data_3IHD # _entry.id 3IHD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3IHD pdb_00003ihd 10.2210/pdb3ihd/pdb RCSB RCSB054412 ? ? WWPDB D_1000054412 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3IHC 'Wild form' unspecified PDB 3IHE mutant unspecified PDB 3IHF mutant unspecified PDB 3IIG mutant unspecified PDB 3IIH 'Wild form' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3IHD _pdbx_database_status.recvd_initial_deposition_date 2009-07-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Priyadarshi, A.' 1 'Hwang, K.Y.' 2 # _citation.id primary _citation.title 'Structural insights into mouse anti-apoptotic Bcl-xl reveal affinity for Beclin 1 and gossypol.' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 394 _citation.page_first 515 _citation.page_last 521 _citation.year 2010 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20206602 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2010.03.002 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Priyadarshi, A.' 1 ? primary 'Roy, A.' 2 ? primary 'Kim, K.S.' 3 ? primary 'Kim, E.E.' 4 ? primary 'Hwang, K.Y.' 5 ? # _cell.entry_id 3IHD _cell.length_a 62.811 _cell.length_b 62.811 _cell.length_c 111.137 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3IHD _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bcl-2-like protein 1' 22102.260 1 ? Y101A 'UNP residues 1-196' ? 2 water nat water 18.015 134 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bcl-xl, Bcl2-L-1, Apoptosis regulator Bcl-X' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDARE VIPMAAVKQALREAGDEFELRARRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEM QVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYG ; _entity_poly.pdbx_seq_one_letter_code_can ;HMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDARE VIPMAAVKQALREAGDEFELRARRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEM QVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 SER n 1 4 GLN n 1 5 SER n 1 6 ASN n 1 7 ARG n 1 8 GLU n 1 9 LEU n 1 10 VAL n 1 11 VAL n 1 12 ASP n 1 13 PHE n 1 14 LEU n 1 15 SER n 1 16 TYR n 1 17 LYS n 1 18 LEU n 1 19 SER n 1 20 GLN n 1 21 LYS n 1 22 GLY n 1 23 TYR n 1 24 SER n 1 25 TRP n 1 26 SER n 1 27 GLN n 1 28 PHE n 1 29 SER n 1 30 ASP n 1 31 VAL n 1 32 GLU n 1 33 GLU n 1 34 ASN n 1 35 ARG n 1 36 THR n 1 37 GLU n 1 38 ALA n 1 39 PRO n 1 40 GLU n 1 41 GLU n 1 42 THR n 1 43 GLU n 1 44 ALA n 1 45 GLU n 1 46 ARG n 1 47 GLU n 1 48 THR n 1 49 PRO n 1 50 SER n 1 51 ALA n 1 52 ILE n 1 53 ASN n 1 54 GLY n 1 55 ASN n 1 56 PRO n 1 57 SER n 1 58 TRP n 1 59 HIS n 1 60 LEU n 1 61 ALA n 1 62 ASP n 1 63 SER n 1 64 PRO n 1 65 ALA n 1 66 VAL n 1 67 ASN n 1 68 GLY n 1 69 ALA n 1 70 THR n 1 71 GLY n 1 72 HIS n 1 73 SER n 1 74 SER n 1 75 SER n 1 76 LEU n 1 77 ASP n 1 78 ALA n 1 79 ARG n 1 80 GLU n 1 81 VAL n 1 82 ILE n 1 83 PRO n 1 84 MET n 1 85 ALA n 1 86 ALA n 1 87 VAL n 1 88 LYS n 1 89 GLN n 1 90 ALA n 1 91 LEU n 1 92 ARG n 1 93 GLU n 1 94 ALA n 1 95 GLY n 1 96 ASP n 1 97 GLU n 1 98 PHE n 1 99 GLU n 1 100 LEU n 1 101 ARG n 1 102 ALA n 1 103 ARG n 1 104 ARG n 1 105 ALA n 1 106 PHE n 1 107 SER n 1 108 ASP n 1 109 LEU n 1 110 THR n 1 111 SER n 1 112 GLN n 1 113 LEU n 1 114 HIS n 1 115 ILE n 1 116 THR n 1 117 PRO n 1 118 GLY n 1 119 THR n 1 120 ALA n 1 121 TYR n 1 122 GLN n 1 123 SER n 1 124 PHE n 1 125 GLU n 1 126 GLN n 1 127 VAL n 1 128 VAL n 1 129 ASN n 1 130 GLU n 1 131 LEU n 1 132 PHE n 1 133 ARG n 1 134 ASP n 1 135 GLY n 1 136 VAL n 1 137 ASN n 1 138 TRP n 1 139 GLY n 1 140 ARG n 1 141 ILE n 1 142 VAL n 1 143 ALA n 1 144 PHE n 1 145 PHE n 1 146 SER n 1 147 PHE n 1 148 GLY n 1 149 GLY n 1 150 ALA n 1 151 LEU n 1 152 CYS n 1 153 VAL n 1 154 GLU n 1 155 SER n 1 156 VAL n 1 157 ASP n 1 158 LYS n 1 159 GLU n 1 160 MET n 1 161 GLN n 1 162 VAL n 1 163 LEU n 1 164 VAL n 1 165 SER n 1 166 ARG n 1 167 ILE n 1 168 ALA n 1 169 SER n 1 170 TRP n 1 171 MET n 1 172 ALA n 1 173 THR n 1 174 TYR n 1 175 LEU n 1 176 ASN n 1 177 ASP n 1 178 HIS n 1 179 LEU n 1 180 GLU n 1 181 PRO n 1 182 TRP n 1 183 ILE n 1 184 GLN n 1 185 GLU n 1 186 ASN n 1 187 GLY n 1 188 GLY n 1 189 TRP n 1 190 ASP n 1 191 THR n 1 192 PHE n 1 193 VAL n 1 194 ASP n 1 195 LEU n 1 196 TYR n 1 197 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Bcl-xl, Bcl2l, Bcl2l1, Bclx' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2CL1_MOUSE _struct_ref.pdbx_db_accession Q64373 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ VLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3IHD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 197 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q64373 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 196 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 196 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3IHD HIS A 1 ? UNP Q64373 ? ? 'expression tag' 0 1 1 3IHD ALA A 102 ? UNP Q64373 TYR 101 'engineered mutation' 101 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3IHD _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_percent_sol 50.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pdbx_details '1.4M Ammonium Sulphate, Tri-Na citrate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.pdbx_collection_date 2008-10-08 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PAL/PLS BEAMLINE 6C1' _diffrn_source.pdbx_synchrotron_site PAL/PLS _diffrn_source.pdbx_synchrotron_beamline 6C1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0000 # _reflns.entry_id 3IHD _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 1.88 _reflns.number_obs 16650 _reflns.number_all 17580 _reflns.percent_possible_obs 93.45 _reflns.pdbx_Rmerge_I_obs 0.08 _reflns.pdbx_Rsym_value 0.34 _reflns.pdbx_netI_over_sigmaI 18.9 _reflns.B_iso_Wilson_estimate 19.6 _reflns.pdbx_redundancy 10.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.88 _reflns_shell.d_res_low 1.95 _reflns_shell.percent_possible_all 51.2 _reflns_shell.Rmerge_I_obs 0.08 _reflns_shell.pdbx_Rsym_value 0.34 _reflns_shell.meanI_over_sigI_obs 1.6 _reflns_shell.pdbx_redundancy 2.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 949 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3IHD _refine.ls_number_reflns_obs 16648 _refine.ls_number_reflns_all 17580 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 41.24 _refine.ls_d_res_high 1.88 _refine.ls_percent_reflns_obs 93.46 _refine.ls_R_factor_obs 0.17302 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.17101 _refine.ls_R_factor_R_free 0.21043 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 891 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.952 _refine.correlation_coeff_Fo_to_Fc_free 0.931 _refine.B_iso_mean 20.758 _refine.aniso_B[1][1] 0.04 _refine.aniso_B[2][2] 0.04 _refine.aniso_B[3][3] -0.07 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 1PQ0 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.112 _refine.pdbx_overall_ESU_R_Free 0.115 _refine.overall_SU_ML 0.076 _refine.overall_SU_B 2.611 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1157 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 134 _refine_hist.number_atoms_total 1291 _refine_hist.d_res_high 1.88 _refine_hist.d_res_low 41.24 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.023 0.022 ? 1186 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.817 1.915 ? 1604 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.578 5.000 ? 141 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 36.978 23.810 ? 63 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 17.132 15.000 ? 191 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 23.321 15.000 ? 8 'X-RAY DIFFRACTION' ? r_chiral_restr 0.148 0.200 ? 167 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.010 0.020 ? 922 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.261 1.500 ? 707 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.427 2.000 ? 1128 'X-RAY DIFFRACTION' ? r_scbond_it 3.864 3.000 ? 479 'X-RAY DIFFRACTION' ? r_scangle_it 6.087 4.500 ? 476 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.881 _refine_ls_shell.d_res_low 1.930 _refine_ls_shell.number_reflns_R_work 598 _refine_ls_shell.R_factor_R_work 0.284 _refine_ls_shell.percent_reflns_obs 46.39 _refine_ls_shell.R_factor_R_free 0.393 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 31 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3IHD _struct.title 'Crystal structure of mouse Bcl-xl mutant (Y101A) at pH 5.0' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3IHD _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text 'Apoptosis, BH3 domain, Bcl-2, Membrane, Mitochondrion, Transmembrane' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 1 ? GLY A 22 ? HIS A 0 GLY A 21 1 ? 22 HELX_P HELX_P2 2 PRO A 83 ? ARG A 103 ? PRO A 82 ARG A 102 1 ? 21 HELX_P HELX_P3 3 PHE A 106 ? HIS A 114 ? PHE A 105 HIS A 113 1 ? 9 HELX_P HELX_P4 4 ALA A 120 ? ASN A 129 ? ALA A 119 ASN A 128 1 ? 10 HELX_P HELX_P5 5 GLU A 130 ? ARG A 133 ? GLU A 129 ARG A 132 5 ? 4 HELX_P HELX_P6 6 ASN A 137 ? LYS A 158 ? ASN A 136 LYS A 157 1 ? 22 HELX_P HELX_P7 7 VAL A 162 ? LEU A 179 ? VAL A 161 LEU A 178 1 ? 18 HELX_P HELX_P8 8 LEU A 179 ? ASN A 186 ? LEU A 178 ASN A 185 1 ? 8 HELX_P HELX_P9 9 GLY A 188 ? GLY A 197 ? GLY A 187 GLY A 196 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 3IHD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3IHD _atom_sites.fract_transf_matrix[1][1] 0.015921 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015921 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008998 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 0 0 HIS HIS A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 GLN 4 3 3 GLN GLN A . n A 1 5 SER 5 4 4 SER SER A . n A 1 6 ASN 6 5 5 ASN ASN A . n A 1 7 ARG 7 6 6 ARG ARG A . n A 1 8 GLU 8 7 7 GLU GLU A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 VAL 10 9 9 VAL VAL A . n A 1 11 VAL 11 10 10 VAL VAL A . n A 1 12 ASP 12 11 11 ASP ASP A . n A 1 13 PHE 13 12 12 PHE PHE A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 SER 15 14 14 SER SER A . n A 1 16 TYR 16 15 15 TYR TYR A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 LEU 18 17 17 LEU LEU A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 GLN 20 19 19 GLN GLN A . n A 1 21 LYS 21 20 20 LYS LYS A . n A 1 22 GLY 22 21 21 GLY GLY A . n A 1 23 TYR 23 22 22 TYR TYR A . n A 1 24 SER 24 23 23 SER SER A . n A 1 25 TRP 25 24 24 TRP TRP A . n A 1 26 SER 26 25 25 SER SER A . n A 1 27 GLN 27 26 26 GLN GLN A . n A 1 28 PHE 28 27 27 PHE PHE A . n A 1 29 SER 29 28 ? ? ? A . n A 1 30 ASP 30 29 ? ? ? A . n A 1 31 VAL 31 30 ? ? ? A . n A 1 32 GLU 32 31 ? ? ? A . n A 1 33 GLU 33 32 ? ? ? A . n A 1 34 ASN 34 33 ? ? ? A . n A 1 35 ARG 35 34 ? ? ? A . n A 1 36 THR 36 35 ? ? ? A . n A 1 37 GLU 37 36 ? ? ? A . n A 1 38 ALA 38 37 ? ? ? A . n A 1 39 PRO 39 38 ? ? ? A . n A 1 40 GLU 40 39 ? ? ? A . n A 1 41 GLU 41 40 ? ? ? A . n A 1 42 THR 42 41 ? ? ? A . n A 1 43 GLU 43 42 ? ? ? A . n A 1 44 ALA 44 43 ? ? ? A . n A 1 45 GLU 45 44 ? ? ? A . n A 1 46 ARG 46 45 ? ? ? A . n A 1 47 GLU 47 46 ? ? ? A . n A 1 48 THR 48 47 ? ? ? A . n A 1 49 PRO 49 48 ? ? ? A . n A 1 50 SER 50 49 ? ? ? A . n A 1 51 ALA 51 50 ? ? ? A . n A 1 52 ILE 52 51 ? ? ? A . n A 1 53 ASN 53 52 ? ? ? A . n A 1 54 GLY 54 53 ? ? ? A . n A 1 55 ASN 55 54 ? ? ? A . n A 1 56 PRO 56 55 ? ? ? A . n A 1 57 SER 57 56 ? ? ? A . n A 1 58 TRP 58 57 ? ? ? A . n A 1 59 HIS 59 58 ? ? ? A . n A 1 60 LEU 60 59 ? ? ? A . n A 1 61 ALA 61 60 ? ? ? A . n A 1 62 ASP 62 61 ? ? ? A . n A 1 63 SER 63 62 ? ? ? A . n A 1 64 PRO 64 63 ? ? ? A . n A 1 65 ALA 65 64 ? ? ? A . n A 1 66 VAL 66 65 ? ? ? A . n A 1 67 ASN 67 66 ? ? ? A . n A 1 68 GLY 68 67 ? ? ? A . n A 1 69 ALA 69 68 ? ? ? A . n A 1 70 THR 70 69 ? ? ? A . n A 1 71 GLY 71 70 ? ? ? A . n A 1 72 HIS 72 71 ? ? ? A . n A 1 73 SER 73 72 ? ? ? A . n A 1 74 SER 74 73 ? ? ? A . n A 1 75 SER 75 74 ? ? ? A . n A 1 76 LEU 76 75 ? ? ? A . n A 1 77 ASP 77 76 ? ? ? A . n A 1 78 ALA 78 77 ? ? ? A . n A 1 79 ARG 79 78 ? ? ? A . n A 1 80 GLU 80 79 ? ? ? A . n A 1 81 VAL 81 80 ? ? ? A . n A 1 82 ILE 82 81 ? ? ? A . n A 1 83 PRO 83 82 82 PRO PRO A . n A 1 84 MET 84 83 83 MET MET A . n A 1 85 ALA 85 84 84 ALA ALA A . n A 1 86 ALA 86 85 85 ALA ALA A . n A 1 87 VAL 87 86 86 VAL VAL A . n A 1 88 LYS 88 87 87 LYS LYS A . n A 1 89 GLN 89 88 88 GLN GLN A . n A 1 90 ALA 90 89 89 ALA ALA A . n A 1 91 LEU 91 90 90 LEU LEU A . n A 1 92 ARG 92 91 91 ARG ARG A . n A 1 93 GLU 93 92 92 GLU GLU A . n A 1 94 ALA 94 93 93 ALA ALA A . n A 1 95 GLY 95 94 94 GLY GLY A . n A 1 96 ASP 96 95 95 ASP ASP A . n A 1 97 GLU 97 96 96 GLU GLU A . n A 1 98 PHE 98 97 97 PHE PHE A . n A 1 99 GLU 99 98 98 GLU GLU A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 ARG 101 100 100 ARG ARG A . n A 1 102 ALA 102 101 101 ALA ALA A . n A 1 103 ARG 103 102 102 ARG ARG A . n A 1 104 ARG 104 103 103 ARG ARG A . n A 1 105 ALA 105 104 104 ALA ALA A . n A 1 106 PHE 106 105 105 PHE PHE A . n A 1 107 SER 107 106 106 SER SER A . n A 1 108 ASP 108 107 107 ASP ASP A . n A 1 109 LEU 109 108 108 LEU LEU A . n A 1 110 THR 110 109 109 THR THR A . n A 1 111 SER 111 110 110 SER SER A . n A 1 112 GLN 112 111 111 GLN GLN A . n A 1 113 LEU 113 112 112 LEU LEU A . n A 1 114 HIS 114 113 113 HIS HIS A . n A 1 115 ILE 115 114 114 ILE ILE A . n A 1 116 THR 116 115 115 THR THR A . n A 1 117 PRO 117 116 116 PRO PRO A . n A 1 118 GLY 118 117 117 GLY GLY A . n A 1 119 THR 119 118 118 THR THR A . n A 1 120 ALA 120 119 119 ALA ALA A . n A 1 121 TYR 121 120 120 TYR TYR A . n A 1 122 GLN 122 121 121 GLN GLN A . n A 1 123 SER 123 122 122 SER SER A . n A 1 124 PHE 124 123 123 PHE PHE A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 GLN 126 125 125 GLN GLN A . n A 1 127 VAL 127 126 126 VAL VAL A . n A 1 128 VAL 128 127 127 VAL VAL A . n A 1 129 ASN 129 128 128 ASN ASN A . n A 1 130 GLU 130 129 129 GLU GLU A . n A 1 131 LEU 131 130 130 LEU LEU A . n A 1 132 PHE 132 131 131 PHE PHE A . n A 1 133 ARG 133 132 132 ARG ARG A . n A 1 134 ASP 134 133 133 ASP ASP A . n A 1 135 GLY 135 134 134 GLY GLY A . n A 1 136 VAL 136 135 135 VAL VAL A . n A 1 137 ASN 137 136 136 ASN ASN A . n A 1 138 TRP 138 137 137 TRP TRP A . n A 1 139 GLY 139 138 138 GLY GLY A . n A 1 140 ARG 140 139 139 ARG ARG A . n A 1 141 ILE 141 140 140 ILE ILE A . n A 1 142 VAL 142 141 141 VAL VAL A . n A 1 143 ALA 143 142 142 ALA ALA A . n A 1 144 PHE 144 143 143 PHE PHE A . n A 1 145 PHE 145 144 144 PHE PHE A . n A 1 146 SER 146 145 145 SER SER A . n A 1 147 PHE 147 146 146 PHE PHE A . n A 1 148 GLY 148 147 147 GLY GLY A . n A 1 149 GLY 149 148 148 GLY GLY A . n A 1 150 ALA 150 149 149 ALA ALA A . n A 1 151 LEU 151 150 150 LEU LEU A . n A 1 152 CYS 152 151 151 CYS CYS A . n A 1 153 VAL 153 152 152 VAL VAL A . n A 1 154 GLU 154 153 153 GLU GLU A . n A 1 155 SER 155 154 154 SER SER A . n A 1 156 VAL 156 155 155 VAL VAL A . n A 1 157 ASP 157 156 156 ASP ASP A . n A 1 158 LYS 158 157 157 LYS LYS A . n A 1 159 GLU 159 158 158 GLU GLU A . n A 1 160 MET 160 159 159 MET MET A . n A 1 161 GLN 161 160 160 GLN GLN A . n A 1 162 VAL 162 161 161 VAL VAL A . n A 1 163 LEU 163 162 162 LEU LEU A . n A 1 164 VAL 164 163 163 VAL VAL A . n A 1 165 SER 165 164 164 SER SER A . n A 1 166 ARG 166 165 165 ARG ARG A . n A 1 167 ILE 167 166 166 ILE ILE A . n A 1 168 ALA 168 167 167 ALA ALA A . n A 1 169 SER 169 168 168 SER SER A . n A 1 170 TRP 170 169 169 TRP TRP A . n A 1 171 MET 171 170 170 MET MET A . n A 1 172 ALA 172 171 171 ALA ALA A . n A 1 173 THR 173 172 172 THR THR A . n A 1 174 TYR 174 173 173 TYR TYR A . n A 1 175 LEU 175 174 174 LEU LEU A . n A 1 176 ASN 176 175 175 ASN ASN A . n A 1 177 ASP 177 176 176 ASP ASP A . n A 1 178 HIS 178 177 177 HIS HIS A . n A 1 179 LEU 179 178 178 LEU LEU A . n A 1 180 GLU 180 179 179 GLU GLU A . n A 1 181 PRO 181 180 180 PRO PRO A . n A 1 182 TRP 182 181 181 TRP TRP A . n A 1 183 ILE 183 182 182 ILE ILE A . n A 1 184 GLN 184 183 183 GLN GLN A . n A 1 185 GLU 185 184 184 GLU GLU A . n A 1 186 ASN 186 185 185 ASN ASN A . n A 1 187 GLY 187 186 186 GLY GLY A . n A 1 188 GLY 188 187 187 GLY GLY A . n A 1 189 TRP 189 188 188 TRP TRP A . n A 1 190 ASP 190 189 189 ASP ASP A . n A 1 191 THR 191 190 190 THR THR A . n A 1 192 PHE 192 191 191 PHE PHE A . n A 1 193 VAL 193 192 192 VAL VAL A . n A 1 194 ASP 194 193 193 ASP ASP A . n A 1 195 LEU 195 194 194 LEU LEU A . n A 1 196 TYR 196 195 195 TYR TYR A . n A 1 197 GLY 197 196 196 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 197 197 HOH HOH A . B 2 HOH 2 198 198 HOH HOH A . B 2 HOH 3 199 199 HOH HOH A . B 2 HOH 4 200 200 HOH HOH A . B 2 HOH 5 201 201 HOH HOH A . B 2 HOH 6 202 202 HOH HOH A . B 2 HOH 7 203 203 HOH HOH A . B 2 HOH 8 204 204 HOH HOH A . B 2 HOH 9 205 205 HOH HOH A . B 2 HOH 10 206 206 HOH HOH A . B 2 HOH 11 207 207 HOH HOH A . B 2 HOH 12 208 208 HOH HOH A . B 2 HOH 13 209 209 HOH HOH A . B 2 HOH 14 210 210 HOH HOH A . B 2 HOH 15 211 211 HOH HOH A . B 2 HOH 16 212 212 HOH HOH A . B 2 HOH 17 213 213 HOH HOH A . B 2 HOH 18 214 214 HOH HOH A . B 2 HOH 19 215 215 HOH HOH A . B 2 HOH 20 216 216 HOH HOH A . B 2 HOH 21 217 217 HOH HOH A . B 2 HOH 22 218 218 HOH HOH A . B 2 HOH 23 219 219 HOH HOH A . B 2 HOH 24 220 220 HOH HOH A . B 2 HOH 25 221 221 HOH HOH A . B 2 HOH 26 222 222 HOH HOH A . B 2 HOH 27 223 223 HOH HOH A . B 2 HOH 28 224 224 HOH HOH A . B 2 HOH 29 225 225 HOH HOH A . B 2 HOH 30 226 226 HOH HOH A . B 2 HOH 31 227 227 HOH HOH A . B 2 HOH 32 228 228 HOH HOH A . B 2 HOH 33 229 229 HOH HOH A . B 2 HOH 34 230 230 HOH HOH A . B 2 HOH 35 231 231 HOH HOH A . B 2 HOH 36 232 232 HOH HOH A . B 2 HOH 37 233 233 HOH HOH A . B 2 HOH 38 234 234 HOH HOH A . B 2 HOH 39 235 235 HOH HOH A . B 2 HOH 40 236 236 HOH HOH A . B 2 HOH 41 237 237 HOH HOH A . B 2 HOH 42 238 238 HOH HOH A . B 2 HOH 43 239 239 HOH HOH A . B 2 HOH 44 240 240 HOH HOH A . B 2 HOH 45 241 241 HOH HOH A . B 2 HOH 46 242 242 HOH HOH A . B 2 HOH 47 243 243 HOH HOH A . B 2 HOH 48 244 244 HOH HOH A . B 2 HOH 49 245 245 HOH HOH A . B 2 HOH 50 246 246 HOH HOH A . B 2 HOH 51 247 247 HOH HOH A . B 2 HOH 52 248 248 HOH HOH A . B 2 HOH 53 249 249 HOH HOH A . B 2 HOH 54 250 250 HOH HOH A . B 2 HOH 55 251 251 HOH HOH A . B 2 HOH 56 252 252 HOH HOH A . B 2 HOH 57 253 253 HOH HOH A . B 2 HOH 58 254 254 HOH HOH A . B 2 HOH 59 255 255 HOH HOH A . B 2 HOH 60 256 256 HOH HOH A . B 2 HOH 61 257 257 HOH HOH A . B 2 HOH 62 258 258 HOH HOH A . B 2 HOH 63 259 259 HOH HOH A . B 2 HOH 64 260 260 HOH HOH A . B 2 HOH 65 261 261 HOH HOH A . B 2 HOH 66 262 262 HOH HOH A . B 2 HOH 67 263 263 HOH HOH A . B 2 HOH 68 264 264 HOH HOH A . B 2 HOH 69 265 265 HOH HOH A . B 2 HOH 70 266 266 HOH HOH A . B 2 HOH 71 267 267 HOH HOH A . B 2 HOH 72 268 268 HOH HOH A . B 2 HOH 73 269 269 HOH HOH A . B 2 HOH 74 270 270 HOH HOH A . B 2 HOH 75 271 271 HOH HOH A . B 2 HOH 76 272 272 HOH HOH A . B 2 HOH 77 273 273 HOH HOH A . B 2 HOH 78 274 274 HOH HOH A . B 2 HOH 79 275 275 HOH HOH A . B 2 HOH 80 276 276 HOH HOH A . B 2 HOH 81 277 277 HOH HOH A . B 2 HOH 82 278 278 HOH HOH A . B 2 HOH 83 279 279 HOH HOH A . B 2 HOH 84 280 280 HOH HOH A . B 2 HOH 85 281 281 HOH HOH A . B 2 HOH 86 282 282 HOH HOH A . B 2 HOH 87 283 283 HOH HOH A . B 2 HOH 88 284 284 HOH HOH A . B 2 HOH 89 285 285 HOH HOH A . B 2 HOH 90 287 287 HOH HOH A . B 2 HOH 91 288 288 HOH HOH A . B 2 HOH 92 289 289 HOH HOH A . B 2 HOH 93 290 290 HOH HOH A . B 2 HOH 94 291 291 HOH HOH A . B 2 HOH 95 293 293 HOH HOH A . B 2 HOH 96 294 294 HOH HOH A . B 2 HOH 97 296 296 HOH HOH A . B 2 HOH 98 297 297 HOH HOH A . B 2 HOH 99 298 298 HOH HOH A . B 2 HOH 100 299 299 HOH HOH A . B 2 HOH 101 300 300 HOH HOH A . B 2 HOH 102 301 301 HOH HOH A . B 2 HOH 103 302 302 HOH HOH A . B 2 HOH 104 303 303 HOH HOH A . B 2 HOH 105 304 304 HOH HOH A . B 2 HOH 106 305 305 HOH HOH A . B 2 HOH 107 306 306 HOH HOH A . B 2 HOH 108 307 307 HOH HOH A . B 2 HOH 109 308 308 HOH HOH A . B 2 HOH 110 309 309 HOH HOH A . B 2 HOH 111 310 310 HOH HOH A . B 2 HOH 112 311 311 HOH HOH A . B 2 HOH 113 312 312 HOH HOH A . B 2 HOH 114 313 313 HOH HOH A . B 2 HOH 115 314 314 HOH HOH A . B 2 HOH 116 315 315 HOH HOH A . B 2 HOH 117 316 316 HOH HOH A . B 2 HOH 118 317 317 HOH HOH A . B 2 HOH 119 318 318 HOH HOH A . B 2 HOH 120 319 319 HOH HOH A . B 2 HOH 121 320 320 HOH HOH A . B 2 HOH 122 321 321 HOH HOH A . B 2 HOH 123 322 322 HOH HOH A . B 2 HOH 124 323 323 HOH HOH A . B 2 HOH 125 324 324 HOH HOH A . B 2 HOH 126 325 325 HOH HOH A . B 2 HOH 127 326 326 HOH HOH A . B 2 HOH 128 327 327 HOH HOH A . B 2 HOH 129 328 328 HOH HOH A . B 2 HOH 130 329 329 HOH HOH A . B 2 HOH 131 330 330 HOH HOH A . B 2 HOH 132 331 331 HOH HOH A . B 2 HOH 133 332 332 HOH HOH A . B 2 HOH 134 333 333 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-04-14 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2013-11-20 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 MOLREP phasing . ? 2 REFMAC refinement 5.5.0072 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 176 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 176 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 OD2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 176 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 111.75 _pdbx_validate_rmsd_angle.angle_target_value 118.30 _pdbx_validate_rmsd_angle.angle_deviation -6.55 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 113 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 30.88 _pdbx_validate_torsion.psi 62.37 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 28 ? A SER 29 2 1 Y 1 A ASP 29 ? A ASP 30 3 1 Y 1 A VAL 30 ? A VAL 31 4 1 Y 1 A GLU 31 ? A GLU 32 5 1 Y 1 A GLU 32 ? A GLU 33 6 1 Y 1 A ASN 33 ? A ASN 34 7 1 Y 1 A ARG 34 ? A ARG 35 8 1 Y 1 A THR 35 ? A THR 36 9 1 Y 1 A GLU 36 ? A GLU 37 10 1 Y 1 A ALA 37 ? A ALA 38 11 1 Y 1 A PRO 38 ? A PRO 39 12 1 Y 1 A GLU 39 ? A GLU 40 13 1 Y 1 A GLU 40 ? A GLU 41 14 1 Y 1 A THR 41 ? A THR 42 15 1 Y 1 A GLU 42 ? A GLU 43 16 1 Y 1 A ALA 43 ? A ALA 44 17 1 Y 1 A GLU 44 ? A GLU 45 18 1 Y 1 A ARG 45 ? A ARG 46 19 1 Y 1 A GLU 46 ? A GLU 47 20 1 Y 1 A THR 47 ? A THR 48 21 1 Y 1 A PRO 48 ? A PRO 49 22 1 Y 1 A SER 49 ? A SER 50 23 1 Y 1 A ALA 50 ? A ALA 51 24 1 Y 1 A ILE 51 ? A ILE 52 25 1 Y 1 A ASN 52 ? A ASN 53 26 1 Y 1 A GLY 53 ? A GLY 54 27 1 Y 1 A ASN 54 ? A ASN 55 28 1 Y 1 A PRO 55 ? A PRO 56 29 1 Y 1 A SER 56 ? A SER 57 30 1 Y 1 A TRP 57 ? A TRP 58 31 1 Y 1 A HIS 58 ? A HIS 59 32 1 Y 1 A LEU 59 ? A LEU 60 33 1 Y 1 A ALA 60 ? A ALA 61 34 1 Y 1 A ASP 61 ? A ASP 62 35 1 Y 1 A SER 62 ? A SER 63 36 1 Y 1 A PRO 63 ? A PRO 64 37 1 Y 1 A ALA 64 ? A ALA 65 38 1 Y 1 A VAL 65 ? A VAL 66 39 1 Y 1 A ASN 66 ? A ASN 67 40 1 Y 1 A GLY 67 ? A GLY 68 41 1 Y 1 A ALA 68 ? A ALA 69 42 1 Y 1 A THR 69 ? A THR 70 43 1 Y 1 A GLY 70 ? A GLY 71 44 1 Y 1 A HIS 71 ? A HIS 72 45 1 Y 1 A SER 72 ? A SER 73 46 1 Y 1 A SER 73 ? A SER 74 47 1 Y 1 A SER 74 ? A SER 75 48 1 Y 1 A LEU 75 ? A LEU 76 49 1 Y 1 A ASP 76 ? A ASP 77 50 1 Y 1 A ALA 77 ? A ALA 78 51 1 Y 1 A ARG 78 ? A ARG 79 52 1 Y 1 A GLU 79 ? A GLU 80 53 1 Y 1 A VAL 80 ? A VAL 81 54 1 Y 1 A ILE 81 ? A ILE 82 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #