data_3KCO # _entry.id 3KCO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3KCO pdb_00003kco 10.2210/pdb3kco/pdb RCSB RCSB055825 ? ? WWPDB D_1000055825 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-06-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2011-07-27 4 'Structure model' 1 3 2018-04-25 5 'Structure model' 1 4 2018-06-20 6 'Structure model' 1 5 2020-07-29 7 'Structure model' 1 6 2024-02-21 8 'Structure model' 1 7 2024-04-03 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 6 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 4 'Structure model' 'Data collection' 4 5 'Structure model' 'Data collection' 5 6 'Structure model' 'Derived calculations' 6 6 'Structure model' 'Structure summary' 7 7 'Structure model' 'Data collection' 8 7 'Structure model' 'Database references' 9 7 'Structure model' 'Structure summary' 10 8 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_source 2 5 'Structure model' diffrn_radiation 3 6 'Structure model' chem_comp 4 6 'Structure model' entity 5 6 'Structure model' pdbx_entity_nonpoly 6 6 'Structure model' pdbx_struct_conn_angle 7 6 'Structure model' struct_conn 8 6 'Structure model' struct_site 9 6 'Structure model' struct_site_gen 10 7 'Structure model' chem_comp 11 7 'Structure model' chem_comp_atom 12 7 'Structure model' chem_comp_bond 13 7 'Structure model' database_2 14 8 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 4 'Structure model' '_diffrn_source.source' 3 4 'Structure model' '_diffrn_source.type' 4 5 'Structure model' '_diffrn_radiation.pdbx_diffrn_protocol' 5 5 'Structure model' '_diffrn_radiation.pdbx_monochromatic_or_laue_m_l' 6 6 'Structure model' '_chem_comp.name' 7 6 'Structure model' '_entity.pdbx_description' 8 6 'Structure model' '_pdbx_entity_nonpoly.name' 9 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 10 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 11 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 12 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 13 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 14 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 6 'Structure model' '_pdbx_struct_conn_angle.value' 20 6 'Structure model' '_struct_conn.pdbx_dist_value' 21 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 6 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 6 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 6 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 28 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 29 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' 30 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 31 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' 32 7 'Structure model' '_chem_comp.pdbx_synonyms' 33 7 'Structure model' '_database_2.pdbx_DOI' 34 7 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3KCO _pdbx_database_status.recvd_initial_deposition_date 2009-10-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3KBJ 'Room temperature X-ray structure of apo-D-Xylose Isomerase' unspecified PDB 3KBM 'Room Temperature X-ray structure of D-Xylose Isomerase complexed with 2Cd(2+) co-factors and d12-D-alpha-glucose in the cyclic form' unspecified PDB 3KBN 'Room temperature structure of D-Xylose Isomerase in complex with 2Ni(2+) co-factors and d12-D-glucose in the linear form' unspecified PDB 3KBS 'Room Temperature X-ray structure of D-Xylose Isomerase in complex with 2Cd(2+) co-factors' unspecified PDB 3KBV 'Room temperature structure of D-Xylose Isomerase in complex with 2Ni(2+) co-factors' unspecified PDB 3KBW 'Room temperature X-ray mixed-metal structure of D-Xylose Isomerase in complex with Ni(2+) and Mg(2+) co-factors' unspecified PDB 3KCJ 'Room temperature neutron structure of apo-D-Xylose Isomerase (refined jointly with X-ray structure 3KBJ)' unspecified PDB 3KCL ;Room temperature neutron structure of D-Xylose Isomerase in complex with two Cd2+ cations and d12-D-alpha-glucose in the ring form (refined jointly with X-ray structure 3KBM) ; unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kovalevsky, A.Y.' 1 'Langan, P.' 2 # _citation.id primary _citation.title ;Metal ion roles and the movement of hydrogen during reaction catalyzed by D-xylose isomerase: a joint x-ray and neutron diffraction study. ; _citation.journal_abbrev Structure _citation.journal_volume 18 _citation.page_first 688 _citation.page_last 699 _citation.year 2010 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20541506 _citation.pdbx_database_id_DOI 10.1016/j.str.2010.03.011 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kovalevsky, A.Y.' 1 ? primary 'Hanson, L.' 2 ? primary 'Fisher, S.Z.' 3 ? primary 'Mustyakimov, M.' 4 ? primary 'Mason, S.A.' 5 ? primary 'Forsyth, V.T.' 6 ? primary 'Blakeley, M.P.' 7 ? primary 'Keen, D.A.' 8 ? primary 'Wagner, T.' 9 ? primary 'Carrell, H.L.' 10 ? primary 'Katz, A.K.' 11 ? primary 'Glusker, J.P.' 12 ? primary 'Langan, P.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Xylose isomerase' 43283.297 1 5.3.1.5 ? ? 'THE PROTEIN WAS PURCHASED FROM HAMPTON RESEARCH' 2 non-polymer syn 'NICKEL (II) ION' 58.693 3 ? ? ? ? 3 non-polymer man D-glucose 180.156 1 ? ? ? ? 4 water nat water 18.015 309 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALD DTGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKE AFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK LFHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKERAAAF RADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEFDVDAAAARGMAFERLDQLAMDHLLGARG ; _entity_poly.pdbx_seq_one_letter_code_can ;MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALD DTGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKE AFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK LFHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKERAAAF RADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEFDVDAAAARGMAFERLDQLAMDHLLGARG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NICKEL (II) ION' NI 3 D-glucose GLO 4 water DOD # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 TYR n 1 4 GLN n 1 5 PRO n 1 6 THR n 1 7 PRO n 1 8 GLU n 1 9 ASP n 1 10 ARG n 1 11 PHE n 1 12 THR n 1 13 PHE n 1 14 GLY n 1 15 LEU n 1 16 TRP n 1 17 THR n 1 18 VAL n 1 19 GLY n 1 20 TRP n 1 21 GLN n 1 22 GLY n 1 23 ARG n 1 24 ASP n 1 25 PRO n 1 26 PHE n 1 27 GLY n 1 28 ASP n 1 29 ALA n 1 30 THR n 1 31 ARG n 1 32 ARG n 1 33 ALA n 1 34 LEU n 1 35 ASP n 1 36 PRO n 1 37 VAL n 1 38 GLU n 1 39 SER n 1 40 VAL n 1 41 ARG n 1 42 ARG n 1 43 LEU n 1 44 ALA n 1 45 GLU n 1 46 LEU n 1 47 GLY n 1 48 ALA n 1 49 HIS n 1 50 GLY n 1 51 VAL n 1 52 THR n 1 53 PHE n 1 54 HIS n 1 55 ASP n 1 56 ASP n 1 57 ASP n 1 58 LEU n 1 59 ILE n 1 60 PRO n 1 61 PHE n 1 62 GLY n 1 63 SER n 1 64 SER n 1 65 ASP n 1 66 SER n 1 67 GLU n 1 68 ARG n 1 69 GLU n 1 70 GLU n 1 71 HIS n 1 72 VAL n 1 73 LYS n 1 74 ARG n 1 75 PHE n 1 76 ARG n 1 77 GLN n 1 78 ALA n 1 79 LEU n 1 80 ASP n 1 81 ASP n 1 82 THR n 1 83 GLY n 1 84 MET n 1 85 LYS n 1 86 VAL n 1 87 PRO n 1 88 MET n 1 89 ALA n 1 90 THR n 1 91 THR n 1 92 ASN n 1 93 LEU n 1 94 PHE n 1 95 THR n 1 96 HIS n 1 97 PRO n 1 98 VAL n 1 99 PHE n 1 100 LYS n 1 101 ASP n 1 102 GLY n 1 103 GLY n 1 104 PHE n 1 105 THR n 1 106 ALA n 1 107 ASN n 1 108 ASP n 1 109 ARG n 1 110 ASP n 1 111 VAL n 1 112 ARG n 1 113 ARG n 1 114 TYR n 1 115 ALA n 1 116 LEU n 1 117 ARG n 1 118 LYS n 1 119 THR n 1 120 ILE n 1 121 ARG n 1 122 ASN n 1 123 ILE n 1 124 ASP n 1 125 LEU n 1 126 ALA n 1 127 VAL n 1 128 GLU n 1 129 LEU n 1 130 GLY n 1 131 ALA n 1 132 GLU n 1 133 THR n 1 134 TYR n 1 135 VAL n 1 136 ALA n 1 137 TRP n 1 138 GLY n 1 139 GLY n 1 140 ARG n 1 141 GLU n 1 142 GLY n 1 143 ALA n 1 144 GLU n 1 145 SER n 1 146 GLY n 1 147 GLY n 1 148 ALA n 1 149 LYS n 1 150 ASP n 1 151 VAL n 1 152 ARG n 1 153 ASP n 1 154 ALA n 1 155 LEU n 1 156 ASP n 1 157 ARG n 1 158 MET n 1 159 LYS n 1 160 GLU n 1 161 ALA n 1 162 PHE n 1 163 ASP n 1 164 LEU n 1 165 LEU n 1 166 GLY n 1 167 GLU n 1 168 TYR n 1 169 VAL n 1 170 THR n 1 171 SER n 1 172 GLN n 1 173 GLY n 1 174 TYR n 1 175 ASP n 1 176 ILE n 1 177 ARG n 1 178 PHE n 1 179 ALA n 1 180 ILE n 1 181 GLU n 1 182 PRO n 1 183 LYS n 1 184 PRO n 1 185 ASN n 1 186 GLU n 1 187 PRO n 1 188 ARG n 1 189 GLY n 1 190 ASP n 1 191 ILE n 1 192 LEU n 1 193 LEU n 1 194 PRO n 1 195 THR n 1 196 VAL n 1 197 GLY n 1 198 HIS n 1 199 ALA n 1 200 LEU n 1 201 ALA n 1 202 PHE n 1 203 ILE n 1 204 GLU n 1 205 ARG n 1 206 LEU n 1 207 GLU n 1 208 ARG n 1 209 PRO n 1 210 GLU n 1 211 LEU n 1 212 TYR n 1 213 GLY n 1 214 VAL n 1 215 ASN n 1 216 PRO n 1 217 GLU n 1 218 VAL n 1 219 GLY n 1 220 HIS n 1 221 GLU n 1 222 GLN n 1 223 MET n 1 224 ALA n 1 225 GLY n 1 226 LEU n 1 227 ASN n 1 228 PHE n 1 229 PRO n 1 230 HIS n 1 231 GLY n 1 232 ILE n 1 233 ALA n 1 234 GLN n 1 235 ALA n 1 236 LEU n 1 237 TRP n 1 238 ALA n 1 239 GLY n 1 240 LYS n 1 241 LEU n 1 242 PHE n 1 243 HIS n 1 244 ILE n 1 245 ASP n 1 246 LEU n 1 247 ASN n 1 248 GLY n 1 249 GLN n 1 250 ASN n 1 251 GLY n 1 252 ILE n 1 253 LYS n 1 254 TYR n 1 255 ASP n 1 256 GLN n 1 257 ASP n 1 258 LEU n 1 259 ARG n 1 260 PHE n 1 261 GLY n 1 262 ALA n 1 263 GLY n 1 264 ASP n 1 265 LEU n 1 266 ARG n 1 267 ALA n 1 268 ALA n 1 269 PHE n 1 270 TRP n 1 271 LEU n 1 272 VAL n 1 273 ASP n 1 274 LEU n 1 275 LEU n 1 276 GLU n 1 277 SER n 1 278 ALA n 1 279 GLY n 1 280 TYR n 1 281 SER n 1 282 GLY n 1 283 PRO n 1 284 ARG n 1 285 HIS n 1 286 PHE n 1 287 ASP n 1 288 PHE n 1 289 LYS n 1 290 PRO n 1 291 PRO n 1 292 ARG n 1 293 THR n 1 294 GLU n 1 295 ASP n 1 296 PHE n 1 297 ASP n 1 298 GLY n 1 299 VAL n 1 300 TRP n 1 301 ALA n 1 302 SER n 1 303 ALA n 1 304 ALA n 1 305 GLY n 1 306 CYS n 1 307 MET n 1 308 ARG n 1 309 ASN n 1 310 TYR n 1 311 LEU n 1 312 ILE n 1 313 LEU n 1 314 LYS n 1 315 GLU n 1 316 ARG n 1 317 ALA n 1 318 ALA n 1 319 ALA n 1 320 PHE n 1 321 ARG n 1 322 ALA n 1 323 ASP n 1 324 PRO n 1 325 GLU n 1 326 VAL n 1 327 GLN n 1 328 GLU n 1 329 ALA n 1 330 LEU n 1 331 ARG n 1 332 ALA n 1 333 SER n 1 334 ARG n 1 335 LEU n 1 336 ASP n 1 337 GLU n 1 338 LEU n 1 339 ALA n 1 340 ARG n 1 341 PRO n 1 342 THR n 1 343 ALA n 1 344 ALA n 1 345 ASP n 1 346 GLY n 1 347 LEU n 1 348 GLN n 1 349 ALA n 1 350 LEU n 1 351 LEU n 1 352 ASP n 1 353 ASP n 1 354 ARG n 1 355 SER n 1 356 ALA n 1 357 PHE n 1 358 GLU n 1 359 GLU n 1 360 PHE n 1 361 ASP n 1 362 VAL n 1 363 ASP n 1 364 ALA n 1 365 ALA n 1 366 ALA n 1 367 ALA n 1 368 ARG n 1 369 GLY n 1 370 MET n 1 371 ALA n 1 372 PHE n 1 373 GLU n 1 374 ARG n 1 375 LEU n 1 376 ASP n 1 377 GLN n 1 378 LEU n 1 379 ALA n 1 380 MET n 1 381 ASP n 1 382 HIS n 1 383 LEU n 1 384 LEU n 1 385 GLY n 1 386 ALA n 1 387 ARG n 1 388 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene xylA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces rubiginosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1929 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLO D-saccharide . D-glucose 'D-GLUCOSE IN LINEAR FORM' 'C6 H12 O6' 180.156 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 TRP 137 137 137 TRP TRP A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 MET 158 158 158 MET MET A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 TYR 174 174 174 TYR TYR A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 PHE 178 178 178 PHE PHE A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 HIS 198 198 198 HIS HIS A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 PHE 202 202 202 PHE PHE A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 ARG 205 205 205 ARG ARG A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 ARG 208 208 208 ARG ARG A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 ASN 215 215 215 ASN ASN A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 HIS 220 220 220 HIS HIS A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 GLN 222 222 222 GLN GLN A . n A 1 223 MET 223 223 223 MET MET A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 ASN 227 227 227 ASN ASN A . n A 1 228 PHE 228 228 228 PHE PHE A . n A 1 229 PRO 229 229 229 PRO PRO A . n A 1 230 HIS 230 230 230 HIS HIS A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 GLN 234 234 234 GLN GLN A . n A 1 235 ALA 235 235 235 ALA ALA A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 TRP 237 237 237 TRP TRP A . n A 1 238 ALA 238 238 238 ALA ALA A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 PHE 242 242 242 PHE PHE A . n A 1 243 HIS 243 243 243 HIS HIS A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 ASN 247 247 247 ASN ASN A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 GLN 249 249 249 GLN GLN A . n A 1 250 ASN 250 250 250 ASN ASN A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 TYR 254 254 254 TYR TYR A . n A 1 255 ASP 255 255 255 ASP ASP A . n A 1 256 GLN 256 256 256 GLN GLN A . n A 1 257 ASP 257 257 257 ASP ASP A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 PHE 260 260 260 PHE PHE A . n A 1 261 GLY 261 261 261 GLY GLY A . n A 1 262 ALA 262 262 262 ALA ALA A . n A 1 263 GLY 263 263 263 GLY GLY A . n A 1 264 ASP 264 264 264 ASP ASP A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 ARG 266 266 266 ARG ARG A . n A 1 267 ALA 267 267 267 ALA ALA A . n A 1 268 ALA 268 268 268 ALA ALA A . n A 1 269 PHE 269 269 269 PHE PHE A . n A 1 270 TRP 270 270 270 TRP TRP A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 VAL 272 272 272 VAL VAL A . n A 1 273 ASP 273 273 273 ASP ASP A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 SER 277 277 277 SER SER A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 GLY 279 279 279 GLY GLY A . n A 1 280 TYR 280 280 280 TYR TYR A . n A 1 281 SER 281 281 281 SER SER A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 PRO 283 283 283 PRO PRO A . n A 1 284 ARG 284 284 284 ARG ARG A . n A 1 285 HIS 285 285 285 HIS HIS A . n A 1 286 PHE 286 286 286 PHE PHE A . n A 1 287 ASP 287 287 287 ASP ASP A . n A 1 288 PHE 288 288 288 PHE PHE A . n A 1 289 LYS 289 289 289 LYS LYS A . n A 1 290 PRO 290 290 290 PRO PRO A . n A 1 291 PRO 291 291 291 PRO PRO A . n A 1 292 ARG 292 292 292 ARG ARG A . n A 1 293 THR 293 293 293 THR THR A . n A 1 294 GLU 294 294 294 GLU GLU A . n A 1 295 ASP 295 295 295 ASP ASP A . n A 1 296 PHE 296 296 296 PHE PHE A . n A 1 297 ASP 297 297 297 ASP ASP A . n A 1 298 GLY 298 298 298 GLY GLY A . n A 1 299 VAL 299 299 299 VAL VAL A . n A 1 300 TRP 300 300 300 TRP TRP A . n A 1 301 ALA 301 301 301 ALA ALA A . n A 1 302 SER 302 302 302 SER SER A . n A 1 303 ALA 303 303 303 ALA ALA A . n A 1 304 ALA 304 304 304 ALA ALA A . n A 1 305 GLY 305 305 305 GLY GLY A . n A 1 306 CYS 306 306 306 CYS CYS A . n A 1 307 MET 307 307 307 MET MET A . n A 1 308 ARG 308 308 308 ARG ARG A . n A 1 309 ASN 309 309 309 ASN ASN A . n A 1 310 TYR 310 310 310 TYR TYR A . n A 1 311 LEU 311 311 311 LEU LEU A . n A 1 312 ILE 312 312 312 ILE ILE A . n A 1 313 LEU 313 313 313 LEU LEU A . n A 1 314 LYS 314 314 314 LYS LYS A . n A 1 315 GLU 315 315 315 GLU GLU A . n A 1 316 ARG 316 316 316 ARG ARG A . n A 1 317 ALA 317 317 317 ALA ALA A . n A 1 318 ALA 318 318 318 ALA ALA A . n A 1 319 ALA 319 319 319 ALA ALA A . n A 1 320 PHE 320 320 320 PHE PHE A . n A 1 321 ARG 321 321 321 ARG ARG A . n A 1 322 ALA 322 322 322 ALA ALA A . n A 1 323 ASP 323 323 323 ASP ASP A . n A 1 324 PRO 324 324 324 PRO PRO A . n A 1 325 GLU 325 325 325 GLU GLU A . n A 1 326 VAL 326 326 326 VAL VAL A . n A 1 327 GLN 327 327 327 GLN GLN A . n A 1 328 GLU 328 328 328 GLU GLU A . n A 1 329 ALA 329 329 329 ALA ALA A . n A 1 330 LEU 330 330 330 LEU LEU A . n A 1 331 ARG 331 331 331 ARG ARG A . n A 1 332 ALA 332 332 332 ALA ALA A . n A 1 333 SER 333 333 333 SER SER A . n A 1 334 ARG 334 334 334 ARG ARG A . n A 1 335 LEU 335 335 335 LEU LEU A . n A 1 336 ASP 336 336 336 ASP ASP A . n A 1 337 GLU 337 337 337 GLU GLU A . n A 1 338 LEU 338 338 338 LEU LEU A . n A 1 339 ALA 339 339 339 ALA ALA A . n A 1 340 ARG 340 340 340 ARG ARG A . n A 1 341 PRO 341 341 341 PRO PRO A . n A 1 342 THR 342 342 342 THR THR A . n A 1 343 ALA 343 343 343 ALA ALA A . n A 1 344 ALA 344 344 344 ALA ALA A . n A 1 345 ASP 345 345 345 ASP ASP A . n A 1 346 GLY 346 346 346 GLY GLY A . n A 1 347 LEU 347 347 347 LEU LEU A . n A 1 348 GLN 348 348 348 GLN GLN A . n A 1 349 ALA 349 349 349 ALA ALA A . n A 1 350 LEU 350 350 350 LEU LEU A . n A 1 351 LEU 351 351 351 LEU LEU A . n A 1 352 ASP 352 352 352 ASP ASP A . n A 1 353 ASP 353 353 353 ASP ASP A . n A 1 354 ARG 354 354 354 ARG ARG A . n A 1 355 SER 355 355 355 SER SER A . n A 1 356 ALA 356 356 356 ALA ALA A . n A 1 357 PHE 357 357 357 PHE PHE A . n A 1 358 GLU 358 358 358 GLU GLU A . n A 1 359 GLU 359 359 359 GLU GLU A . n A 1 360 PHE 360 360 360 PHE PHE A . n A 1 361 ASP 361 361 361 ASP ASP A . n A 1 362 VAL 362 362 362 VAL VAL A . n A 1 363 ASP 363 363 363 ASP ASP A . n A 1 364 ALA 364 364 364 ALA ALA A . n A 1 365 ALA 365 365 365 ALA ALA A . n A 1 366 ALA 366 366 366 ALA ALA A . n A 1 367 ALA 367 367 367 ALA ALA A . n A 1 368 ARG 368 368 368 ARG ARG A . n A 1 369 GLY 369 369 369 GLY GLY A . n A 1 370 MET 370 370 370 MET MET A . n A 1 371 ALA 371 371 371 ALA ALA A . n A 1 372 PHE 372 372 372 PHE PHE A . n A 1 373 GLU 373 373 373 GLU GLU A . n A 1 374 ARG 374 374 374 ARG ARG A . n A 1 375 LEU 375 375 375 LEU LEU A . n A 1 376 ASP 376 376 376 ASP ASP A . n A 1 377 GLN 377 377 377 GLN GLN A . n A 1 378 LEU 378 378 378 LEU LEU A . n A 1 379 ALA 379 379 379 ALA ALA A . n A 1 380 MET 380 380 380 MET MET A . n A 1 381 ASP 381 381 381 ASP ASP A . n A 1 382 HIS 382 382 382 HIS HIS A . n A 1 383 LEU 383 383 383 LEU LEU A . n A 1 384 LEU 384 384 384 LEU LEU A . n A 1 385 GLY 385 385 385 GLY GLY A . n A 1 386 ALA 386 386 386 ALA ALA A . n A 1 387 ARG 387 387 387 ARG ARG A . n A 1 388 GLY 388 388 388 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NI 1 391 391 NI NI A . C 2 NI 1 392 392 NI NI A . D 2 NI 1 393 393 NI NI A . E 3 GLO 1 401 401 GLO GLO A . F 4 DOD 1 1001 1001 DOD DOD A . F 4 DOD 2 1002 1002 DOD DOD A . F 4 DOD 3 1003 1003 DOD DOD A . F 4 DOD 4 1004 1004 DOD DOD A . F 4 DOD 5 1005 1005 DOD DOD A . F 4 DOD 6 1006 1006 DOD DOD A . F 4 DOD 7 1007 1007 DOD DOD A . F 4 DOD 8 1008 1008 DOD DOD A . F 4 DOD 9 1009 1009 DOD DOD A . F 4 DOD 10 1010 1010 DOD DOD A . F 4 DOD 11 1011 1011 DOD DOD A . F 4 DOD 12 1012 1012 DOD DOD A . F 4 DOD 13 1013 1013 DOD DOD A . F 4 DOD 14 1014 1014 DOD DOD A . F 4 DOD 15 1015 1015 DOD DOD A . F 4 DOD 16 1016 1016 DOD DOD A . F 4 DOD 17 1017 1017 DOD DOD A . F 4 DOD 18 1018 1018 DOD DOD A . F 4 DOD 19 1019 1019 DOD DOD A . F 4 DOD 20 1020 1020 DOD DOD A . F 4 DOD 21 1021 1021 DOD DOD A . F 4 DOD 22 1022 1022 DOD DOD A . F 4 DOD 23 1023 1023 DOD DOD A . F 4 DOD 24 1024 1024 DOD DOD A . F 4 DOD 25 1025 1025 DOD DOD A . F 4 DOD 26 1026 1026 DOD DOD A . F 4 DOD 27 1027 1027 DOD DOD A . F 4 DOD 28 1028 1028 DOD DOD A . F 4 DOD 29 1029 1029 DOD DOD A . F 4 DOD 30 1030 1030 DOD DOD A . F 4 DOD 31 1031 1031 DOD DOD A . F 4 DOD 32 1032 1032 DOD DOD A . F 4 DOD 33 1033 1033 DOD DOD A . F 4 DOD 34 1034 1034 DOD DOD A . F 4 DOD 35 1035 1035 DOD DOD A . F 4 DOD 36 1036 1036 DOD DOD A . F 4 DOD 37 1037 1037 DOD DOD A . F 4 DOD 38 1038 1038 DOD DOD A . F 4 DOD 39 1039 1039 DOD DOD A . F 4 DOD 40 1040 1040 DOD DOD A . F 4 DOD 41 1041 1041 DOD DOD A . F 4 DOD 42 1042 1042 DOD DOD A . F 4 DOD 43 1043 1043 DOD DOD A . F 4 DOD 44 1044 1044 DOD DOD A . F 4 DOD 45 1045 1045 DOD DOD A . F 4 DOD 46 1046 1046 DOD DOD A . F 4 DOD 47 1047 1047 DOD DOD A . F 4 DOD 48 1048 1048 DOD DOD A . F 4 DOD 49 1049 1049 DOD DOD A . F 4 DOD 50 1050 1050 DOD DOD A . F 4 DOD 51 1051 1051 DOD DOD A . F 4 DOD 52 1052 1052 DOD DOD A . F 4 DOD 53 1053 1053 DOD DOD A . F 4 DOD 54 1054 1054 DOD DOD A . F 4 DOD 55 1055 1055 DOD DOD A . F 4 DOD 56 1056 1056 DOD DOD A . F 4 DOD 57 1057 1057 DOD DOD A . F 4 DOD 58 1058 1058 DOD DOD A . F 4 DOD 59 1059 1059 DOD DOD A . F 4 DOD 60 1060 1060 DOD DOD A . F 4 DOD 61 1061 1061 DOD DOD A . F 4 DOD 62 1062 1062 DOD DOD A . F 4 DOD 63 1063 1063 DOD DOD A . F 4 DOD 64 1064 1064 DOD DOD A . F 4 DOD 65 1065 1065 DOD DOD A . F 4 DOD 66 1066 1066 DOD DOD A . F 4 DOD 67 1067 1067 DOD DOD A . F 4 DOD 68 1068 1068 DOD DOD A . F 4 DOD 69 1069 1069 DOD DOD A . F 4 DOD 70 1070 1070 DOD DOD A . F 4 DOD 71 1071 1071 DOD DOD A . F 4 DOD 72 1072 1072 DOD DOD A . F 4 DOD 73 1073 1073 DOD DOD A . F 4 DOD 74 1074 1074 DOD DOD A . F 4 DOD 75 1075 1075 DOD DOD A . F 4 DOD 76 1076 1076 DOD DOD A . F 4 DOD 77 1077 1077 DOD DOD A . F 4 DOD 78 1078 1078 DOD DOD A . F 4 DOD 79 1079 1079 DOD DOD A . F 4 DOD 80 1080 1080 DOD DOD A . F 4 DOD 81 1081 1081 DOD DOD A . F 4 DOD 82 1082 1082 DOD DOD A . F 4 DOD 83 1083 1083 DOD DOD A . F 4 DOD 84 1084 1084 DOD DOD A . F 4 DOD 85 1085 1085 DOD DOD A . F 4 DOD 86 1086 1086 DOD DOD A . F 4 DOD 87 1087 1087 DOD DOD A . F 4 DOD 88 1088 1088 DOD DOD A . F 4 DOD 89 1089 1089 DOD DOD A . F 4 DOD 90 1090 1090 DOD DOD A . F 4 DOD 91 1091 1091 DOD DOD A . F 4 DOD 92 1092 1092 DOD DOD A . F 4 DOD 93 1093 1093 DOD DOD A . F 4 DOD 94 1094 1094 DOD DOD A . F 4 DOD 95 1095 1095 DOD DOD A . F 4 DOD 96 1096 1096 DOD DOD A . F 4 DOD 97 1097 1097 DOD DOD A . F 4 DOD 98 1098 1098 DOD DOD A . F 4 DOD 99 1099 1099 DOD DOD A . F 4 DOD 100 1100 1100 DOD DOD A . F 4 DOD 101 1101 1101 DOD DOD A . F 4 DOD 102 1102 1102 DOD DOD A . F 4 DOD 103 1103 1103 DOD DOD A . F 4 DOD 104 1104 1104 DOD DOD A . F 4 DOD 105 1105 1105 DOD DOD A . F 4 DOD 106 1106 1106 DOD DOD A . F 4 DOD 107 1107 1107 DOD DOD A . F 4 DOD 108 1108 1108 DOD DOD A . F 4 DOD 109 1109 1109 DOD DOD A . F 4 DOD 110 1110 1110 DOD DOD A . F 4 DOD 111 1111 1111 DOD DOD A . F 4 DOD 112 1112 1112 DOD DOD A . F 4 DOD 113 1113 1113 DOD DOD A . F 4 DOD 114 1114 1114 DOD DOD A . F 4 DOD 115 1115 1115 DOD DOD A . F 4 DOD 116 1116 1116 DOD DOD A . F 4 DOD 117 1117 1117 DOD DOD A . F 4 DOD 118 1118 1118 DOD DOD A . F 4 DOD 119 1119 1119 DOD DOD A . F 4 DOD 120 1120 1120 DOD DOD A . F 4 DOD 121 1121 1121 DOD DOD A . F 4 DOD 122 1122 1122 DOD DOD A . F 4 DOD 123 1123 1123 DOD DOD A . F 4 DOD 124 1124 1124 DOD DOD A . F 4 DOD 125 1125 1125 DOD DOD A . F 4 DOD 126 1126 1126 DOD DOD A . F 4 DOD 127 1127 1127 DOD DOD A . F 4 DOD 128 1128 1128 DOD DOD A . F 4 DOD 129 1129 1129 DOD DOD A . F 4 DOD 130 1130 1130 DOD DOD A . F 4 DOD 131 1131 1131 DOD DOD A . F 4 DOD 132 1132 1132 DOD DOD A . F 4 DOD 133 1133 1133 DOD DOD A . F 4 DOD 134 1134 1134 DOD DOD A . F 4 DOD 135 1135 1135 DOD DOD A . F 4 DOD 136 1136 1136 DOD DOD A . F 4 DOD 137 1137 1137 DOD DOD A . F 4 DOD 138 1138 1138 DOD DOD A . F 4 DOD 139 1139 1139 DOD DOD A . F 4 DOD 140 1140 1140 DOD DOD A . F 4 DOD 141 1141 1141 DOD DOD A . F 4 DOD 142 1142 1142 DOD DOD A . F 4 DOD 143 1143 1143 DOD DOD A . F 4 DOD 144 1144 1144 DOD DOD A . F 4 DOD 145 1146 1146 DOD DOD A . F 4 DOD 146 1147 1147 DOD DOD A . F 4 DOD 147 1148 1148 DOD DOD A . F 4 DOD 148 1149 1149 DOD DOD A . F 4 DOD 149 1150 1150 DOD DOD A . F 4 DOD 150 1151 1151 DOD DOD A . F 4 DOD 151 1152 1152 DOD DOD A . F 4 DOD 152 1153 1153 DOD DOD A . F 4 DOD 153 1154 1154 DOD DOD A . F 4 DOD 154 1155 1155 DOD DOD A . F 4 DOD 155 1156 1156 DOD DOD A . F 4 DOD 156 1157 1157 DOD DOD A . F 4 DOD 157 1158 1158 DOD DOD A . F 4 DOD 158 1159 1159 DOD DOD A . F 4 DOD 159 1160 1160 DOD DOD A . F 4 DOD 160 1161 1161 DOD DOD A . F 4 DOD 161 1162 1162 DOD DOD A . F 4 DOD 162 1163 1163 DOD DOD A . F 4 DOD 163 1164 1164 DOD DOD A . F 4 DOD 164 1165 1165 DOD DOD A . F 4 DOD 165 1166 1166 DOD DOD A . F 4 DOD 166 1167 1167 DOD DOD A . F 4 DOD 167 1168 1168 DOD DOD A . F 4 DOD 168 1169 1169 DOD DOD A . F 4 DOD 169 1170 1170 DOD DOD A . F 4 DOD 170 1171 1171 DOD DOD A . F 4 DOD 171 1172 1172 DOD DOD A . F 4 DOD 172 1173 1173 DOD DOD A . F 4 DOD 173 1174 1174 DOD DOD A . F 4 DOD 174 1175 1175 DOD DOD A . F 4 DOD 175 1176 1176 DOD DOD A . F 4 DOD 176 1177 1177 DOD DOD A . F 4 DOD 177 1178 1178 DOD DOD A . F 4 DOD 178 1179 1179 DOD DOD A . F 4 DOD 179 1180 1180 DOD DOD A . F 4 DOD 180 1181 1181 DOD DOD A . F 4 DOD 181 1182 1182 DOD DOD A . F 4 DOD 182 1183 1183 DOD DOD A . F 4 DOD 183 1184 1184 DOD DOD A . F 4 DOD 184 1185 1185 DOD DOD A . F 4 DOD 185 1186 1186 DOD DOD A . F 4 DOD 186 1187 1187 DOD DOD A . F 4 DOD 187 1188 1188 DOD DOD A . F 4 DOD 188 1189 1189 DOD DOD A . F 4 DOD 189 1190 1190 DOD DOD A . F 4 DOD 190 1191 1191 DOD DOD A . F 4 DOD 191 1192 1192 DOD DOD A . F 4 DOD 192 1193 1193 DOD DOD A . F 4 DOD 193 1194 1194 DOD DOD A . F 4 DOD 194 1195 1195 DOD DOD A . F 4 DOD 195 1196 1196 DOD DOD A . F 4 DOD 196 1197 1197 DOD DOD A . F 4 DOD 197 1198 1198 DOD DOD A . F 4 DOD 198 1199 1199 DOD DOD A . F 4 DOD 199 1200 1200 DOD DOD A . F 4 DOD 200 1201 1201 DOD DOD A . F 4 DOD 201 1202 1202 DOD DOD A . F 4 DOD 202 1203 1203 DOD DOD A . F 4 DOD 203 1204 1204 DOD DOD A . F 4 DOD 204 1205 1205 DOD DOD A . F 4 DOD 205 1206 1206 DOD DOD A . F 4 DOD 206 1207 1207 DOD DOD A . F 4 DOD 207 1208 1208 DOD DOD A . F 4 DOD 208 1209 1209 DOD DOD A . F 4 DOD 209 1210 1210 DOD DOD A . F 4 DOD 210 1211 1211 DOD DOD A . F 4 DOD 211 1212 1212 DOD DOD A . F 4 DOD 212 1213 1213 DOD DOD A . F 4 DOD 213 1214 1214 DOD DOD A . F 4 DOD 214 1215 1215 DOD DOD A . F 4 DOD 215 1216 1216 DOD DOD A . F 4 DOD 216 1217 1217 DOD DOD A . F 4 DOD 217 1218 1218 DOD DOD A . F 4 DOD 218 1219 1219 DOD DOD A . F 4 DOD 219 1220 1220 DOD DOD A . F 4 DOD 220 1221 1221 DOD DOD A . F 4 DOD 221 1222 1222 DOD DOD A . F 4 DOD 222 1223 1223 DOD DOD A . F 4 DOD 223 1224 1224 DOD DOD A . F 4 DOD 224 1225 1225 DOD DOD A . F 4 DOD 225 1226 1226 DOD DOD A . F 4 DOD 226 1227 1227 DOD DOD A . F 4 DOD 227 1228 1228 DOD DOD A . F 4 DOD 228 1229 1229 DOD DOD A . F 4 DOD 229 1230 1230 DOD DOD A . F 4 DOD 230 1231 1231 DOD DOD A . F 4 DOD 231 1233 1233 DOD DOD A . F 4 DOD 232 1234 1234 DOD DOD A . F 4 DOD 233 1236 1236 DOD DOD A . F 4 DOD 234 1237 1237 DOD DOD A . F 4 DOD 235 1238 1238 DOD DOD A . F 4 DOD 236 1240 1240 DOD DOD A . F 4 DOD 237 1242 1242 DOD DOD A . F 4 DOD 238 1243 1243 DOD DOD A . F 4 DOD 239 1244 1244 DOD DOD A . F 4 DOD 240 1246 1246 DOD DOD A . F 4 DOD 241 1248 1248 DOD DOD A . F 4 DOD 242 1249 1249 DOD DOD A . F 4 DOD 243 1251 1251 DOD DOD A . F 4 DOD 244 1252 1252 DOD DOD A . F 4 DOD 245 1253 1253 DOD DOD A . F 4 DOD 246 1254 1254 DOD DOD A . F 4 DOD 247 1255 1255 DOD DOD A . F 4 DOD 248 1256 1256 DOD DOD A . F 4 DOD 249 1257 1257 DOD DOD A . F 4 DOD 250 1258 1258 DOD DOD A . F 4 DOD 251 1262 1262 DOD DOD A . F 4 DOD 252 1263 1263 DOD DOD A . F 4 DOD 253 1264 1264 DOD DOD A . F 4 DOD 254 1265 1265 DOD DOD A . F 4 DOD 255 1266 1266 DOD DOD A . F 4 DOD 256 1267 1267 DOD DOD A . F 4 DOD 257 1268 1268 DOD DOD A . F 4 DOD 258 1269 1269 DOD DOD A . F 4 DOD 259 1270 1270 DOD DOD A . F 4 DOD 260 1271 1271 DOD DOD A . F 4 DOD 261 1272 1272 DOD DOD A . F 4 DOD 262 1273 1273 DOD DOD A . F 4 DOD 263 1274 1274 DOD DOD A . F 4 DOD 264 1275 1275 DOD DOD A . F 4 DOD 265 1276 1276 DOD DOD A . F 4 DOD 266 1277 1277 DOD DOD A . F 4 DOD 267 1280 1280 DOD DOD A . F 4 DOD 268 1281 1281 DOD DOD A . F 4 DOD 269 1282 1282 DOD DOD A . F 4 DOD 270 1284 1284 DOD DOD A . F 4 DOD 271 1285 1285 DOD DOD A . F 4 DOD 272 1286 1286 DOD DOD A . F 4 DOD 273 1287 1287 DOD DOD A . F 4 DOD 274 1288 1288 DOD DOD A . F 4 DOD 275 1289 1289 DOD DOD A . F 4 DOD 276 1290 1290 DOD DOD A . F 4 DOD 277 1291 1291 DOD DOD A . F 4 DOD 278 1292 1292 DOD DOD A . F 4 DOD 279 1293 1293 DOD DOD A . F 4 DOD 280 1294 1294 DOD DOD A . F 4 DOD 281 1295 1295 DOD DOD A . F 4 DOD 282 1296 1296 DOD DOD A . F 4 DOD 283 1297 1297 DOD DOD A . F 4 DOD 284 1298 1298 DOD DOD A . F 4 DOD 285 1300 1300 DOD DOD A . F 4 DOD 286 1301 1301 DOD DOD A . F 4 DOD 287 1303 1303 DOD DOD A . F 4 DOD 288 1304 1304 DOD DOD A . F 4 DOD 289 1305 1305 DOD DOD A . F 4 DOD 290 1306 1306 DOD DOD A . F 4 DOD 291 1307 1307 DOD DOD A . F 4 DOD 292 1308 1308 DOD DOD A . F 4 DOD 293 1309 1309 DOD DOD A . F 4 DOD 294 1310 1310 DOD DOD A . F 4 DOD 295 1314 1314 DOD DOD A . F 4 DOD 296 1317 1317 DOD DOD A . F 4 DOD 297 1318 1318 DOD DOD A . F 4 DOD 298 1319 1319 DOD DOD A . F 4 DOD 299 1321 1321 DOD DOD A . F 4 DOD 300 1324 1324 DOD DOD A . F 4 DOD 301 1327 1327 DOD DOD A . F 4 DOD 302 1331 1331 DOD DOD A . F 4 DOD 303 1332 1332 DOD DOD A . F 4 DOD 304 1337 1337 DOD DOD A . F 4 DOD 305 1338 1338 DOD DOD A . F 4 DOD 306 1339 1339 DOD DOD A . F 4 DOD 307 1340 1340 DOD DOD A . F 4 DOD 308 1341 1341 DOD DOD A . F 4 DOD 309 1342 1342 DOD DOD A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language PCS 'data collection' software ? 1 ? ? ? ? nCNS refinement . ? 2 ? ? ? ? d*TREK 'data reduction' 'MODIFIED FOR NEUTRON' ? 3 ? ? ? ? LAUENORM 'data scaling' 'MODIFIED FOR NEUTRON' ? 4 ? ? ? ? nCNS phasing . ? 5 ? ? ? ? # _cell.entry_id 3KCO _cell.length_a 94.007 _cell.length_b 99.669 _cell.length_c 102.862 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3KCO _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? # loop_ _exptl.entry_id _exptl.method _exptl.crystals_number 3KCO 'NEUTRON DIFFRACTION' 1 3KCO 'X-RAY DIFFRACTION' ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.78 _exptl_crystal.density_percent_sol 55.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.7 _exptl_crystal_grow.pdbx_details ;50MM HEPES, 40% v/v (NH4)2SO4 (sat.), protein 40 MG/ML, PH=7.7, BATCH METHOD, APO-XI CRYSTALS WERE SOAKED WITH 5mM NiCl2 SALT, 0.5M PER-DEUTERATED D-GLUCOSE IN D2O, temperature 293K ; _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 293 ? 1 2 293 ? 1 # loop_ _diffrn_detector.diffrn_id _diffrn_detector.detector _diffrn_detector.type _diffrn_detector.pdbx_collection_date _diffrn_detector.details 1 'AREA DETECTOR' 'TIME-OF-FLIGHT MULTIWIRE HE3' 2008-10-10 ? 2 'IMAGE PLATE' 'RIGAKU RAXIS IV++' 2009-03-10 ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 L ? LAUE neutron 2 1 M ? 'SINGLE WAVELENGTH' x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.7 1.0 2 6.5 1.0 3 1.54 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list 1 'NUCLEAR REACTOR' 'LANSCE BEAMLINE PCS' LANSCE PCS ? 0.7-6.5 2 'ROTATING ANODE' ? ? ? ? 1.54 # _reflns.entry_id 3KCO _reflns.observed_criterion_sigma_I 1.7 _reflns.observed_criterion_sigma_F 3 _reflns.d_resolution_low 20 _reflns.d_resolution_high 1.8 _reflns.number_obs 27031 _reflns.number_all 37568 _reflns.percent_possible_obs 72 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.236 _reflns.pdbx_netI_over_sigmaI 4.0 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.90 _reflns_shell.percent_possible_all 72.5 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.359 _reflns_shell.meanI_over_sigI_obs 1.5 _reflns_shell.pdbx_redundancy 1.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # loop_ _refine.pdbx_refine_id _refine.entry_id _refine.ls_number_reflns_obs _refine.ls_number_reflns_all _refine.pdbx_ls_sigma_I _refine.pdbx_ls_sigma_F _refine.pdbx_data_cutoff_high_absF _refine.pdbx_data_cutoff_low_absF _refine.pdbx_data_cutoff_high_rms_absF _refine.ls_d_res_low _refine.ls_d_res_high _refine.ls_percent_reflns_obs _refine.ls_R_factor_obs _refine.ls_R_factor_all _refine.ls_R_factor_R_work _refine.ls_R_factor_R_free _refine.ls_R_factor_R_free_error _refine.ls_R_factor_R_free_error_details _refine.ls_percent_reflns_R_free _refine.ls_number_reflns_R_free _refine.ls_number_parameters _refine.ls_number_restraints _refine.occupancy_min _refine.occupancy_max _refine.correlation_coeff_Fo_to_Fc _refine.correlation_coeff_Fo_to_Fc_free _refine.B_iso_mean _refine.aniso_B[1][1] _refine.aniso_B[2][2] _refine.aniso_B[3][3] _refine.aniso_B[1][2] _refine.aniso_B[1][3] _refine.aniso_B[2][3] _refine.solvent_model_details _refine.solvent_model_param_ksol _refine.solvent_model_param_bsol _refine.pdbx_solvent_vdw_probe_radii _refine.pdbx_solvent_ion_probe_radii _refine.pdbx_solvent_shrinkage_radii _refine.pdbx_ls_cross_valid_method _refine.details _refine.pdbx_starting_model _refine.pdbx_method_to_determine_struct _refine.pdbx_isotropic_thermal_model _refine.pdbx_stereochemistry_target_values _refine.pdbx_stereochem_target_val_spec_case _refine.pdbx_R_Free_selection_details _refine.pdbx_overall_ESU_R_Free _refine.overall_SU_ML _refine.overall_SU_B _refine.ls_redundancy_reflns_obs _refine.B_iso_min _refine.B_iso_max _refine.overall_SU_R_Cruickshank_DPI _refine.overall_SU_R_free _refine.ls_wR_factor_R_free _refine.ls_wR_factor_R_work _refine.overall_FOM_free_R_set _refine.overall_FOM_work_R_set _refine.pdbx_overall_phase_error _refine.pdbx_overall_ESU_R _refine.pdbx_diffrn_id _refine.pdbx_TLS_residual_ADP_flag _refine.pdbx_overall_SU_R_free_Cruickshank_DPI _refine.pdbx_overall_SU_R_Blow_DPI _refine.pdbx_overall_SU_R_free_Blow_DPI 'NEUTRON DIFFRACTION' 3KCO 27031 37568 ? 3 ? ? ? 20 1.8 ? ? ? 0.273 0.294 ? ? 5.1 1388 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3CWH 'MOLECULAR REPLACEMENT' ? 'ENGH AND HUBER' ? RANDOM ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 ? ? ? ? 'X-RAY DIFFRACTION' 3KCO ? ? ? 3 ? ? ? 20 1.53 ? ? ? 0.199 0.211 ? ? 5.1 3281 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3CWH 'MOLECULAR REPLACEMENT' ? ? ? RANDOM ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # _refine_hist.pdbx_refine_id 'NEUTRON DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3054 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 309 _refine_hist.number_atoms_total 3378 _refine_hist.d_res_high 1.8 _refine_hist.d_res_low 20 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'NEUTRON DIFFRACTION' ? c_angle_deg 1.011 ? ? ? 'NEUTRON DIFFRACTION' ? # _database_PDB_matrix.entry_id 3KCO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 3KCO _struct.title ;Room temperature neutron structure of D-Xylose Isomerase in complex with two Ni2+ cations and d12-D-glucose in the linear form (refined jointly with X-ray structure 3KBN) ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3KCO _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'xylose isomerase, deuterated glucose, Carbohydrate metabolism, Metal-binding, Pentose shunt, Xylose metabolism, ISOMERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code XYLA_STRRU _struct_ref.pdbx_db_accession P24300 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALD DTGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKE AFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK LFHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKERAAAF RADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEFDVDAAAARGMAFERLDQLAMDHLLGARG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3KCO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 388 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P24300 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 388 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 388 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 35010 ? 1 MORE -347 ? 1 'SSA (A^2)' 46270 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_554 -x,y,-z-1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -102.8620000000 4 'crystal symmetry operation' 4_554 x,-y,-z-1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -102.8620000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 6 ? ASP A 9 ? THR A 6 ASP A 9 5 ? 4 HELX_P HELX_P2 2 LEU A 15 ? GLY A 19 ? LEU A 15 GLY A 19 1 ? 5 HELX_P HELX_P3 3 ASP A 35 ? LEU A 46 ? ASP A 35 LEU A 46 1 ? 12 HELX_P HELX_P4 4 ASP A 55 ? ILE A 59 ? ASP A 55 ILE A 59 1 ? 5 HELX_P HELX_P5 5 SER A 64 ? GLY A 83 ? SER A 64 GLY A 83 1 ? 20 HELX_P HELX_P6 6 HIS A 96 ? LYS A 100 ? HIS A 96 LYS A 100 5 ? 5 HELX_P HELX_P7 7 ASP A 108 ? GLY A 130 ? ASP A 108 GLY A 130 1 ? 23 HELX_P HELX_P8 8 ASP A 150 ? GLY A 173 ? ASP A 150 GLY A 173 1 ? 24 HELX_P HELX_P9 9 THR A 195 ? GLU A 204 ? THR A 195 GLU A 204 1 ? 10 HELX_P HELX_P10 10 ARG A 208 ? GLU A 210 ? ARG A 208 GLU A 210 5 ? 3 HELX_P HELX_P11 11 GLU A 217 ? MET A 223 ? GLU A 217 MET A 223 1 ? 7 HELX_P HELX_P12 12 ASN A 227 ? ALA A 238 ? ASN A 227 ALA A 238 1 ? 12 HELX_P HELX_P13 13 ASP A 264 ? ALA A 278 ? ASP A 264 ALA A 278 1 ? 15 HELX_P HELX_P14 14 ASP A 295 ? ASP A 323 ? ASP A 295 ASP A 323 1 ? 29 HELX_P HELX_P15 15 ASP A 323 ? SER A 333 ? ASP A 323 SER A 333 1 ? 11 HELX_P HELX_P16 16 ARG A 334 ? ALA A 339 ? ARG A 334 ALA A 339 1 ? 6 HELX_P HELX_P17 17 GLY A 346 ? ASP A 353 ? GLY A 346 ASP A 353 1 ? 8 HELX_P HELX_P18 18 ARG A 354 ? PHE A 357 ? ARG A 354 PHE A 357 5 ? 4 HELX_P HELX_P19 19 ASP A 361 ? ARG A 368 ? ASP A 361 ARG A 368 1 ? 8 HELX_P HELX_P20 20 ALA A 371 ? LEU A 384 ? ALA A 371 LEU A 384 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 181 OE2 ? ? ? 1_555 D NI . NI ? ? A GLU 181 A NI 393 1_555 ? ? ? ? ? ? ? 2.050 ? ? metalc2 metalc ? ? A GLU 217 OE2 ? ? ? 1_555 B NI . NI ? ? A GLU 217 A NI 391 1_555 ? ? ? ? ? ? ? 2.282 ? ? metalc3 metalc ? ? A GLU 217 OE2 ? ? ? 1_555 C NI . NI ? ? A GLU 217 A NI 392 1_555 ? ? ? ? ? ? ? 2.173 ? ? metalc4 metalc ? ? A GLU 217 OE1 ? ? ? 1_555 D NI . NI ? ? A GLU 217 A NI 393 1_555 ? ? ? ? ? ? ? 2.022 ? ? metalc5 metalc ? ? A HIS 220 NE2 ? ? ? 1_555 B NI . NI ? ? A HIS 220 A NI 391 1_555 ? ? ? ? ? ? ? 2.020 ? ? metalc6 metalc ? ? A HIS 220 NE2 ? ? ? 1_555 C NI . NI ? ? A HIS 220 A NI 392 1_555 ? ? ? ? ? ? ? 2.610 ? ? metalc7 metalc ? ? A ASP 245 OD2 ? ? ? 1_555 D NI . NI ? ? A ASP 245 A NI 393 1_555 ? ? ? ? ? ? ? 2.219 ? ? metalc8 metalc ? ? A ASP 255 OD1 ? ? ? 1_555 C NI . NI ? ? A ASP 255 A NI 392 1_555 ? ? ? ? ? ? ? 2.180 ? ? metalc9 metalc ? ? A ASP 255 OD2 ? ? ? 1_555 C NI . NI ? ? A ASP 255 A NI 392 1_555 ? ? ? ? ? ? ? 2.077 ? ? metalc10 metalc ? ? A ASP 257 OD1 ? ? ? 1_555 C NI . NI ? ? A ASP 257 A NI 392 1_555 ? ? ? ? ? ? ? 2.227 ? ? metalc11 metalc ? ? A ASP 287 OD2 ? ? ? 1_555 D NI . NI ? ? A ASP 287 A NI 393 1_555 ? ? ? ? ? ? ? 2.114 ? ? metalc12 metalc ? ? B NI . NI ? ? ? 1_555 E GLO . O1 ? ? A NI 391 A GLO 401 1_555 ? ? ? ? ? ? ? 2.286 ? ? metalc13 metalc ? ? B NI . NI ? ? ? 1_555 E GLO . O2 ? ? A NI 391 A GLO 401 1_555 ? ? ? ? ? ? ? 2.043 ? ? metalc14 metalc ? ? B NI . NI ? ? ? 1_555 F DOD . O ? ? A NI 391 A DOD 1001 1_555 ? ? ? ? ? ? ? 1.877 ? ? metalc15 metalc ? ? C NI . NI ? ? ? 1_555 F DOD . O ? ? A NI 392 A DOD 1001 1_555 ? ? ? ? ? ? ? 2.722 ? ? metalc16 metalc ? ? D NI . NI ? ? ? 1_555 E GLO . O4 ? ? A NI 393 A GLO 401 1_555 ? ? ? ? ? ? ? 2.379 ? ? metalc17 metalc ? ? D NI . NI ? ? ? 1_555 E GLO . O2 ? ? A NI 393 A GLO 401 1_555 ? ? ? ? ? ? ? 2.159 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 95.9 ? 2 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 97.0 ? 3 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 101.3 ? 4 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 160.5 ? 5 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 97.1 ? 6 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 94.5 ? 7 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 O4 ? E GLO . ? A GLO 401 ? 1_555 81.1 ? 8 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 O4 ? E GLO . ? A GLO 401 ? 1_555 167.2 ? 9 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 O4 ? E GLO . ? A GLO 401 ? 1_555 91.5 ? 10 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 O4 ? E GLO . ? A GLO 401 ? 1_555 83.0 ? 11 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 O2 ? E GLO . ? A GLO 401 ? 1_555 81.7 ? 12 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 O2 ? E GLO . ? A GLO 401 ? 1_555 81.4 ? 13 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 O2 ? E GLO . ? A GLO 401 ? 1_555 177.1 ? 14 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 O2 ? E GLO . ? A GLO 401 ? 1_555 86.0 ? 15 O4 ? E GLO . ? A GLO 401 ? 1_555 NI ? D NI . ? A NI 393 ? 1_555 O2 ? E GLO . ? A GLO 401 ? 1_555 85.8 ? 16 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? B NI . ? A NI 391 ? 1_555 NE2 ? A HIS 220 ? A HIS 220 ? 1_555 83.4 ? 17 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? B NI . ? A NI 391 ? 1_555 O1 ? E GLO . ? A GLO 401 ? 1_555 169.6 ? 18 NE2 ? A HIS 220 ? A HIS 220 ? 1_555 NI ? B NI . ? A NI 391 ? 1_555 O1 ? E GLO . ? A GLO 401 ? 1_555 90.6 ? 19 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? B NI . ? A NI 391 ? 1_555 O2 ? E GLO . ? A GLO 401 ? 1_555 111.7 ? 20 NE2 ? A HIS 220 ? A HIS 220 ? 1_555 NI ? B NI . ? A NI 391 ? 1_555 O2 ? E GLO . ? A GLO 401 ? 1_555 107.4 ? 21 O1 ? E GLO . ? A GLO 401 ? 1_555 NI ? B NI . ? A NI 391 ? 1_555 O2 ? E GLO . ? A GLO 401 ? 1_555 78.1 ? 22 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? B NI . ? A NI 391 ? 1_555 O ? F DOD . ? A DOD 1001 ? 1_555 102.6 ? 23 NE2 ? A HIS 220 ? A HIS 220 ? 1_555 NI ? B NI . ? A NI 391 ? 1_555 O ? F DOD . ? A DOD 1001 ? 1_555 170.6 ? 24 O1 ? E GLO . ? A GLO 401 ? 1_555 NI ? B NI . ? A NI 391 ? 1_555 O ? F DOD . ? A DOD 1001 ? 1_555 82.3 ? 25 O2 ? E GLO . ? A GLO 401 ? 1_555 NI ? B NI . ? A NI 391 ? 1_555 O ? F DOD . ? A DOD 1001 ? 1_555 77.2 ? 26 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 NE2 ? A HIS 220 ? A HIS 220 ? 1_555 73.1 ? 27 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 OD1 ? A ASP 255 ? A ASP 255 ? 1_555 122.9 ? 28 NE2 ? A HIS 220 ? A HIS 220 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 OD1 ? A ASP 255 ? A ASP 255 ? 1_555 101.3 ? 29 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 OD2 ? A ASP 255 ? A ASP 255 ? 1_555 175.1 ? 30 NE2 ? A HIS 220 ? A HIS 220 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 OD2 ? A ASP 255 ? A ASP 255 ? 1_555 106.1 ? 31 OD1 ? A ASP 255 ? A ASP 255 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 OD2 ? A ASP 255 ? A ASP 255 ? 1_555 61.9 ? 32 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 OD1 ? A ASP 257 ? A ASP 257 ? 1_555 94.0 ? 33 NE2 ? A HIS 220 ? A HIS 220 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 OD1 ? A ASP 257 ? A ASP 257 ? 1_555 166.1 ? 34 OD1 ? A ASP 255 ? A ASP 255 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 OD1 ? A ASP 257 ? A ASP 257 ? 1_555 81.0 ? 35 OD2 ? A ASP 255 ? A ASP 255 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 OD1 ? A ASP 257 ? A ASP 257 ? 1_555 87.2 ? 36 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 O ? F DOD . ? A DOD 1001 ? 1_555 82.6 ? 37 NE2 ? A HIS 220 ? A HIS 220 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 O ? F DOD . ? A DOD 1001 ? 1_555 93.5 ? 38 OD1 ? A ASP 255 ? A ASP 255 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 O ? F DOD . ? A DOD 1001 ? 1_555 153.3 ? 39 OD2 ? A ASP 255 ? A ASP 255 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 O ? F DOD . ? A DOD 1001 ? 1_555 92.7 ? 40 OD1 ? A ASP 257 ? A ASP 257 ? 1_555 NI ? C NI . ? A NI 392 ? 1_555 O ? F DOD . ? A DOD 1001 ? 1_555 90.0 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 186 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 186 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 187 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 187 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 28.64 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? parallel A 7 8 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 212 ? VAL A 214 ? TYR A 212 VAL A 214 A 2 ARG A 177 ? ILE A 180 ? ARG A 177 ILE A 180 A 3 THR A 133 ? ALA A 136 ? THR A 133 ALA A 136 A 4 LYS A 85 ? THR A 90 ? LYS A 85 THR A 90 A 5 GLY A 50 ? HIS A 54 ? GLY A 50 HIS A 54 A 6 PHE A 11 ? GLY A 14 ? PHE A 11 GLY A 14 A 7 ARG A 284 ? PHE A 286 ? ARG A 284 PHE A 286 A 8 ASP A 245 ? LEU A 246 ? ASP A 245 LEU A 246 B 1 GLY A 142 ? ALA A 143 ? GLY A 142 ALA A 143 B 2 ASP A 190 ? ILE A 191 ? ASP A 190 ILE A 191 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLY A 213 ? O GLY A 213 N PHE A 178 ? N PHE A 178 A 2 3 O ARG A 177 ? O ARG A 177 N TYR A 134 ? N TYR A 134 A 3 4 O VAL A 135 ? O VAL A 135 N ALA A 89 ? N ALA A 89 A 4 5 O LYS A 85 ? O LYS A 85 N VAL A 51 ? N VAL A 51 A 5 6 O THR A 52 ? O THR A 52 N PHE A 13 ? N PHE A 13 A 6 7 N THR A 12 ? N THR A 12 O PHE A 286 ? O PHE A 286 A 7 8 O HIS A 285 ? O HIS A 285 N LEU A 246 ? N LEU A 246 B 1 2 N ALA A 143 ? N ALA A 143 O ASP A 190 ? O ASP A 190 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 D2 A DOD 1185 ? ? O A DOD 1225 ? ? 1.37 2 1 O A DOD 1105 ? ? D2 A DOD 1154 ? ? 1.53 3 1 O A DOD 1185 ? ? D1 A DOD 1273 ? ? 1.54 4 1 D1 A DOD 1216 ? ? O A DOD 1251 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 17 ? ? -81.88 -73.84 2 1 ASP A 175 ? ? -109.29 67.33 3 1 GLU A 186 ? ? 74.58 99.80 4 1 LEU A 193 ? ? 61.37 61.35 5 1 ASN A 247 ? ? -168.87 -164.93 6 1 LYS A 253 ? ? -174.65 -166.36 7 1 PHE A 357 ? ? -165.96 -72.81 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 331 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.073 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id DOD _pdbx_struct_special_symmetry.auth_seq_id 1192 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id DOD _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_entry_details.entry_id 3KCO _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details 'THE PROTEIN WAS PURCHASED FROM HAMPTON RESEARCH' _pdbx_entry_details.has_ligand_of_interest ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DOD O O N N 88 DOD D1 D N N 89 DOD D2 D N N 90 GLN N N N N 91 GLN CA C N S 92 GLN C C N N 93 GLN O O N N 94 GLN CB C N N 95 GLN CG C N N 96 GLN CD C N N 97 GLN OE1 O N N 98 GLN NE2 N N N 99 GLN OXT O N N 100 GLN H H N N 101 GLN H2 H N N 102 GLN HA H N N 103 GLN HB2 H N N 104 GLN HB3 H N N 105 GLN HG2 H N N 106 GLN HG3 H N N 107 GLN HE21 H N N 108 GLN HE22 H N N 109 GLN HXT H N N 110 GLO C1 C N N 111 GLO C2 C N R 112 GLO C3 C N S 113 GLO C4 C N R 114 GLO C5 C N R 115 GLO C6 C N N 116 GLO O1 O N N 117 GLO O2 O N N 118 GLO O3 O N N 119 GLO O4 O N N 120 GLO O5 O N N 121 GLO O6 O N N 122 GLO H1 H N N 123 GLO H2 H N N 124 GLO H3 H N N 125 GLO H4 H N N 126 GLO H5 H N N 127 GLO H61 H N N 128 GLO H62 H N N 129 GLO HO2 H N N 130 GLO HO3 H N N 131 GLO HO4 H N N 132 GLO HO5 H N N 133 GLO HO6 H N N 134 GLU N N N N 135 GLU CA C N S 136 GLU C C N N 137 GLU O O N N 138 GLU CB C N N 139 GLU CG C N N 140 GLU CD C N N 141 GLU OE1 O N N 142 GLU OE2 O N N 143 GLU OXT O N N 144 GLU H H N N 145 GLU H2 H N N 146 GLU HA H N N 147 GLU HB2 H N N 148 GLU HB3 H N N 149 GLU HG2 H N N 150 GLU HG3 H N N 151 GLU HE2 H N N 152 GLU HXT H N N 153 GLY N N N N 154 GLY CA C N N 155 GLY C C N N 156 GLY O O N N 157 GLY OXT O N N 158 GLY H H N N 159 GLY H2 H N N 160 GLY HA2 H N N 161 GLY HA3 H N N 162 GLY HXT H N N 163 HIS N N N N 164 HIS CA C N S 165 HIS C C N N 166 HIS O O N N 167 HIS CB C N N 168 HIS CG C Y N 169 HIS ND1 N Y N 170 HIS CD2 C Y N 171 HIS CE1 C Y N 172 HIS NE2 N Y N 173 HIS OXT O N N 174 HIS H H N N 175 HIS H2 H N N 176 HIS HA H N N 177 HIS HB2 H N N 178 HIS HB3 H N N 179 HIS HD1 H N N 180 HIS HD2 H N N 181 HIS HE1 H N N 182 HIS HE2 H N N 183 HIS HXT H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 NI NI NI N N 274 PHE N N N N 275 PHE CA C N S 276 PHE C C N N 277 PHE O O N N 278 PHE CB C N N 279 PHE CG C Y N 280 PHE CD1 C Y N 281 PHE CD2 C Y N 282 PHE CE1 C Y N 283 PHE CE2 C Y N 284 PHE CZ C Y N 285 PHE OXT O N N 286 PHE H H N N 287 PHE H2 H N N 288 PHE HA H N N 289 PHE HB2 H N N 290 PHE HB3 H N N 291 PHE HD1 H N N 292 PHE HD2 H N N 293 PHE HE1 H N N 294 PHE HE2 H N N 295 PHE HZ H N N 296 PHE HXT H N N 297 PRO N N N N 298 PRO CA C N S 299 PRO C C N N 300 PRO O O N N 301 PRO CB C N N 302 PRO CG C N N 303 PRO CD C N N 304 PRO OXT O N N 305 PRO H H N N 306 PRO HA H N N 307 PRO HB2 H N N 308 PRO HB3 H N N 309 PRO HG2 H N N 310 PRO HG3 H N N 311 PRO HD2 H N N 312 PRO HD3 H N N 313 PRO HXT H N N 314 SER N N N N 315 SER CA C N S 316 SER C C N N 317 SER O O N N 318 SER CB C N N 319 SER OG O N N 320 SER OXT O N N 321 SER H H N N 322 SER H2 H N N 323 SER HA H N N 324 SER HB2 H N N 325 SER HB3 H N N 326 SER HG H N N 327 SER HXT H N N 328 THR N N N N 329 THR CA C N S 330 THR C C N N 331 THR O O N N 332 THR CB C N R 333 THR OG1 O N N 334 THR CG2 C N N 335 THR OXT O N N 336 THR H H N N 337 THR H2 H N N 338 THR HA H N N 339 THR HB H N N 340 THR HG1 H N N 341 THR HG21 H N N 342 THR HG22 H N N 343 THR HG23 H N N 344 THR HXT H N N 345 TRP N N N N 346 TRP CA C N S 347 TRP C C N N 348 TRP O O N N 349 TRP CB C N N 350 TRP CG C Y N 351 TRP CD1 C Y N 352 TRP CD2 C Y N 353 TRP NE1 N Y N 354 TRP CE2 C Y N 355 TRP CE3 C Y N 356 TRP CZ2 C Y N 357 TRP CZ3 C Y N 358 TRP CH2 C Y N 359 TRP OXT O N N 360 TRP H H N N 361 TRP H2 H N N 362 TRP HA H N N 363 TRP HB2 H N N 364 TRP HB3 H N N 365 TRP HD1 H N N 366 TRP HE1 H N N 367 TRP HE3 H N N 368 TRP HZ2 H N N 369 TRP HZ3 H N N 370 TRP HH2 H N N 371 TRP HXT H N N 372 TYR N N N N 373 TYR CA C N S 374 TYR C C N N 375 TYR O O N N 376 TYR CB C N N 377 TYR CG C Y N 378 TYR CD1 C Y N 379 TYR CD2 C Y N 380 TYR CE1 C Y N 381 TYR CE2 C Y N 382 TYR CZ C Y N 383 TYR OH O N N 384 TYR OXT O N N 385 TYR H H N N 386 TYR H2 H N N 387 TYR HA H N N 388 TYR HB2 H N N 389 TYR HB3 H N N 390 TYR HD1 H N N 391 TYR HD2 H N N 392 TYR HE1 H N N 393 TYR HE2 H N N 394 TYR HH H N N 395 TYR HXT H N N 396 VAL N N N N 397 VAL CA C N S 398 VAL C C N N 399 VAL O O N N 400 VAL CB C N N 401 VAL CG1 C N N 402 VAL CG2 C N N 403 VAL OXT O N N 404 VAL H H N N 405 VAL H2 H N N 406 VAL HA H N N 407 VAL HB H N N 408 VAL HG11 H N N 409 VAL HG12 H N N 410 VAL HG13 H N N 411 VAL HG21 H N N 412 VAL HG22 H N N 413 VAL HG23 H N N 414 VAL HXT H N N 415 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DOD O D1 sing N N 83 DOD O D2 sing N N 84 GLN N CA sing N N 85 GLN N H sing N N 86 GLN N H2 sing N N 87 GLN CA C sing N N 88 GLN CA CB sing N N 89 GLN CA HA sing N N 90 GLN C O doub N N 91 GLN C OXT sing N N 92 GLN CB CG sing N N 93 GLN CB HB2 sing N N 94 GLN CB HB3 sing N N 95 GLN CG CD sing N N 96 GLN CG HG2 sing N N 97 GLN CG HG3 sing N N 98 GLN CD OE1 doub N N 99 GLN CD NE2 sing N N 100 GLN NE2 HE21 sing N N 101 GLN NE2 HE22 sing N N 102 GLN OXT HXT sing N N 103 GLO C1 C2 sing N N 104 GLO C1 O1 doub N N 105 GLO C1 H1 sing N N 106 GLO C2 C3 sing N N 107 GLO C2 O2 sing N N 108 GLO C2 H2 sing N N 109 GLO C3 C4 sing N N 110 GLO C3 O3 sing N N 111 GLO C3 H3 sing N N 112 GLO C4 C5 sing N N 113 GLO C4 O4 sing N N 114 GLO C4 H4 sing N N 115 GLO C5 C6 sing N N 116 GLO C5 O5 sing N N 117 GLO C5 H5 sing N N 118 GLO C6 O6 sing N N 119 GLO C6 H61 sing N N 120 GLO C6 H62 sing N N 121 GLO O2 HO2 sing N N 122 GLO O3 HO3 sing N N 123 GLO O4 HO4 sing N N 124 GLO O5 HO5 sing N N 125 GLO O6 HO6 sing N N 126 GLU N CA sing N N 127 GLU N H sing N N 128 GLU N H2 sing N N 129 GLU CA C sing N N 130 GLU CA CB sing N N 131 GLU CA HA sing N N 132 GLU C O doub N N 133 GLU C OXT sing N N 134 GLU CB CG sing N N 135 GLU CB HB2 sing N N 136 GLU CB HB3 sing N N 137 GLU CG CD sing N N 138 GLU CG HG2 sing N N 139 GLU CG HG3 sing N N 140 GLU CD OE1 doub N N 141 GLU CD OE2 sing N N 142 GLU OE2 HE2 sing N N 143 GLU OXT HXT sing N N 144 GLY N CA sing N N 145 GLY N H sing N N 146 GLY N H2 sing N N 147 GLY CA C sing N N 148 GLY CA HA2 sing N N 149 GLY CA HA3 sing N N 150 GLY C O doub N N 151 GLY C OXT sing N N 152 GLY OXT HXT sing N N 153 HIS N CA sing N N 154 HIS N H sing N N 155 HIS N H2 sing N N 156 HIS CA C sing N N 157 HIS CA CB sing N N 158 HIS CA HA sing N N 159 HIS C O doub N N 160 HIS C OXT sing N N 161 HIS CB CG sing N N 162 HIS CB HB2 sing N N 163 HIS CB HB3 sing N N 164 HIS CG ND1 sing Y N 165 HIS CG CD2 doub Y N 166 HIS ND1 CE1 doub Y N 167 HIS ND1 HD1 sing N N 168 HIS CD2 NE2 sing Y N 169 HIS CD2 HD2 sing N N 170 HIS CE1 NE2 sing Y N 171 HIS CE1 HE1 sing N N 172 HIS NE2 HE2 sing N N 173 HIS OXT HXT sing N N 174 ILE N CA sing N N 175 ILE N H sing N N 176 ILE N H2 sing N N 177 ILE CA C sing N N 178 ILE CA CB sing N N 179 ILE CA HA sing N N 180 ILE C O doub N N 181 ILE C OXT sing N N 182 ILE CB CG1 sing N N 183 ILE CB CG2 sing N N 184 ILE CB HB sing N N 185 ILE CG1 CD1 sing N N 186 ILE CG1 HG12 sing N N 187 ILE CG1 HG13 sing N N 188 ILE CG2 HG21 sing N N 189 ILE CG2 HG22 sing N N 190 ILE CG2 HG23 sing N N 191 ILE CD1 HD11 sing N N 192 ILE CD1 HD12 sing N N 193 ILE CD1 HD13 sing N N 194 ILE OXT HXT sing N N 195 LEU N CA sing N N 196 LEU N H sing N N 197 LEU N H2 sing N N 198 LEU CA C sing N N 199 LEU CA CB sing N N 200 LEU CA HA sing N N 201 LEU C O doub N N 202 LEU C OXT sing N N 203 LEU CB CG sing N N 204 LEU CB HB2 sing N N 205 LEU CB HB3 sing N N 206 LEU CG CD1 sing N N 207 LEU CG CD2 sing N N 208 LEU CG HG sing N N 209 LEU CD1 HD11 sing N N 210 LEU CD1 HD12 sing N N 211 LEU CD1 HD13 sing N N 212 LEU CD2 HD21 sing N N 213 LEU CD2 HD22 sing N N 214 LEU CD2 HD23 sing N N 215 LEU OXT HXT sing N N 216 LYS N CA sing N N 217 LYS N H sing N N 218 LYS N H2 sing N N 219 LYS CA C sing N N 220 LYS CA CB sing N N 221 LYS CA HA sing N N 222 LYS C O doub N N 223 LYS C OXT sing N N 224 LYS CB CG sing N N 225 LYS CB HB2 sing N N 226 LYS CB HB3 sing N N 227 LYS CG CD sing N N 228 LYS CG HG2 sing N N 229 LYS CG HG3 sing N N 230 LYS CD CE sing N N 231 LYS CD HD2 sing N N 232 LYS CD HD3 sing N N 233 LYS CE NZ sing N N 234 LYS CE HE2 sing N N 235 LYS CE HE3 sing N N 236 LYS NZ HZ1 sing N N 237 LYS NZ HZ2 sing N N 238 LYS NZ HZ3 sing N N 239 LYS OXT HXT sing N N 240 MET N CA sing N N 241 MET N H sing N N 242 MET N H2 sing N N 243 MET CA C sing N N 244 MET CA CB sing N N 245 MET CA HA sing N N 246 MET C O doub N N 247 MET C OXT sing N N 248 MET CB CG sing N N 249 MET CB HB2 sing N N 250 MET CB HB3 sing N N 251 MET CG SD sing N N 252 MET CG HG2 sing N N 253 MET CG HG3 sing N N 254 MET SD CE sing N N 255 MET CE HE1 sing N N 256 MET CE HE2 sing N N 257 MET CE HE3 sing N N 258 MET OXT HXT sing N N 259 PHE N CA sing N N 260 PHE N H sing N N 261 PHE N H2 sing N N 262 PHE CA C sing N N 263 PHE CA CB sing N N 264 PHE CA HA sing N N 265 PHE C O doub N N 266 PHE C OXT sing N N 267 PHE CB CG sing N N 268 PHE CB HB2 sing N N 269 PHE CB HB3 sing N N 270 PHE CG CD1 doub Y N 271 PHE CG CD2 sing Y N 272 PHE CD1 CE1 sing Y N 273 PHE CD1 HD1 sing N N 274 PHE CD2 CE2 doub Y N 275 PHE CD2 HD2 sing N N 276 PHE CE1 CZ doub Y N 277 PHE CE1 HE1 sing N N 278 PHE CE2 CZ sing Y N 279 PHE CE2 HE2 sing N N 280 PHE CZ HZ sing N N 281 PHE OXT HXT sing N N 282 PRO N CA sing N N 283 PRO N CD sing N N 284 PRO N H sing N N 285 PRO CA C sing N N 286 PRO CA CB sing N N 287 PRO CA HA sing N N 288 PRO C O doub N N 289 PRO C OXT sing N N 290 PRO CB CG sing N N 291 PRO CB HB2 sing N N 292 PRO CB HB3 sing N N 293 PRO CG CD sing N N 294 PRO CG HG2 sing N N 295 PRO CG HG3 sing N N 296 PRO CD HD2 sing N N 297 PRO CD HD3 sing N N 298 PRO OXT HXT sing N N 299 SER N CA sing N N 300 SER N H sing N N 301 SER N H2 sing N N 302 SER CA C sing N N 303 SER CA CB sing N N 304 SER CA HA sing N N 305 SER C O doub N N 306 SER C OXT sing N N 307 SER CB OG sing N N 308 SER CB HB2 sing N N 309 SER CB HB3 sing N N 310 SER OG HG sing N N 311 SER OXT HXT sing N N 312 THR N CA sing N N 313 THR N H sing N N 314 THR N H2 sing N N 315 THR CA C sing N N 316 THR CA CB sing N N 317 THR CA HA sing N N 318 THR C O doub N N 319 THR C OXT sing N N 320 THR CB OG1 sing N N 321 THR CB CG2 sing N N 322 THR CB HB sing N N 323 THR OG1 HG1 sing N N 324 THR CG2 HG21 sing N N 325 THR CG2 HG22 sing N N 326 THR CG2 HG23 sing N N 327 THR OXT HXT sing N N 328 TRP N CA sing N N 329 TRP N H sing N N 330 TRP N H2 sing N N 331 TRP CA C sing N N 332 TRP CA CB sing N N 333 TRP CA HA sing N N 334 TRP C O doub N N 335 TRP C OXT sing N N 336 TRP CB CG sing N N 337 TRP CB HB2 sing N N 338 TRP CB HB3 sing N N 339 TRP CG CD1 doub Y N 340 TRP CG CD2 sing Y N 341 TRP CD1 NE1 sing Y N 342 TRP CD1 HD1 sing N N 343 TRP CD2 CE2 doub Y N 344 TRP CD2 CE3 sing Y N 345 TRP NE1 CE2 sing Y N 346 TRP NE1 HE1 sing N N 347 TRP CE2 CZ2 sing Y N 348 TRP CE3 CZ3 doub Y N 349 TRP CE3 HE3 sing N N 350 TRP CZ2 CH2 doub Y N 351 TRP CZ2 HZ2 sing N N 352 TRP CZ3 CH2 sing Y N 353 TRP CZ3 HZ3 sing N N 354 TRP CH2 HH2 sing N N 355 TRP OXT HXT sing N N 356 TYR N CA sing N N 357 TYR N H sing N N 358 TYR N H2 sing N N 359 TYR CA C sing N N 360 TYR CA CB sing N N 361 TYR CA HA sing N N 362 TYR C O doub N N 363 TYR C OXT sing N N 364 TYR CB CG sing N N 365 TYR CB HB2 sing N N 366 TYR CB HB3 sing N N 367 TYR CG CD1 doub Y N 368 TYR CG CD2 sing Y N 369 TYR CD1 CE1 sing Y N 370 TYR CD1 HD1 sing N N 371 TYR CD2 CE2 doub Y N 372 TYR CD2 HD2 sing N N 373 TYR CE1 CZ doub Y N 374 TYR CE1 HE1 sing N N 375 TYR CE2 CZ sing Y N 376 TYR CE2 HE2 sing N N 377 TYR CZ OH sing N N 378 TYR OH HH sing N N 379 TYR OXT HXT sing N N 380 VAL N CA sing N N 381 VAL N H sing N N 382 VAL N H2 sing N N 383 VAL CA C sing N N 384 VAL CA CB sing N N 385 VAL CA HA sing N N 386 VAL C O doub N N 387 VAL C OXT sing N N 388 VAL CB CG1 sing N N 389 VAL CB CG2 sing N N 390 VAL CB HB sing N N 391 VAL CG1 HG11 sing N N 392 VAL CG1 HG12 sing N N 393 VAL CG1 HG13 sing N N 394 VAL CG2 HG21 sing N N 395 VAL CG2 HG22 sing N N 396 VAL CG2 HG23 sing N N 397 VAL OXT HXT sing N N 398 # _pdbx_initial_refinement_model.accession_code 3CWH _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 3KCO _atom_sites.fract_transf_matrix[1][1] 0.010638 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010033 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009722 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C D H N NI O S # loop_