ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGRENLYFQGVPMNIKGLFEVAVKVKNLEKSSQFYTEILGFEAGLLDSARRWNFLWVSGRAGMVVLQEE KENWQQQHFSFRVEKSEIEPLKKALESKGVSVHGPVNQEWMQAVSLYFADPNGHALEFTAL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC7777 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 ARG n 1 15 GLU n 1 16 ASN n 1 17 LEU n 1 18 TYR n 1 19 PHE n 1 20 GLN n 1 21 GLY n 1 22 VAL n 1 23 PRO n 1 24 MSE n 1 25 ASN n 1 26 ILE n 1 27 LYS n 1 28 GLY n 1 29 LEU n 1 30 PHE n 1 31 GLU n 1 32 VAL n 1 33 ALA n 1 34 VAL n 1 35 LYS n 1 36 VAL n 1 37 LYS n 1 38 ASN n 1 39 LEU n 1 40 GLU n 1 41 LYS n 1 42 SER n 1 43 SER n 1 44 GLN n 1 45 PHE n 1 46 TYR n 1 47 THR n 1 48 GLU n 1 49 ILE n 1 50 LEU n 1 51 GLY n 1 52 PHE n 1 53 GLU n 1 54 ALA n 1 55 GLY n 1 56 LEU n 1 57 LEU n 1 58 ASP n 1 59 SER n 1 60 ALA n 1 61 ARG n 1 62 ARG n 1 63 TRP n 1 64 ASN n 1 65 PHE n 1 66 LEU n 1 67 TRP n 1 68 VAL n 1 69 SER n 1 70 GLY n 1 71 ARG n 1 72 ALA n 1 73 GLY n 1 74 MSE n 1 75 VAL n 1 76 VAL n 1 77 LEU n 1 78 GLN n 1 79 GLU n 1 80 GLU n 1 81 LYS n 1 82 GLU n 1 83 ASN n 1 84 TRP n 1 85 GLN n 1 86 GLN n 1 87 GLN n 1 88 HIS n 1 89 PHE n 1 90 SER n 1 91 PHE n 1 92 ARG n 1 93 VAL n 1 94 GLU n 1 95 LYS n 1 96 SER n 1 97 GLU n 1 98 ILE n 1 99 GLU n 1 100 PRO n 1 101 LEU n 1 102 LYS n 1 103 LYS n 1 104 ALA n 1 105 LEU n 1 106 GLU n 1 107 SER n 1 108 LYS n 1 109 GLY n 1 110 VAL n 1 111 SER n 1 112 VAL n 1 113 HIS n 1 114 GLY n 1 115 PRO n 1 116 VAL n 1 117 ASN n 1 118 GLN n 1 119 GLU n 1 120 TRP n 1 121 MSE n 1 122 GLN n 1 123 ALA n 1 124 VAL n 1 125 SER n 1 126 LEU n 1 127 TYR n 1 128 PHE n 1 129 ALA n 1 130 ASP n 1 131 PRO n 1 132 ASN n 1 133 GLY n 1 134 HIS n 1 135 ALA n 1 136 LEU n 1 137 GLU n 1 138 PHE n 1 139 THR n 1 140 ALA n 1 141 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ORF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'uncultured bacterium' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 77133 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-CodonPlus(DE3)-RIPL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'p15TV LIC' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -20 ? ? ? A . n A 1 2 GLY 2 -19 ? ? ? A . n A 1 3 SER 3 -18 ? ? ? A . n A 1 4 SER 4 -17 ? ? ? A . n A 1 5 HIS 5 -16 ? ? ? A . n A 1 6 HIS 6 -15 ? ? ? A . n A 1 7 HIS 7 -14 ? ? ? A . n A 1 8 HIS 8 -13 ? ? ? A . n A 1 9 HIS 9 -12 ? ? ? A . n A 1 10 HIS 10 -11 ? ? ? A . n A 1 11 SER 11 -10 ? ? ? A . n A 1 12 SER 12 -9 ? ? ? A . n A 1 13 GLY 13 -8 ? ? ? A . n A 1 14 ARG 14 -7 ? ? ? A . n A 1 15 GLU 15 -6 ? ? ? A . n A 1 16 ASN 16 -5 ? ? ? A . n A 1 17 LEU 17 -4 ? ? ? A . n A 1 18 TYR 18 -3 ? ? ? A . n A 1 19 PHE 19 -2 ? ? ? A . n A 1 20 GLN 20 -1 ? ? ? A . n A 1 21 GLY 21 0 ? ? ? A . n A 1 22 VAL 22 1 ? ? ? A . n A 1 23 PRO 23 2 ? ? ? A . n A 1 24 MSE 24 3 ? ? ? A . n A 1 25 ASN 25 4 ? ? ? A . n A 1 26 ILE 26 5 5 ILE ILE A . n A 1 27 LYS 27 6 6 LYS LYS A . n A 1 28 GLY 28 7 7 GLY GLY A . n A 1 29 LEU 29 8 8 LEU LEU A . n A 1 30 PHE 30 9 9 PHE PHE A . n A 1 31 GLU 31 10 10 GLU GLU A . n A 1 32 VAL 32 11 11 VAL VAL A . n A 1 33 ALA 33 12 12 ALA ALA A . n A 1 34 VAL 34 13 13 VAL VAL A . n A 1 35 LYS 35 14 14 LYS LYS A . n A 1 36 VAL 36 15 15 VAL VAL A . n A 1 37 LYS 37 16 16 LYS LYS A . n A 1 38 ASN 38 17 17 ASN ASN A . n A 1 39 LEU 39 18 18 LEU LEU A . n A 1 40 GLU 40 19 19 GLU GLU A . n A 1 41 LYS 41 20 20 LYS LYS A . n A 1 42 SER 42 21 21 SER SER A . n A 1 43 SER 43 22 22 SER SER A . n A 1 44 GLN 44 23 23 GLN GLN A . n A 1 45 PHE 45 24 24 PHE PHE A . n A 1 46 TYR 46 25 25 TYR TYR A . n A 1 47 THR 47 26 26 THR THR A . n A 1 48 GLU 48 27 27 GLU GLU A . n A 1 49 ILE 49 28 28 ILE ILE A . n A 1 50 LEU 50 29 29 LEU LEU A . n A 1 51 GLY 51 30 30 GLY GLY A . n A 1 52 PHE 52 31 31 PHE PHE A . n A 1 53 GLU 53 32 32 GLU GLU A . n A 1 54 ALA 54 33 33 ALA ALA A . n A 1 55 GLY 55 34 34 GLY GLY A . n A 1 56 LEU 56 35 35 LEU LEU A . n A 1 57 LEU 57 36 36 LEU LEU A . n A 1 58 ASP 58 37 37 ASP ASP A . n A 1 59 SER 59 38 38 SER SER A . n A 1 60 ALA 60 39 39 ALA ALA A . n A 1 61 ARG 61 40 40 ARG ARG A . n A 1 62 ARG 62 41 41 ARG ARG A . n A 1 63 TRP 63 42 42 TRP TRP A . n A 1 64 ASN 64 43 43 ASN ASN A . n A 1 65 PHE 65 44 44 PHE PHE A . n A 1 66 LEU 66 45 45 LEU LEU A . n A 1 67 TRP 67 46 46 TRP TRP A . n A 1 68 VAL 68 47 47 VAL VAL A . n A 1 69 SER 69 48 48 SER SER A . n A 1 70 GLY 70 49 49 GLY GLY A . n A 1 71 ARG 71 50 50 ARG ARG A . n A 1 72 ALA 72 51 51 ALA ALA A . n A 1 73 GLY 73 52 52 GLY GLY A . n A 1 74 MSE 74 53 53 MSE MSE A . n A 1 75 VAL 75 54 54 VAL VAL A . n A 1 76 VAL 76 55 55 VAL VAL A . n A 1 77 LEU 77 56 56 LEU LEU A . n A 1 78 GLN 78 57 57 GLN GLN A . n A 1 79 GLU 79 58 58 GLU GLU A . n A 1 80 GLU 80 59 59 GLU GLU A . n A 1 81 LYS 81 60 60 LYS LYS A . n A 1 82 GLU 82 61 61 GLU GLU A . n A 1 83 ASN 83 62 62 ASN ASN A . n A 1 84 TRP 84 63 63 TRP TRP A . n A 1 85 GLN 85 64 64 GLN GLN A . n A 1 86 GLN 86 65 65 GLN GLN A . n A 1 87 GLN 87 66 66 GLN GLN A . n A 1 88 HIS 88 67 67 HIS HIS A . n A 1 89 PHE 89 68 68 PHE PHE A . n A 1 90 SER 90 69 69 SER SER A . n A 1 91 PHE 91 70 70 PHE PHE A . n A 1 92 ARG 92 71 71 ARG ARG A . n A 1 93 VAL 93 72 72 VAL VAL A . n A 1 94 GLU 94 73 73 GLU GLU A . n A 1 95 LYS 95 74 74 LYS LYS A . n A 1 96 SER 96 75 75 SER SER A . n A 1 97 GLU 97 76 76 GLU GLU A . n A 1 98 ILE 98 77 77 ILE ILE A . n A 1 99 GLU 99 78 78 GLU GLU A . n A 1 100 PRO 100 79 79 PRO PRO A . n A 1 101 LEU 101 80 80 LEU LEU A . n A 1 102 LYS 102 81 81 LYS LYS A . n A 1 103 LYS 103 82 82 LYS LYS A . n A 1 104 ALA 104 83 83 ALA ALA A . n A 1 105 LEU 105 84 84 LEU LEU A . n A 1 106 GLU 106 85 85 GLU GLU A . n A 1 107 SER 107 86 86 SER SER A . n A 1 108 LYS 108 87 87 LYS LYS A . n A 1 109 GLY 109 88 88 GLY GLY A . n A 1 110 VAL 110 89 89 VAL VAL A . n A 1 111 SER 111 90 90 SER SER A . n A 1 112 VAL 112 91 91 VAL VAL A . n A 1 113 HIS 113 92 92 HIS HIS A . n A 1 114 GLY 114 93 93 GLY GLY A . n A 1 115 PRO 115 94 94 PRO PRO A . n A 1 116 VAL 116 95 95 VAL VAL A . n A 1 117 ASN 117 96 96 ASN ASN A . n A 1 118 GLN 118 97 97 GLN GLN A . n A 1 119 GLU 119 98 98 GLU GLU A . n A 1 120 TRP 120 99 99 TRP TRP A . n A 1 121 MSE 121 100 100 MSE MSE A . n A 1 122 GLN 122 101 101 GLN GLN A . n A 1 123 ALA 123 102 102 ALA ALA A . n A 1 124 VAL 124 103 103 VAL VAL A . n A 1 125 SER 125 104 104 SER SER A . n A 1 126 LEU 126 105 105 LEU LEU A . n A 1 127 TYR 127 106 106 TYR TYR A . n A 1 128 PHE 128 107 107 PHE PHE A . n A 1 129 ALA 129 108 108 ALA ALA A . n A 1 130 ASP 130 109 109 ASP ASP A . n A 1 131 PRO 131 110 110 PRO PRO A . n A 1 132 ASN 132 111 111 ASN ASN A . n A 1 133 GLY 133 112 112 GLY GLY A . n A 1 134 HIS 134 113 113 HIS HIS A . n A 1 135 ALA 135 114 114 ALA ALA A . n A 1 136 LEU 136 115 115 LEU LEU A . n A 1 137 GLU 137 116 116 GLU GLU A . n A 1 138 PHE 138 117 117 PHE PHE A . n A 1 139 THR 139 118 118 THR THR A . n A 1 140 ALA 140 119 119 ALA ALA A . n A 1 141 LEU 141 120 120 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 121 1 HOH HOH A . B 2 HOH 2 122 2 HOH HOH A . B 2 HOH 3 123 3 HOH HOH A . B 2 HOH 4 124 4 HOH HOH A . B 2 HOH 5 125 5 HOH HOH A . B 2 HOH 6 126 6 HOH HOH A . B 2 HOH 7 127 7 HOH HOH A . B 2 HOH 8 128 8 HOH HOH A . B 2 HOH 9 129 129 HOH HOH A . B 2 HOH 10 130 9 HOH HOH A . B 2 HOH 11 131 10 HOH HOH A . B 2 HOH 12 132 12 HOH HOH A . B 2 HOH 13 133 14 HOH HOH A . B 2 HOH 14 134 15 HOH HOH A . B 2 HOH 15 135 16 HOH HOH A . B 2 HOH 16 136 17 HOH HOH A . B 2 HOH 17 137 18 HOH HOH A . B 2 HOH 18 138 19 HOH HOH A . B 2 HOH 19 139 20 HOH HOH A . B 2 HOH 20 140 21 HOH HOH A . B 2 HOH 21 141 22 HOH HOH A . B 2 HOH 22 142 23 HOH HOH A . B 2 HOH 23 143 24 HOH HOH A . B 2 HOH 24 144 25 HOH HOH A . B 2 HOH 25 145 26 HOH HOH A . B 2 HOH 26 146 27 HOH HOH A . B 2 HOH 27 147 29 HOH HOH A . B 2 HOH 28 148 30 HOH HOH A . B 2 HOH 29 149 33 HOH HOH A . B 2 HOH 30 150 34 HOH HOH A . B 2 HOH 31 151 38 HOH HOH A . B 2 HOH 32 152 39 HOH HOH A . B 2 HOH 33 153 40 HOH HOH A . B 2 HOH 34 154 154 HOH HOH A . B 2 HOH 35 155 41 HOH HOH A . B 2 HOH 36 156 44 HOH HOH A . B 2 HOH 37 157 157 HOH HOH A . B 2 HOH 38 158 158 HOH HOH A . B 2 HOH 39 159 45 HOH HOH A . B 2 HOH 40 160 160 HOH HOH A . B 2 HOH 41 161 161 HOH HOH A . B 2 HOH 42 162 162 HOH HOH A . B 2 HOH 43 163 163 HOH HOH A . B 2 HOH 44 164 164 HOH HOH A . B 2 HOH 45 165 165 HOH HOH A . B 2 HOH 46 166 166 HOH HOH A . B 2 HOH 47 167 167 HOH HOH A . B 2 HOH 48 168 168 HOH HOH A . B 2 HOH 49 169 169 HOH HOH A . B 2 HOH 50 170 170 HOH HOH A . B 2 HOH 51 171 171 HOH HOH A . B 2 HOH 52 172 172 HOH HOH A . B 2 HOH 53 173 173 HOH HOH A . B 2 HOH 54 174 174 HOH HOH A . B 2 HOH 55 175 46 HOH HOH A . B 2 HOH 56 176 176 HOH HOH A . B 2 HOH 57 177 47 HOH HOH A . B 2 HOH 58 178 48 HOH HOH A . B 2 HOH 59 179 49 HOH HOH A . B 2 HOH 60 180 50 HOH HOH A . B 2 HOH 61 181 51 HOH HOH A . B 2 HOH 62 182 53 HOH HOH A . B 2 HOH 63 183 62 HOH HOH A . B 2 HOH 64 184 64 HOH HOH A . B 2 HOH 65 185 65 HOH HOH A . B 2 HOH 66 186 72 HOH HOH A . B 2 HOH 67 187 101 HOH HOH A . B 2 HOH 68 188 104 HOH HOH A . # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 2 PHENIX . ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 3 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 HKL-3000 . ? ? ? ? 'data collection' ? ? ? 5 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 6 PHENIX AUTOSOL ? ? ? ? phasing ? ? ? 7 # _cell.length_a 51.001 _cell.length_b 66.391 _cell.length_c 80.822 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3GHJ _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.entry_id 3GHJ _symmetry.Int_Tables_number 20 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 3GHJ _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.094 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 41.27 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '0.2 M Ammonium sulfate, 25% PEG 4000, 0.1 M Na acetate pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 294K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type SBC-3 _diffrn_detector.pdbx_collection_date 2008-10-12 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97921 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97921 _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM # _reflns.entry_id 3GHJ _reflns.d_resolution_high 1.47 _reflns.d_resolution_low 50.0 _reflns.number_obs 23542 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_netI_over_sigmaI 37.280 _reflns.pdbx_chi_squared 1.524 _reflns.pdbx_redundancy 8.100 _reflns.percent_possible_obs 99.300 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.number_all ? _reflns.pdbx_Rsym_value 0.074 _reflns.B_iso_Wilson_estimate 13.12 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.47 _reflns_shell.d_res_low 1.50 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.344 _reflns_shell.meanI_over_sigI_obs 4.07 _reflns_shell.pdbx_Rsym_value 0.344 _reflns_shell.pdbx_chi_squared 0.605 _reflns_shell.pdbx_redundancy 5.80 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1127 _reflns_shell.percent_possible_all 95.70 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3GHJ _refine.ls_d_res_high 1.471 _refine.ls_d_res_low 24.319 _refine.pdbx_ls_sigma_F 0 _refine.ls_percent_reflns_obs 98.140 _refine.ls_number_reflns_obs 23217 _refine.ls_R_factor_obs 0.169 _refine.ls_R_factor_R_work 0.168 _refine.ls_R_factor_R_free 0.183 _refine.ls_percent_reflns_R_free 8.480 _refine.ls_number_reflns_R_free 1969 _refine.B_iso_mean 17.906 _refine.solvent_model_param_bsol 70.531 _refine.solvent_model_param_ksol 0.442 _refine.aniso_B[1][1] 0.377 _refine.aniso_B[2][2] -1.749 _refine.aniso_B[3][3] 1.372 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] -0.000 _refine.overall_SU_ML 0.140 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.110 _refine.pdbx_solvent_shrinkage_radii 0.900 _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.overall_FOM_work_R_set 0.919 _refine.B_iso_max 66.91 _refine.B_iso_min 6.97 _refine.occupancy_max 1.00 _refine.occupancy_min 0.26 _refine.pdbx_ls_sigma_I 0 _refine.ls_number_reflns_all 23217 _refine.ls_R_factor_all 0.169 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_isotropic_thermal_model anisotropic _refine.details ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_ion_probe_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1054 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 68 _refine_hist.number_atoms_total 1122 _refine_hist.d_res_high 1.471 _refine_hist.d_res_low 24.319 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 1096 0.011 ? ? 'X-RAY DIFFRACTION' ? f_angle_d 1502 1.074 ? ? 'X-RAY DIFFRACTION' ? f_chiral_restr 153 0.078 ? ? 'X-RAY DIFFRACTION' ? f_plane_restr 203 0.006 ? ? 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 405 16.148 ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 1.471 1.508 14 95.000 1447 . 0.139 0.187 . 134 . 1581 . . 'X-RAY DIFFRACTION' 1.508 1.549 14 97.000 1487 . 0.115 0.161 . 136 . 1623 . . 'X-RAY DIFFRACTION' 1.549 1.594 14 97.000 1469 . 0.117 0.153 . 135 . 1604 . . 'X-RAY DIFFRACTION' 1.594 1.646 14 98.000 1480 . 0.119 0.164 . 140 . 1620 . . 'X-RAY DIFFRACTION' 1.646 1.705 14 97.000 1494 . 0.125 0.146 . 138 . 1632 . . 'X-RAY DIFFRACTION' 1.705 1.773 14 98.000 1488 . 0.132 0.191 . 138 . 1626 . . 'X-RAY DIFFRACTION' 1.773 1.854 14 98.000 1507 . 0.137 0.152 . 139 . 1646 . . 'X-RAY DIFFRACTION' 1.854 1.951 14 99.000 1524 . 0.140 0.169 . 141 . 1665 . . 'X-RAY DIFFRACTION' 1.951 2.073 14 100.000 1540 . 0.141 0.167 . 142 . 1682 . . 'X-RAY DIFFRACTION' 2.073 2.233 14 100.000 1538 . 0.147 0.154 . 143 . 1681 . . 'X-RAY DIFFRACTION' 2.233 2.458 14 99.000 1556 . 0.168 0.181 . 144 . 1700 . . 'X-RAY DIFFRACTION' 2.458 2.813 14 99.000 1532 . 0.178 0.210 . 142 . 1674 . . 'X-RAY DIFFRACTION' 2.813 3.543 14 99.000 1562 . 0.190 0.192 . 146 . 1708 . . 'X-RAY DIFFRACTION' 3.543 24.322 14 98.000 1624 . 0.194 0.197 . 151 . 1775 . . 'X-RAY DIFFRACTION' # _struct.entry_id 3GHJ _struct.title 'Crystal structure from the mobile metagenome of Halifax Harbour Sewage Outfall: Integron Cassette Protein HFX_CASS4' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3GHJ _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Integron Cassette Protein, Mobile Metagenome, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B0BGV9_9BACT _struct_ref.pdbx_db_accession B0BGV9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PMNIKGLFEVAVKVKNLEKSSQFYTEILGFEAGLLDSARRWNFLWVSGRAGMVVLQEEKENWQQQHFSFRVEKSEIEPLK KALESKGVSVHGPVNLEWMQAVSLYFADPNGHALEFTAL ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3GHJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 23 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 141 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B0BGV9 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 120 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 120 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3GHJ MSE A 1 ? UNP B0BGV9 ? ? 'expression tag' -20 1 1 3GHJ GLY A 2 ? UNP B0BGV9 ? ? 'expression tag' -19 2 1 3GHJ SER A 3 ? UNP B0BGV9 ? ? 'expression tag' -18 3 1 3GHJ SER A 4 ? UNP B0BGV9 ? ? 'expression tag' -17 4 1 3GHJ HIS A 5 ? UNP B0BGV9 ? ? 'expression tag' -16 5 1 3GHJ HIS A 6 ? UNP B0BGV9 ? ? 'expression tag' -15 6 1 3GHJ HIS A 7 ? UNP B0BGV9 ? ? 'expression tag' -14 7 1 3GHJ HIS A 8 ? UNP B0BGV9 ? ? 'expression tag' -13 8 1 3GHJ HIS A 9 ? UNP B0BGV9 ? ? 'expression tag' -12 9 1 3GHJ HIS A 10 ? UNP B0BGV9 ? ? 'expression tag' -11 10 1 3GHJ SER A 11 ? UNP B0BGV9 ? ? 'expression tag' -10 11 1 3GHJ SER A 12 ? UNP B0BGV9 ? ? 'expression tag' -9 12 1 3GHJ GLY A 13 ? UNP B0BGV9 ? ? 'expression tag' -8 13 1 3GHJ ARG A 14 ? UNP B0BGV9 ? ? 'expression tag' -7 14 1 3GHJ GLU A 15 ? UNP B0BGV9 ? ? 'expression tag' -6 15 1 3GHJ ASN A 16 ? UNP B0BGV9 ? ? 'expression tag' -5 16 1 3GHJ LEU A 17 ? UNP B0BGV9 ? ? 'expression tag' -4 17 1 3GHJ TYR A 18 ? UNP B0BGV9 ? ? 'expression tag' -3 18 1 3GHJ PHE A 19 ? UNP B0BGV9 ? ? 'expression tag' -2 19 1 3GHJ GLN A 20 ? UNP B0BGV9 ? ? 'expression tag' -1 20 1 3GHJ GLY A 21 ? UNP B0BGV9 ? ? 'expression tag' 0 21 1 3GHJ VAL A 22 ? UNP B0BGV9 ? ? 'expression tag' 1 22 1 3GHJ GLN A 118 ? UNP B0BGV9 LEU 97 'engineered mutation' 97 23 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3550 ? 1 MORE -22.5 ? 1 'SSA (A^2)' 10990 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 66.3910000000 0.0000000000 0.0000000000 -1.0000000000 80.8220000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 38 ? ILE A 49 ? ASN A 17 ILE A 28 1 ? 12 HELX_P HELX_P2 2 GLU A 94 ? SER A 96 ? GLU A 73 SER A 75 5 ? 3 HELX_P HELX_P3 3 GLU A 97 ? LYS A 108 ? GLU A 76 LYS A 87 1 ? 12 HELX_P HELX_P4 4 GLU A 119 ? GLN A 122 ? GLU A 98 GLN A 101 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLY 73 C ? ? ? 1_555 A MSE 74 N ? ? A GLY 52 A MSE 53 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A MSE 74 C ? ? ? 1_555 A VAL 75 N A ? A MSE 53 A VAL 54 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale3 covale both ? A MSE 74 C ? ? ? 1_555 A VAL 75 N B ? A MSE 53 A VAL 54 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? A TRP 120 C ? ? ? 1_555 A MSE 121 N ? ? A TRP 99 A MSE 100 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale5 covale both ? A MSE 121 C ? ? ? 1_555 A GLN 122 N A ? A MSE 100 A GLN 101 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A MSE 121 C ? ? ? 1_555 A GLN 122 N B ? A MSE 100 A GLN 101 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 74 ? . . . . MSE A 53 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 121 ? . . . . MSE A 100 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 114 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 93 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 115 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 94 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 7.39 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 31 ? VAL A 36 ? GLU A 10 VAL A 15 A 2 GLY A 73 ? GLU A 79 ? GLY A 52 GLU A 58 A 3 TRP A 63 ? VAL A 68 ? TRP A 42 VAL A 47 A 4 GLU A 53 ? ASP A 58 ? GLU A 32 ASP A 37 B 1 HIS A 88 ? VAL A 93 ? HIS A 67 VAL A 72 B 2 ALA A 135 ? ALA A 140 ? ALA A 114 ALA A 119 B 3 ALA A 123 ? ALA A 129 ? ALA A 102 ALA A 108 B 4 HIS A 113 ? GLN A 118 ? HIS A 92 GLN A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 34 ? N VAL A 13 O GLN A 78 ? O GLN A 57 A 2 3 O LEU A 77 ? O LEU A 56 N ASN A 64 ? N ASN A 43 A 3 4 O TRP A 63 ? O TRP A 42 N ASP A 58 ? N ASP A 37 B 1 2 N PHE A 91 ? N PHE A 70 O THR A 139 ? O THR A 118 B 2 3 O ALA A 140 ? O ALA A 119 N VAL A 124 ? N VAL A 103 B 3 4 O ALA A 123 ? O ALA A 102 N GLN A 118 ? N GLN A 97 # _pdbx_entry_details.entry_id 3GHJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 74 A MSE 53 ? MET SELENOMETHIONINE 2 A MSE 121 A MSE 100 ? MET SELENOMETHIONINE # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 125 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE -20 ? A MSE 1 2 1 Y 1 A GLY -19 ? A GLY 2 3 1 Y 1 A SER -18 ? A SER 3 4 1 Y 1 A SER -17 ? A SER 4 5 1 Y 1 A HIS -16 ? A HIS 5 6 1 Y 1 A HIS -15 ? A HIS 6 7 1 Y 1 A HIS -14 ? A HIS 7 8 1 Y 1 A HIS -13 ? A HIS 8 9 1 Y 1 A HIS -12 ? A HIS 9 10 1 Y 1 A HIS -11 ? A HIS 10 11 1 Y 1 A SER -10 ? A SER 11 12 1 Y 1 A SER -9 ? A SER 12 13 1 Y 1 A GLY -8 ? A GLY 13 14 1 Y 1 A ARG -7 ? A ARG 14 15 1 Y 1 A GLU -6 ? A GLU 15 16 1 Y 1 A ASN -5 ? A ASN 16 17 1 Y 1 A LEU -4 ? A LEU 17 18 1 Y 1 A TYR -3 ? A TYR 18 19 1 Y 1 A PHE -2 ? A PHE 19 20 1 Y 1 A GLN -1 ? A GLN 20 21 1 Y 1 A GLY 0 ? A GLY 21 22 1 Y 1 A VAL 1 ? A VAL 22 23 1 Y 1 A PRO 2 ? A PRO 23 24 1 Y 1 A MSE 3 ? A MSE 24 25 1 Y 1 A ASN 4 ? A ASN 25 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MSE N N N N 216 MSE CA C N S 217 MSE C C N N 218 MSE O O N N 219 MSE OXT O N N 220 MSE CB C N N 221 MSE CG C N N 222 MSE SE SE N N 223 MSE CE C N N 224 MSE H H N N 225 MSE H2 H N N 226 MSE HA H N N 227 MSE HXT H N N 228 MSE HB2 H N N 229 MSE HB3 H N N 230 MSE HG2 H N N 231 MSE HG3 H N N 232 MSE HE1 H N N 233 MSE HE2 H N N 234 MSE HE3 H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MSE N CA sing N N 205 MSE N H sing N N 206 MSE N H2 sing N N 207 MSE CA C sing N N 208 MSE CA CB sing N N 209 MSE CA HA sing N N 210 MSE C O doub N N 211 MSE C OXT sing N N 212 MSE OXT HXT sing N N 213 MSE CB CG sing N N 214 MSE CB HB2 sing N N 215 MSE CB HB3 sing N N 216 MSE CG SE sing N N 217 MSE CG HG2 sing N N 218 MSE CG HG3 sing N N 219 MSE SE CE sing N N 220 MSE CE HE1 sing N N 221 MSE CE HE2 sing N N 222 MSE CE HE3 sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _atom_sites.entry_id 3GHJ _atom_sites.fract_transf_matrix[1][1] 0.019607 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015062 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012373 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O SE # loop_