data_3HZ7 # _entry.id 3HZ7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3HZ7 pdb_00003hz7 10.2210/pdb3hz7/pdb RCSB RCSB053763 ? ? WWPDB D_1000053763 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-07-07 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2019-07-24 5 'Structure model' 2 0 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' Advisory 7 5 'Structure model' 'Atomic model' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Derived calculations' 11 5 'Structure model' 'Non-polymer description' 12 5 'Structure model' 'Polymer sequence' 13 5 'Structure model' 'Source and taxonomy' 14 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' software 3 4 'Structure model' struct_conn 4 5 'Structure model' atom_site 5 5 'Structure model' chem_comp 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' entity 10 5 'Structure model' entity_poly 11 5 'Structure model' entity_poly_seq 12 5 'Structure model' entity_src_gen 13 5 'Structure model' pdbx_distant_solvent_atoms 14 5 'Structure model' pdbx_entity_nonpoly 15 5 'Structure model' pdbx_entry_details 16 5 'Structure model' pdbx_modification_feature 17 5 'Structure model' pdbx_nonpoly_scheme 18 5 'Structure model' pdbx_poly_seq_scheme 19 5 'Structure model' pdbx_struct_assembly_gen 20 5 'Structure model' pdbx_struct_mod_residue 21 5 'Structure model' struct_asym 22 5 'Structure model' struct_conn 23 5 'Structure model' struct_mon_prot_cis 24 5 'Structure model' struct_ref 25 5 'Structure model' struct_ref_seq 26 5 'Structure model' struct_ref_seq_dif 27 5 'Structure model' struct_site 28 5 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.name' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.language' 5 4 'Structure model' '_software.location' 6 4 'Structure model' '_software.name' 7 4 'Structure model' '_software.type' 8 4 'Structure model' '_software.version' 9 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 10 5 'Structure model' '_atom_site.B_iso_or_equiv' 11 5 'Structure model' '_atom_site.Cartn_x' 12 5 'Structure model' '_atom_site.Cartn_y' 13 5 'Structure model' '_atom_site.Cartn_z' 14 5 'Structure model' '_atom_site.auth_atom_id' 15 5 'Structure model' '_atom_site.auth_comp_id' 16 5 'Structure model' '_atom_site.auth_seq_id' 17 5 'Structure model' '_atom_site.group_PDB' 18 5 'Structure model' '_atom_site.label_asym_id' 19 5 'Structure model' '_atom_site.label_atom_id' 20 5 'Structure model' '_atom_site.label_comp_id' 21 5 'Structure model' '_atom_site.label_entity_id' 22 5 'Structure model' '_atom_site.label_seq_id' 23 5 'Structure model' '_atom_site.type_symbol' 24 5 'Structure model' '_chem_comp.formula' 25 5 'Structure model' '_chem_comp.formula_weight' 26 5 'Structure model' '_chem_comp.id' 27 5 'Structure model' '_chem_comp.mon_nstd_flag' 28 5 'Structure model' '_chem_comp.name' 29 5 'Structure model' '_chem_comp.type' 30 5 'Structure model' '_database_2.pdbx_DOI' 31 5 'Structure model' '_database_2.pdbx_database_accession' 32 5 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 33 5 'Structure model' '_entity_poly_seq.mon_id' 34 5 'Structure model' '_entity_src_gen.pdbx_beg_seq_num' 35 5 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 36 5 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 37 5 'Structure model' '_entity_src_gen.pdbx_seq_type' 38 5 'Structure model' '_pdbx_entry_details.has_protein_modification' 39 5 'Structure model' '_pdbx_poly_seq_scheme.mon_id' 40 5 'Structure model' '_pdbx_poly_seq_scheme.pdb_mon_id' 41 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 42 5 'Structure model' '_struct_mon_prot_cis.auth_comp_id' 43 5 'Structure model' '_struct_mon_prot_cis.label_comp_id' 44 5 'Structure model' '_struct_ref.db_code' 45 5 'Structure model' '_struct_ref.pdbx_db_accession' 46 5 'Structure model' '_struct_ref_seq.pdbx_db_accession' 47 5 'Structure model' '_struct_ref_seq_dif.details' 48 5 'Structure model' '_struct_ref_seq_dif.pdbx_seq_db_accession_code' # _pdbx_database_status.entry_id 3HZ7 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-06-23 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id DhR2A _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Lew, S.' 2 'Seetharaman, J.' 3 'Sahdev, S.' 4 'Xiao, R.' 5 'Ciccosanti, C.' 6 'Maglaqui, M.' 7 'Everett, J.K.' 8 'Nair, R.' 9 'Acton, T.B.' 10 'Rost, B.' 11 'Montelione, G.T.' 12 'Tong, L.' 13 'Hunt, J.F.' 14 'Northeast Structural Genomics Consortium (NESG)' 15 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target DhR2A' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Forouhar, F.' 1 ? primary 'Lew, S.' 2 ? primary 'Seetharaman, J.' 3 ? primary 'Sahdev, S.' 4 ? primary 'Xiao, R.' 5 ? primary 'Ciccosanti, C.' 6 ? primary 'Maglaqui, M.' 7 ? primary 'Everett, J.K.' 8 ? primary 'Nair, R.' 9 ? primary 'Acton, T.B.' 10 ? primary 'Rost, B.' 11 ? primary 'Montelione, G.T.' 12 ? primary 'Tong, L.' 13 ? primary 'Hunt, J.F.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'UPF0033 domain-containing protein' 9583.475 1 ? ? 'sequence database residues 1-79' ? 2 water nat water 18.015 41 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)ITIDALGQV(CSS)PIPVIRAKKALAELGEAGGVVTVLVDNDISRQNLQK(MSE)AEG(MSE)GYQSEYLEKDNG VIEVTIVAGEGCAVELEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MITIDALGQVCPIPVIRAKKALAELGEAGGVVTVLVDNDISRQNLQKMAEGMGYQSEYLEKDNGVIEVTIVAGEGCAVEL EHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier DhR2A # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ILE n 1 3 THR n 1 4 ILE n 1 5 ASP n 1 6 ALA n 1 7 LEU n 1 8 GLY n 1 9 GLN n 1 10 VAL n 1 11 CSS n 1 12 PRO n 1 13 ILE n 1 14 PRO n 1 15 VAL n 1 16 ILE n 1 17 ARG n 1 18 ALA n 1 19 LYS n 1 20 LYS n 1 21 ALA n 1 22 LEU n 1 23 ALA n 1 24 GLU n 1 25 LEU n 1 26 GLY n 1 27 GLU n 1 28 ALA n 1 29 GLY n 1 30 GLY n 1 31 VAL n 1 32 VAL n 1 33 THR n 1 34 VAL n 1 35 LEU n 1 36 VAL n 1 37 ASP n 1 38 ASN n 1 39 ASP n 1 40 ILE n 1 41 SER n 1 42 ARG n 1 43 GLN n 1 44 ASN n 1 45 LEU n 1 46 GLN n 1 47 LYS n 1 48 MSE n 1 49 ALA n 1 50 GLU n 1 51 GLY n 1 52 MSE n 1 53 GLY n 1 54 TYR n 1 55 GLN n 1 56 SER n 1 57 GLU n 1 58 TYR n 1 59 LEU n 1 60 GLU n 1 61 LYS n 1 62 ASP n 1 63 ASN n 1 64 GLY n 1 65 VAL n 1 66 ILE n 1 67 GLU n 1 68 VAL n 1 69 THR n 1 70 ILE n 1 71 VAL n 1 72 ALA n 1 73 GLY n 1 74 GLU n 1 75 GLY n 1 76 CYS n 1 77 ALA n 1 78 VAL n 1 79 GLU n 1 80 LEU n 1 81 GLU n 1 82 HIS n 1 83 HIS n 1 84 HIS n 1 85 HIS n 1 86 HIS n 1 87 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 87 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene AT727_01915 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Y51 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Desulfitobacterium hafniense' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 49338 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector 'pET 21-23C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BL21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSS 'L-peptide linking' n S-MERCAPTOCYSTEINE ? 'C3 H7 N O2 S2' 153.223 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 CSS 11 11 11 CSS CYS A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 MSE 48 48 48 MSE MSE A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 MSE 52 52 52 MSE MSE A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLY 75 75 ? ? ? A . n A 1 76 CYS 76 76 ? ? ? A . n A 1 77 ALA 77 77 ? ? ? A . n A 1 78 VAL 78 78 ? ? ? A . n A 1 79 GLU 79 79 ? ? ? A . n A 1 80 LEU 80 80 ? ? ? A . n A 1 81 GLU 81 81 ? ? ? A . n A 1 82 HIS 82 82 ? ? ? A . n A 1 83 HIS 83 83 ? ? ? A . n A 1 84 HIS 84 84 ? ? ? A . n A 1 85 HIS 85 85 ? ? ? A . n A 1 86 HIS 86 86 ? ? ? A . n A 1 87 HIS 87 87 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 88 1 HOH HOH A . B 2 HOH 2 89 2 HOH HOH A . B 2 HOH 3 90 3 HOH HOH A . B 2 HOH 4 91 4 HOH HOH A . B 2 HOH 5 92 5 HOH HOH A . B 2 HOH 6 93 6 HOH HOH A . B 2 HOH 7 94 7 HOH HOH A . B 2 HOH 8 95 8 HOH HOH A . B 2 HOH 9 96 9 HOH HOH A . B 2 HOH 10 97 10 HOH HOH A . B 2 HOH 11 98 11 HOH HOH A . B 2 HOH 12 99 12 HOH HOH A . B 2 HOH 13 100 13 HOH HOH A . B 2 HOH 14 102 14 HOH HOH A . B 2 HOH 15 103 15 HOH HOH A . B 2 HOH 16 104 16 HOH HOH A . B 2 HOH 17 105 17 HOH HOH A . B 2 HOH 18 106 18 HOH HOH A . B 2 HOH 19 107 19 HOH HOH A . B 2 HOH 20 108 20 HOH HOH A . B 2 HOH 21 109 21 HOH HOH A . B 2 HOH 22 110 22 HOH HOH A . B 2 HOH 23 111 23 HOH HOH A . B 2 HOH 24 112 24 HOH HOH A . B 2 HOH 25 113 25 HOH HOH A . B 2 HOH 26 114 26 HOH HOH A . B 2 HOH 27 115 27 HOH HOH A . B 2 HOH 28 116 28 HOH HOH A . B 2 HOH 29 117 29 HOH HOH A . B 2 HOH 30 118 30 HOH HOH A . B 2 HOH 31 119 31 HOH HOH A . B 2 HOH 32 120 32 HOH HOH A . B 2 HOH 33 121 33 HOH HOH A . B 2 HOH 34 122 34 HOH HOH A . B 2 HOH 35 123 35 HOH HOH A . B 2 HOH 36 124 36 HOH HOH A . B 2 HOH 37 125 37 HOH HOH A . B 2 HOH 38 126 38 HOH HOH A . B 2 HOH 39 127 39 HOH HOH A . B 2 HOH 40 128 40 HOH HOH A . B 2 HOH 41 129 41 HOH HOH A . # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal CNS '1.2 & XtalView' ? ? ? ? refinement ? ? ? 1 PDB_EXTRACT 3.00 'March. 27, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 MAR345dtb . ? ? ? ? 'data collection' ? ? ? 3 DENZO . ? ? ? ? 'data reduction' ? ? ? 4 SCALEPACK . ? ? ? ? 'data scaling' ? ? ? 5 SnB 'then SOLVE/RESOLVE' ? ? ? ? phasing ? ? ? 6 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 7 # _cell.entry_id 3HZ7 _cell.length_a 46.046 _cell.length_b 46.046 _cell.length_c 82.811 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3HZ7 _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.Int_Tables_number 96 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 3HZ7 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 46.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details ;Protein solution: 100mM NaCl, 5mM DTT, 0.02% NaN3, 10mM Tris-HCl (pH 7.5), Reservoir solution: 100mM Bis-Tris Propane (pH 7), 40% PEG4k, and 100mM calcium chloride, Microbatch, under oil, temperature 277K ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.pdbx_collection_date 2009-05-28 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.pdbx_wavelength_list 0.97976 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL9-2 # _reflns.entry_id 3HZ7 _reflns.B_iso_Wilson_estimate 21.300 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 30 _reflns.number_all 11596 _reflns.number_obs 11492 _reflns.percent_possible_obs 99.1 _reflns.pdbx_Rmerge_I_obs 0.042 _reflns.pdbx_Rsym_value 0.033 _reflns.pdbx_netI_over_sigmaI 62.7 _reflns.pdbx_redundancy 14.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 96.4 _reflns_shell.Rmerge_I_obs 0.236 _reflns_shell.meanI_over_sigI_obs 10.1 _reflns_shell.pdbx_Rsym_value 0.201 _reflns_shell.pdbx_redundancy 10.0 _reflns_shell.number_unique_all 1159 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3HZ7 _refine.ls_d_res_high 2.000 _refine.ls_d_res_low 19.980 _refine.pdbx_ls_sigma_F 2.00 _refine.pdbx_data_cutoff_high_absF 504513.781 _refine.pdbx_data_cutoff_low_absF 0.000 _refine.ls_percent_reflns_obs 95.000 _refine.ls_number_reflns_obs 10918 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.ls_R_factor_R_work 0.228 _refine.ls_R_factor_R_free 0.250 _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 561 _refine.ls_R_factor_R_free_error 0.011 _refine.B_iso_mean 32.600 _refine.solvent_model_param_bsol 55.676 _refine.solvent_model_param_ksol 0.400 _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.aniso_B[1][1] 0.340 _refine.aniso_B[2][2] 0.340 _refine.aniso_B[3][3] -0.690 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details 'FLAT MODEL' _refine.pdbx_ls_sigma_I 2.00 _refine.ls_number_reflns_all 11492 _refine.ls_R_factor_all 0.230 _refine.ls_R_factor_obs 0.229 _refine.ls_redundancy_reflns_obs ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.occupancy_max ? _refine.occupancy_min ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3HZ7 _refine_analyze.Luzzati_coordinate_error_obs 0.250 _refine_analyze.Luzzati_sigma_a_obs 0.170 _refine_analyze.Luzzati_d_res_low_obs 5.000 _refine_analyze.Luzzati_coordinate_error_free 0.320 _refine_analyze.Luzzati_sigma_a_free 0.240 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 548 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 590 _refine_hist.d_res_high 2.000 _refine_hist.d_res_low 19.980 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.022 ? ? 'X-RAY DIFFRACTION' ? c_angle_deg ? 1.800 ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? 24.700 ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? 1.150 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 2.000 _refine_ls_shell.d_res_low 2.070 _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.percent_reflns_obs 83.600 _refine_ls_shell.number_reflns_R_work 914 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.249 _refine_ls_shell.R_factor_R_free 0.273 _refine_ls_shell.percent_reflns_R_free 4.400 _refine_ls_shell.number_reflns_R_free 42 _refine_ls_shell.R_factor_R_free_error 0.042 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 956 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 3HZ7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _struct.entry_id 3HZ7 _struct.title ;Crystal Structure of the SirA-like protein (DSY4693) from Desulfitobacterium hafniense, Northeast Structural Genomics Consortium Target DhR2A ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3HZ7 _struct_keywords.text ;alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0W1JQA6_DESHA _struct_ref.pdbx_db_accession A0A0W1JQA6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MITIDALGQVCPIPVIRAKKALAELGEAGGVVTVLVDNDISRQNLQKMAEGMGYQAEYLEKDNGVIEVTIVAGEGCAVE _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3HZ7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0W1JQA6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 79 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 79 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3HZ7 SER A 56 ? UNP A0A0W1JQA6 ALA 56 conflict 56 1 1 3HZ7 LEU A 80 ? UNP A0A0W1JQA6 ? ? 'expression tag' 80 2 1 3HZ7 GLU A 81 ? UNP A0A0W1JQA6 ? ? 'expression tag' 81 3 1 3HZ7 HIS A 82 ? UNP A0A0W1JQA6 ? ? 'expression tag' 82 4 1 3HZ7 HIS A 83 ? UNP A0A0W1JQA6 ? ? 'expression tag' 83 5 1 3HZ7 HIS A 84 ? UNP A0A0W1JQA6 ? ? 'expression tag' 84 6 1 3HZ7 HIS A 85 ? UNP A0A0W1JQA6 ? ? 'expression tag' 85 7 1 3HZ7 HIS A 86 ? UNP A0A0W1JQA6 ? ? 'expression tag' 86 8 1 3HZ7 HIS A 87 ? UNP A0A0W1JQA6 ? ? 'expression tag' 87 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 12 ? GLU A 24 ? PRO A 12 GLU A 24 1 ? 13 HELX_P HELX_P2 2 LEU A 25 ? GLY A 29 ? LEU A 25 GLY A 29 5 ? 5 HELX_P HELX_P3 3 ASN A 38 ? GLY A 53 ? ASN A 38 GLY A 53 1 ? 16 HELX_P HELX_P4 4 ASP A 62 ? GLY A 64 ? ASP A 62 GLY A 64 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A ILE 2 N ? ? A MSE 1 A ILE 2 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A VAL 10 C ? ? ? 1_555 A CSS 11 N ? ? A VAL 10 A CSS 11 1_555 ? ? ? ? ? ? ? 1.317 ? ? covale3 covale both ? A CSS 11 C ? ? ? 1_555 A PRO 12 N ? ? A CSS 11 A PRO 12 1_555 ? ? ? ? ? ? ? 1.350 ? ? covale4 covale both ? A LYS 47 C ? ? ? 1_555 A MSE 48 N ? ? A LYS 47 A MSE 48 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale5 covale both ? A MSE 48 C ? ? ? 1_555 A ALA 49 N ? ? A MSE 48 A ALA 49 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale6 covale both ? A GLY 51 C ? ? ? 1_555 A MSE 52 N ? ? A GLY 51 A MSE 52 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale7 covale both ? A MSE 52 C ? ? ? 1_555 A GLY 53 N ? ? A MSE 52 A GLY 53 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 1 ? . . . . MSE A 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 CSS A 11 ? . . . . CSS A 11 ? 1_555 . . . . . . . CYS 1 CSS Sulfhydration 'Named protein modification' 3 MSE A 48 ? . . . . MSE A 48 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 52 ? . . . . MSE A 52 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id CSS _struct_mon_prot_cis.label_seq_id 11 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id CSS _struct_mon_prot_cis.auth_seq_id 11 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 12 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 12 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.79 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 2 ? ASP A 5 ? ILE A 2 ASP A 5 A 2 VAL A 31 ? VAL A 36 ? VAL A 31 VAL A 36 A 3 ILE A 66 ? VAL A 71 ? ILE A 66 VAL A 71 A 4 GLN A 55 ? GLU A 60 ? GLN A 55 GLU A 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 2 ? N ILE A 2 O THR A 33 ? O THR A 33 A 2 3 N VAL A 36 ? N VAL A 36 O ILE A 66 ? O ILE A 66 A 3 4 O GLU A 67 ? O GLU A 67 N LEU A 59 ? N LEU A 59 # _pdbx_entry_details.sequence_details 'THE CURRENT CRYSTAL STRUCTURE SUGGESTS THAT THERE IS AN ADDITIONAL MUTATION AT POSITION 56 FROM ALA TO SERINE.' _pdbx_entry_details.entry_id 3HZ7 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLY 73 ? ? O A HOH 129 ? ? 2.05 2 1 OD2 A ASP 39 ? ? O A HOH 102 ? ? 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 24 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 24 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_665 _pdbx_validate_symm_contact.dist 2.11 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 63 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 70.89 _pdbx_validate_torsion.psi 32.44 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET 'modified residue' 2 A CSS 11 A CSS 11 ? CYS 'modified residue' 3 A MSE 48 A MSE 48 ? MET 'modified residue' 4 A MSE 52 A MSE 52 ? MET 'modified residue' # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 107 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.30 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 75 ? A GLY 75 2 1 Y 1 A CYS 76 ? A CYS 76 3 1 Y 1 A ALA 77 ? A ALA 77 4 1 Y 1 A VAL 78 ? A VAL 78 5 1 Y 1 A GLU 79 ? A GLU 79 6 1 Y 1 A LEU 80 ? A LEU 80 7 1 Y 1 A GLU 81 ? A GLU 81 8 1 Y 1 A HIS 82 ? A HIS 82 9 1 Y 1 A HIS 83 ? A HIS 83 10 1 Y 1 A HIS 84 ? A HIS 84 11 1 Y 1 A HIS 85 ? A HIS 85 12 1 Y 1 A HIS 86 ? A HIS 86 13 1 Y 1 A HIS 87 ? A HIS 87 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CSS N N N N 74 CSS CA C N R 75 CSS CB C N N 76 CSS SG S N N 77 CSS SD S N N 78 CSS C C N N 79 CSS O O N N 80 CSS OXT O N N 81 CSS H H N N 82 CSS H2 H N N 83 CSS HA H N N 84 CSS HB2 H N N 85 CSS HB3 H N N 86 CSS HD H N N 87 CSS HXT H N N 88 CYS N N N N 89 CYS CA C N R 90 CYS C C N N 91 CYS O O N N 92 CYS CB C N N 93 CYS SG S N N 94 CYS OXT O N N 95 CYS H H N N 96 CYS H2 H N N 97 CYS HA H N N 98 CYS HB2 H N N 99 CYS HB3 H N N 100 CYS HG H N N 101 CYS HXT H N N 102 GLN N N N N 103 GLN CA C N S 104 GLN C C N N 105 GLN O O N N 106 GLN CB C N N 107 GLN CG C N N 108 GLN CD C N N 109 GLN OE1 O N N 110 GLN NE2 N N N 111 GLN OXT O N N 112 GLN H H N N 113 GLN H2 H N N 114 GLN HA H N N 115 GLN HB2 H N N 116 GLN HB3 H N N 117 GLN HG2 H N N 118 GLN HG3 H N N 119 GLN HE21 H N N 120 GLN HE22 H N N 121 GLN HXT H N N 122 GLU N N N N 123 GLU CA C N S 124 GLU C C N N 125 GLU O O N N 126 GLU CB C N N 127 GLU CG C N N 128 GLU CD C N N 129 GLU OE1 O N N 130 GLU OE2 O N N 131 GLU OXT O N N 132 GLU H H N N 133 GLU H2 H N N 134 GLU HA H N N 135 GLU HB2 H N N 136 GLU HB3 H N N 137 GLU HG2 H N N 138 GLU HG3 H N N 139 GLU HE2 H N N 140 GLU HXT H N N 141 GLY N N N N 142 GLY CA C N N 143 GLY C C N N 144 GLY O O N N 145 GLY OXT O N N 146 GLY H H N N 147 GLY H2 H N N 148 GLY HA2 H N N 149 GLY HA3 H N N 150 GLY HXT H N N 151 HIS N N N N 152 HIS CA C N S 153 HIS C C N N 154 HIS O O N N 155 HIS CB C N N 156 HIS CG C Y N 157 HIS ND1 N Y N 158 HIS CD2 C Y N 159 HIS CE1 C Y N 160 HIS NE2 N Y N 161 HIS OXT O N N 162 HIS H H N N 163 HIS H2 H N N 164 HIS HA H N N 165 HIS HB2 H N N 166 HIS HB3 H N N 167 HIS HD1 H N N 168 HIS HD2 H N N 169 HIS HE1 H N N 170 HIS HE2 H N N 171 HIS HXT H N N 172 HOH O O N N 173 HOH H1 H N N 174 HOH H2 H N N 175 ILE N N N N 176 ILE CA C N S 177 ILE C C N N 178 ILE O O N N 179 ILE CB C N S 180 ILE CG1 C N N 181 ILE CG2 C N N 182 ILE CD1 C N N 183 ILE OXT O N N 184 ILE H H N N 185 ILE H2 H N N 186 ILE HA H N N 187 ILE HB H N N 188 ILE HG12 H N N 189 ILE HG13 H N N 190 ILE HG21 H N N 191 ILE HG22 H N N 192 ILE HG23 H N N 193 ILE HD11 H N N 194 ILE HD12 H N N 195 ILE HD13 H N N 196 ILE HXT H N N 197 LEU N N N N 198 LEU CA C N S 199 LEU C C N N 200 LEU O O N N 201 LEU CB C N N 202 LEU CG C N N 203 LEU CD1 C N N 204 LEU CD2 C N N 205 LEU OXT O N N 206 LEU H H N N 207 LEU H2 H N N 208 LEU HA H N N 209 LEU HB2 H N N 210 LEU HB3 H N N 211 LEU HG H N N 212 LEU HD11 H N N 213 LEU HD12 H N N 214 LEU HD13 H N N 215 LEU HD21 H N N 216 LEU HD22 H N N 217 LEU HD23 H N N 218 LEU HXT H N N 219 LYS N N N N 220 LYS CA C N S 221 LYS C C N N 222 LYS O O N N 223 LYS CB C N N 224 LYS CG C N N 225 LYS CD C N N 226 LYS CE C N N 227 LYS NZ N N N 228 LYS OXT O N N 229 LYS H H N N 230 LYS H2 H N N 231 LYS HA H N N 232 LYS HB2 H N N 233 LYS HB3 H N N 234 LYS HG2 H N N 235 LYS HG3 H N N 236 LYS HD2 H N N 237 LYS HD3 H N N 238 LYS HE2 H N N 239 LYS HE3 H N N 240 LYS HZ1 H N N 241 LYS HZ2 H N N 242 LYS HZ3 H N N 243 LYS HXT H N N 244 MSE N N N N 245 MSE CA C N S 246 MSE C C N N 247 MSE O O N N 248 MSE OXT O N N 249 MSE CB C N N 250 MSE CG C N N 251 MSE SE SE N N 252 MSE CE C N N 253 MSE H H N N 254 MSE H2 H N N 255 MSE HA H N N 256 MSE HXT H N N 257 MSE HB2 H N N 258 MSE HB3 H N N 259 MSE HG2 H N N 260 MSE HG3 H N N 261 MSE HE1 H N N 262 MSE HE2 H N N 263 MSE HE3 H N N 264 PRO N N N N 265 PRO CA C N S 266 PRO C C N N 267 PRO O O N N 268 PRO CB C N N 269 PRO CG C N N 270 PRO CD C N N 271 PRO OXT O N N 272 PRO H H N N 273 PRO HA H N N 274 PRO HB2 H N N 275 PRO HB3 H N N 276 PRO HG2 H N N 277 PRO HG3 H N N 278 PRO HD2 H N N 279 PRO HD3 H N N 280 PRO HXT H N N 281 SER N N N N 282 SER CA C N S 283 SER C C N N 284 SER O O N N 285 SER CB C N N 286 SER OG O N N 287 SER OXT O N N 288 SER H H N N 289 SER H2 H N N 290 SER HA H N N 291 SER HB2 H N N 292 SER HB3 H N N 293 SER HG H N N 294 SER HXT H N N 295 THR N N N N 296 THR CA C N S 297 THR C C N N 298 THR O O N N 299 THR CB C N R 300 THR OG1 O N N 301 THR CG2 C N N 302 THR OXT O N N 303 THR H H N N 304 THR H2 H N N 305 THR HA H N N 306 THR HB H N N 307 THR HG1 H N N 308 THR HG21 H N N 309 THR HG22 H N N 310 THR HG23 H N N 311 THR HXT H N N 312 TYR N N N N 313 TYR CA C N S 314 TYR C C N N 315 TYR O O N N 316 TYR CB C N N 317 TYR CG C Y N 318 TYR CD1 C Y N 319 TYR CD2 C Y N 320 TYR CE1 C Y N 321 TYR CE2 C Y N 322 TYR CZ C Y N 323 TYR OH O N N 324 TYR OXT O N N 325 TYR H H N N 326 TYR H2 H N N 327 TYR HA H N N 328 TYR HB2 H N N 329 TYR HB3 H N N 330 TYR HD1 H N N 331 TYR HD2 H N N 332 TYR HE1 H N N 333 TYR HE2 H N N 334 TYR HH H N N 335 TYR HXT H N N 336 VAL N N N N 337 VAL CA C N S 338 VAL C C N N 339 VAL O O N N 340 VAL CB C N N 341 VAL CG1 C N N 342 VAL CG2 C N N 343 VAL OXT O N N 344 VAL H H N N 345 VAL H2 H N N 346 VAL HA H N N 347 VAL HB H N N 348 VAL HG11 H N N 349 VAL HG12 H N N 350 VAL HG13 H N N 351 VAL HG21 H N N 352 VAL HG22 H N N 353 VAL HG23 H N N 354 VAL HXT H N N 355 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CSS N CA sing N N 70 CSS N H sing N N 71 CSS N H2 sing N N 72 CSS CA CB sing N N 73 CSS CA C sing N N 74 CSS CA HA sing N N 75 CSS CB SG sing N N 76 CSS CB HB2 sing N N 77 CSS CB HB3 sing N N 78 CSS SG SD sing N N 79 CSS SD HD sing N N 80 CSS C O doub N N 81 CSS C OXT sing N N 82 CSS OXT HXT sing N N 83 CYS N CA sing N N 84 CYS N H sing N N 85 CYS N H2 sing N N 86 CYS CA C sing N N 87 CYS CA CB sing N N 88 CYS CA HA sing N N 89 CYS C O doub N N 90 CYS C OXT sing N N 91 CYS CB SG sing N N 92 CYS CB HB2 sing N N 93 CYS CB HB3 sing N N 94 CYS SG HG sing N N 95 CYS OXT HXT sing N N 96 GLN N CA sing N N 97 GLN N H sing N N 98 GLN N H2 sing N N 99 GLN CA C sing N N 100 GLN CA CB sing N N 101 GLN CA HA sing N N 102 GLN C O doub N N 103 GLN C OXT sing N N 104 GLN CB CG sing N N 105 GLN CB HB2 sing N N 106 GLN CB HB3 sing N N 107 GLN CG CD sing N N 108 GLN CG HG2 sing N N 109 GLN CG HG3 sing N N 110 GLN CD OE1 doub N N 111 GLN CD NE2 sing N N 112 GLN NE2 HE21 sing N N 113 GLN NE2 HE22 sing N N 114 GLN OXT HXT sing N N 115 GLU N CA sing N N 116 GLU N H sing N N 117 GLU N H2 sing N N 118 GLU CA C sing N N 119 GLU CA CB sing N N 120 GLU CA HA sing N N 121 GLU C O doub N N 122 GLU C OXT sing N N 123 GLU CB CG sing N N 124 GLU CB HB2 sing N N 125 GLU CB HB3 sing N N 126 GLU CG CD sing N N 127 GLU CG HG2 sing N N 128 GLU CG HG3 sing N N 129 GLU CD OE1 doub N N 130 GLU CD OE2 sing N N 131 GLU OE2 HE2 sing N N 132 GLU OXT HXT sing N N 133 GLY N CA sing N N 134 GLY N H sing N N 135 GLY N H2 sing N N 136 GLY CA C sing N N 137 GLY CA HA2 sing N N 138 GLY CA HA3 sing N N 139 GLY C O doub N N 140 GLY C OXT sing N N 141 GLY OXT HXT sing N N 142 HIS N CA sing N N 143 HIS N H sing N N 144 HIS N H2 sing N N 145 HIS CA C sing N N 146 HIS CA CB sing N N 147 HIS CA HA sing N N 148 HIS C O doub N N 149 HIS C OXT sing N N 150 HIS CB CG sing N N 151 HIS CB HB2 sing N N 152 HIS CB HB3 sing N N 153 HIS CG ND1 sing Y N 154 HIS CG CD2 doub Y N 155 HIS ND1 CE1 doub Y N 156 HIS ND1 HD1 sing N N 157 HIS CD2 NE2 sing Y N 158 HIS CD2 HD2 sing N N 159 HIS CE1 NE2 sing Y N 160 HIS CE1 HE1 sing N N 161 HIS NE2 HE2 sing N N 162 HIS OXT HXT sing N N 163 HOH O H1 sing N N 164 HOH O H2 sing N N 165 ILE N CA sing N N 166 ILE N H sing N N 167 ILE N H2 sing N N 168 ILE CA C sing N N 169 ILE CA CB sing N N 170 ILE CA HA sing N N 171 ILE C O doub N N 172 ILE C OXT sing N N 173 ILE CB CG1 sing N N 174 ILE CB CG2 sing N N 175 ILE CB HB sing N N 176 ILE CG1 CD1 sing N N 177 ILE CG1 HG12 sing N N 178 ILE CG1 HG13 sing N N 179 ILE CG2 HG21 sing N N 180 ILE CG2 HG22 sing N N 181 ILE CG2 HG23 sing N N 182 ILE CD1 HD11 sing N N 183 ILE CD1 HD12 sing N N 184 ILE CD1 HD13 sing N N 185 ILE OXT HXT sing N N 186 LEU N CA sing N N 187 LEU N H sing N N 188 LEU N H2 sing N N 189 LEU CA C sing N N 190 LEU CA CB sing N N 191 LEU CA HA sing N N 192 LEU C O doub N N 193 LEU C OXT sing N N 194 LEU CB CG sing N N 195 LEU CB HB2 sing N N 196 LEU CB HB3 sing N N 197 LEU CG CD1 sing N N 198 LEU CG CD2 sing N N 199 LEU CG HG sing N N 200 LEU CD1 HD11 sing N N 201 LEU CD1 HD12 sing N N 202 LEU CD1 HD13 sing N N 203 LEU CD2 HD21 sing N N 204 LEU CD2 HD22 sing N N 205 LEU CD2 HD23 sing N N 206 LEU OXT HXT sing N N 207 LYS N CA sing N N 208 LYS N H sing N N 209 LYS N H2 sing N N 210 LYS CA C sing N N 211 LYS CA CB sing N N 212 LYS CA HA sing N N 213 LYS C O doub N N 214 LYS C OXT sing N N 215 LYS CB CG sing N N 216 LYS CB HB2 sing N N 217 LYS CB HB3 sing N N 218 LYS CG CD sing N N 219 LYS CG HG2 sing N N 220 LYS CG HG3 sing N N 221 LYS CD CE sing N N 222 LYS CD HD2 sing N N 223 LYS CD HD3 sing N N 224 LYS CE NZ sing N N 225 LYS CE HE2 sing N N 226 LYS CE HE3 sing N N 227 LYS NZ HZ1 sing N N 228 LYS NZ HZ2 sing N N 229 LYS NZ HZ3 sing N N 230 LYS OXT HXT sing N N 231 MSE N CA sing N N 232 MSE N H sing N N 233 MSE N H2 sing N N 234 MSE CA C sing N N 235 MSE CA CB sing N N 236 MSE CA HA sing N N 237 MSE C O doub N N 238 MSE C OXT sing N N 239 MSE OXT HXT sing N N 240 MSE CB CG sing N N 241 MSE CB HB2 sing N N 242 MSE CB HB3 sing N N 243 MSE CG SE sing N N 244 MSE CG HG2 sing N N 245 MSE CG HG3 sing N N 246 MSE SE CE sing N N 247 MSE CE HE1 sing N N 248 MSE CE HE2 sing N N 249 MSE CE HE3 sing N N 250 PRO N CA sing N N 251 PRO N CD sing N N 252 PRO N H sing N N 253 PRO CA C sing N N 254 PRO CA CB sing N N 255 PRO CA HA sing N N 256 PRO C O doub N N 257 PRO C OXT sing N N 258 PRO CB CG sing N N 259 PRO CB HB2 sing N N 260 PRO CB HB3 sing N N 261 PRO CG CD sing N N 262 PRO CG HG2 sing N N 263 PRO CG HG3 sing N N 264 PRO CD HD2 sing N N 265 PRO CD HD3 sing N N 266 PRO OXT HXT sing N N 267 SER N CA sing N N 268 SER N H sing N N 269 SER N H2 sing N N 270 SER CA C sing N N 271 SER CA CB sing N N 272 SER CA HA sing N N 273 SER C O doub N N 274 SER C OXT sing N N 275 SER CB OG sing N N 276 SER CB HB2 sing N N 277 SER CB HB3 sing N N 278 SER OG HG sing N N 279 SER OXT HXT sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TYR N CA sing N N 297 TYR N H sing N N 298 TYR N H2 sing N N 299 TYR CA C sing N N 300 TYR CA CB sing N N 301 TYR CA HA sing N N 302 TYR C O doub N N 303 TYR C OXT sing N N 304 TYR CB CG sing N N 305 TYR CB HB2 sing N N 306 TYR CB HB3 sing N N 307 TYR CG CD1 doub Y N 308 TYR CG CD2 sing Y N 309 TYR CD1 CE1 sing Y N 310 TYR CD1 HD1 sing N N 311 TYR CD2 CE2 doub Y N 312 TYR CD2 HD2 sing N N 313 TYR CE1 CZ doub Y N 314 TYR CE1 HE1 sing N N 315 TYR CE2 CZ sing Y N 316 TYR CE2 HE2 sing N N 317 TYR CZ OH sing N N 318 TYR OH HH sing N N 319 TYR OXT HXT sing N N 320 VAL N CA sing N N 321 VAL N H sing N N 322 VAL N H2 sing N N 323 VAL CA C sing N N 324 VAL CA CB sing N N 325 VAL CA HA sing N N 326 VAL C O doub N N 327 VAL C OXT sing N N 328 VAL CB CG1 sing N N 329 VAL CB CG2 sing N N 330 VAL CB HB sing N N 331 VAL CG1 HG11 sing N N 332 VAL CG1 HG12 sing N N 333 VAL CG1 HG13 sing N N 334 VAL CG2 HG21 sing N N 335 VAL CG2 HG22 sing N N 336 VAL CG2 HG23 sing N N 337 VAL OXT HXT sing N N 338 # _atom_sites.entry_id 3HZ7 _atom_sites.fract_transf_matrix[1][1] 0.021717 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021717 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012076 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_