data_3MGJ # _entry.id 3MGJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3MGJ RCSB RCSB058517 WWPDB D_1000058517 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id MjR83a _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3MGJ _pdbx_database_status.recvd_initial_deposition_date 2010-04-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vorobiev, S.' 1 'Neely, H.' 2 'Seetharaman, J.' 3 'Lee, D.' 4 'Patel, D.' 5 'Ciccosanti, C.' 6 'Xiao, R.' 7 'Acton, T.B.' 8 'Everett, J.K.' 9 'Montelione, G.T.' 10 'Hunt, J.F.' 11 'Tong, L.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title 'Crystal structure of the Saccharop_dh_N domain of MJ1480 protein from Methanococcus jannaschii.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Vorobiev, S.' 1 primary 'Neely, H.' 2 primary 'Seetharaman, J.' 3 primary 'Lee, D.' 4 primary 'Patel, D.' 5 primary 'Xiao, R.' 6 primary 'Ciccosanti, C.' 7 primary 'Acton, T.B.' 8 primary 'Everett, J.K.' 9 primary 'Montelione, G.T.' 10 primary 'Hunt, J.F.' 11 primary 'Tong, L.' 12 # _cell.entry_id 3MGJ _cell.length_a 39.370 _cell.length_b 65.395 _cell.length_c 76.929 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3MGJ _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein MJ1480' 14069.513 2 ? ? ? ? 2 water nat water 18.015 31 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)F(MSE)REIELRGHIIDSLILPKVFDKILD(MSE)GGDYKVLEFEIGKRKTDPSYAKILVIGRDERHVDEILNEL RDLGAEIPEIEEVELQPAEKD(MSE)VLPEGFYSTTNHKTFIRFKGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MFMREIELRGHIIDSLILPKVFDKILDMGGDYKVLEFEIGKRKTDPSYAKILVIGRDERHVDEILNELRDLGAEIPEIEE VELQPAEKDMVLPEGFYSTTNHKTFIRFKGLEHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier MjR83a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 PHE n 1 3 MSE n 1 4 ARG n 1 5 GLU n 1 6 ILE n 1 7 GLU n 1 8 LEU n 1 9 ARG n 1 10 GLY n 1 11 HIS n 1 12 ILE n 1 13 ILE n 1 14 ASP n 1 15 SER n 1 16 LEU n 1 17 ILE n 1 18 LEU n 1 19 PRO n 1 20 LYS n 1 21 VAL n 1 22 PHE n 1 23 ASP n 1 24 LYS n 1 25 ILE n 1 26 LEU n 1 27 ASP n 1 28 MSE n 1 29 GLY n 1 30 GLY n 1 31 ASP n 1 32 TYR n 1 33 LYS n 1 34 VAL n 1 35 LEU n 1 36 GLU n 1 37 PHE n 1 38 GLU n 1 39 ILE n 1 40 GLY n 1 41 LYS n 1 42 ARG n 1 43 LYS n 1 44 THR n 1 45 ASP n 1 46 PRO n 1 47 SER n 1 48 TYR n 1 49 ALA n 1 50 LYS n 1 51 ILE n 1 52 LEU n 1 53 VAL n 1 54 ILE n 1 55 GLY n 1 56 ARG n 1 57 ASP n 1 58 GLU n 1 59 ARG n 1 60 HIS n 1 61 VAL n 1 62 ASP n 1 63 GLU n 1 64 ILE n 1 65 LEU n 1 66 ASN n 1 67 GLU n 1 68 LEU n 1 69 ARG n 1 70 ASP n 1 71 LEU n 1 72 GLY n 1 73 ALA n 1 74 GLU n 1 75 ILE n 1 76 PRO n 1 77 GLU n 1 78 ILE n 1 79 GLU n 1 80 GLU n 1 81 VAL n 1 82 GLU n 1 83 LEU n 1 84 GLN n 1 85 PRO n 1 86 ALA n 1 87 GLU n 1 88 LYS n 1 89 ASP n 1 90 MSE n 1 91 VAL n 1 92 LEU n 1 93 PRO n 1 94 GLU n 1 95 GLY n 1 96 PHE n 1 97 TYR n 1 98 SER n 1 99 THR n 1 100 THR n 1 101 ASN n 1 102 HIS n 1 103 LYS n 1 104 THR n 1 105 PHE n 1 106 ILE n 1 107 ARG n 1 108 PHE n 1 109 LYS n 1 110 GLY n 1 111 LEU n 1 112 GLU n 1 113 HIS n 1 114 HIS n 1 115 HIS n 1 116 HIS n 1 117 HIS n 1 118 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Methanococcus jannaschii' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MJ1480 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanocaldococcus jannaschii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2190 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) +Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET 21-23C' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y1480_METJA _struct_ref.pdbx_db_accession Q58875 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MFMREIELRGHIIDSLILPKVFDKILDMGGDYKVLEFEIGKRKTDPSYAKILVIGRDERHVDEILNELRDLGAEIPEIEE VELQPAEKDMVLPEGFYSTTNHKTFIRFKG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3MGJ A 1 ? 110 ? Q58875 1 ? 110 ? 1 110 2 1 3MGJ B 1 ? 110 ? Q58875 1 ? 110 ? 1 110 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3MGJ LEU A 111 ? UNP Q58875 ? ? 'expression tag' 111 1 1 3MGJ GLU A 112 ? UNP Q58875 ? ? 'expression tag' 112 2 1 3MGJ HIS A 113 ? UNP Q58875 ? ? 'expression tag' 113 3 1 3MGJ HIS A 114 ? UNP Q58875 ? ? 'expression tag' 114 4 1 3MGJ HIS A 115 ? UNP Q58875 ? ? 'expression tag' 115 5 1 3MGJ HIS A 116 ? UNP Q58875 ? ? 'expression tag' 116 6 1 3MGJ HIS A 117 ? UNP Q58875 ? ? 'expression tag' 117 7 1 3MGJ HIS A 118 ? UNP Q58875 ? ? 'expression tag' 118 8 2 3MGJ LEU B 111 ? UNP Q58875 ? ? 'expression tag' 111 9 2 3MGJ GLU B 112 ? UNP Q58875 ? ? 'expression tag' 112 10 2 3MGJ HIS B 113 ? UNP Q58875 ? ? 'expression tag' 113 11 2 3MGJ HIS B 114 ? UNP Q58875 ? ? 'expression tag' 114 12 2 3MGJ HIS B 115 ? UNP Q58875 ? ? 'expression tag' 115 13 2 3MGJ HIS B 116 ? UNP Q58875 ? ? 'expression tag' 116 14 2 3MGJ HIS B 117 ? UNP Q58875 ? ? 'expression tag' 117 15 2 3MGJ HIS B 118 ? UNP Q58875 ? ? 'expression tag' 118 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3MGJ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'microbatch under paraffin oil' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pdbx_details '2.21M lithium chloride, 0.1M sodium citrate, pH 4.2 , microbatch under paraffin oil, temperature 291K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.pdbx_collection_date 2010-04-03 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97910 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X6A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X6A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97910 # _reflns.entry_id 3MGJ _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.70 _reflns.number_obs 10472 _reflns.number_all 10525 _reflns.percent_possible_obs 99.5 _reflns.pdbx_Rmerge_I_obs 0.114 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 23.5 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.80 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.605 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.8 _reflns_shell.pdbx_redundancy 7.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1053 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3MGJ _refine.ls_number_reflns_obs 10432 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.89 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.155 _refine.ls_d_res_high 2.703 _refine.ls_percent_reflns_obs 99.34 _refine.ls_R_factor_obs 0.2018 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1992 _refine.ls_R_factor_R_free 0.2549 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.60 _refine.ls_number_reflns_R_free 480 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.400 _refine.solvent_model_param_bsol 59.433 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.38 _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1459 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 31 _refine_hist.number_atoms_total 1490 _refine_hist.d_res_high 2.703 _refine_hist.d_res_low 33.155 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.010 ? ? 1483 'X-RAY DIFFRACTION' ? f_angle_d 1.261 ? ? 1998 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 20.069 ? ? 577 'X-RAY DIFFRACTION' ? f_chiral_restr 0.077 ? ? 226 'X-RAY DIFFRACTION' ? f_plane_restr 0.006 ? ? 263 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 2.7031 3.0940 3312 0.2458 100.00 0.3243 . . 173 . . . . 'X-RAY DIFFRACTION' . 3.0940 3.8971 3336 0.1918 100.00 0.2645 . . 174 . . . . 'X-RAY DIFFRACTION' . 3.8971 33.1570 3304 0.1893 98.00 0.2225 . . 133 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 3MGJ _struct.title ;Crystal structure of the Saccharop_dh_N domain of MJ1480 protein from Methanococcus jannaschii. Northeast Structural Genomics Consortium Target MjR83a. ; _struct.pdbx_descriptor 'Uncharacterized protein MJ1480' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3MGJ _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;Saccharop_dh_N domain, NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, unknown function ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 _struct_biol.details 'Dimer according to aggregation screening' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 16 ? MSE A 28 ? LEU A 16 MSE A 28 1 ? 13 HELX_P HELX_P2 2 ASP A 57 ? ILE A 75 ? ASP A 57 ILE A 75 1 ? 19 HELX_P HELX_P3 3 LEU B 16 ? MSE B 28 ? LEU B 16 MSE B 28 1 ? 13 HELX_P HELX_P4 4 ASP B 57 ? ILE B 75 ? ASP B 57 ILE B 75 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A PHE 2 N ? ? A MSE 1 A PHE 2 1_555 ? ? ? ? ? ? ? 1.322 ? covale2 covale ? ? A PHE 2 C ? ? ? 1_555 A MSE 3 N ? ? A PHE 2 A MSE 3 1_555 ? ? ? ? ? ? ? 1.333 ? covale3 covale ? ? A MSE 3 C ? ? ? 1_555 A ARG 4 N ? ? A MSE 3 A ARG 4 1_555 ? ? ? ? ? ? ? 1.322 ? covale4 covale ? ? A ASP 27 C ? ? ? 1_555 A MSE 28 N ? ? A ASP 27 A MSE 28 1_555 ? ? ? ? ? ? ? 1.330 ? covale5 covale ? ? A MSE 28 C ? ? ? 1_555 A GLY 29 N ? ? A MSE 28 A GLY 29 1_555 ? ? ? ? ? ? ? 1.327 ? covale6 covale ? ? A ASP 89 C ? ? ? 1_555 A MSE 90 N ? ? A ASP 89 A MSE 90 1_555 ? ? ? ? ? ? ? 1.330 ? covale7 covale ? ? A MSE 90 C ? ? ? 1_555 A VAL 91 N ? ? A MSE 90 A VAL 91 1_555 ? ? ? ? ? ? ? 1.327 ? covale8 covale ? ? B MSE 1 C ? ? ? 1_555 B PHE 2 N ? ? B MSE 1 B PHE 2 1_555 ? ? ? ? ? ? ? 1.322 ? covale9 covale ? ? B PHE 2 C ? ? ? 1_555 B MSE 3 N ? ? B PHE 2 B MSE 3 1_555 ? ? ? ? ? ? ? 1.322 ? covale10 covale ? ? B MSE 3 C ? ? ? 1_555 B ARG 4 N ? ? B MSE 3 B ARG 4 1_555 ? ? ? ? ? ? ? 1.331 ? covale11 covale ? ? B ASP 27 C ? ? ? 1_555 B MSE 28 N ? ? B ASP 27 B MSE 28 1_555 ? ? ? ? ? ? ? 1.333 ? covale12 covale ? ? B MSE 28 C ? ? ? 1_555 B GLY 29 N ? ? B MSE 28 B GLY 29 1_555 ? ? ? ? ? ? ? 1.328 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 31 ? GLU A 38 ? ASP A 31 GLU A 38 A 2 SER A 47 ? GLY A 55 ? SER A 47 GLY A 55 A 3 PHE A 2 ? GLY A 10 ? PHE A 2 GLY A 10 A 4 ILE A 78 ? LEU A 83 ? ILE A 78 LEU A 83 B 1 ASP B 31 ? GLU B 38 ? ASP B 31 GLU B 38 B 2 SER B 47 ? GLY B 55 ? SER B 47 GLY B 55 B 3 PHE B 2 ? GLY B 10 ? PHE B 2 GLY B 10 B 4 ILE B 78 ? GLU B 82 ? ILE B 78 GLU B 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 31 ? N ASP A 31 O ILE A 54 ? O ILE A 54 A 2 3 O SER A 47 ? O SER A 47 N GLY A 10 ? N GLY A 10 A 3 4 N GLU A 5 ? N GLU A 5 O LEU A 83 ? O LEU A 83 B 1 2 N LYS B 33 ? N LYS B 33 O LEU B 52 ? O LEU B 52 B 2 3 O GLY B 55 ? O GLY B 55 N PHE B 2 ? N PHE B 2 B 3 4 N ARG B 9 ? N ARG B 9 O GLU B 79 ? O GLU B 79 # _database_PDB_matrix.entry_id 3MGJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3MGJ _atom_sites.fract_transf_matrix[1][1] 0.025400 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015292 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012999 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 MSE 3 3 3 MSE MSE A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 MSE 28 28 28 MSE MSE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 LYS 88 88 88 LYS ALA A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 MSE 90 90 90 MSE MSE A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 TYR 97 97 97 TYR ALA A . n A 1 98 SER 98 98 ? ? ? A . n A 1 99 THR 99 99 ? ? ? A . n A 1 100 THR 100 100 ? ? ? A . n A 1 101 ASN 101 101 ? ? ? A . n A 1 102 HIS 102 102 ? ? ? A . n A 1 103 LYS 103 103 ? ? ? A . n A 1 104 THR 104 104 ? ? ? A . n A 1 105 PHE 105 105 ? ? ? A . n A 1 106 ILE 106 106 ? ? ? A . n A 1 107 ARG 107 107 ? ? ? A . n A 1 108 PHE 108 108 ? ? ? A . n A 1 109 LYS 109 109 ? ? ? A . n A 1 110 GLY 110 110 ? ? ? A . n A 1 111 LEU 111 111 ? ? ? A . n A 1 112 GLU 112 112 ? ? ? A . n A 1 113 HIS 113 113 ? ? ? A . n A 1 114 HIS 114 114 ? ? ? A . n A 1 115 HIS 115 115 ? ? ? A . n A 1 116 HIS 116 116 ? ? ? A . n A 1 117 HIS 117 117 ? ? ? A . n A 1 118 HIS 118 118 ? ? ? A . n B 1 1 MSE 1 1 1 MSE MSE B . n B 1 2 PHE 2 2 2 PHE PHE B . n B 1 3 MSE 3 3 3 MSE MSE B . n B 1 4 ARG 4 4 4 ARG ALA B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 ILE 6 6 6 ILE ILE B . n B 1 7 GLU 7 7 7 GLU GLU B . n B 1 8 LEU 8 8 8 LEU LEU B . n B 1 9 ARG 9 9 9 ARG ARG B . n B 1 10 GLY 10 10 10 GLY GLY B . n B 1 11 HIS 11 11 11 HIS HIS B . n B 1 12 ILE 12 12 12 ILE ILE B . n B 1 13 ILE 13 13 13 ILE ILE B . n B 1 14 ASP 14 14 14 ASP ASP B . n B 1 15 SER 15 15 15 SER SER B . n B 1 16 LEU 16 16 16 LEU LEU B . n B 1 17 ILE 17 17 17 ILE ILE B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 PRO 19 19 19 PRO PRO B . n B 1 20 LYS 20 20 20 LYS LYS B . n B 1 21 VAL 21 21 21 VAL VAL B . n B 1 22 PHE 22 22 22 PHE PHE B . n B 1 23 ASP 23 23 23 ASP ASP B . n B 1 24 LYS 24 24 24 LYS LYS B . n B 1 25 ILE 25 25 25 ILE ILE B . n B 1 26 LEU 26 26 26 LEU LEU B . n B 1 27 ASP 27 27 27 ASP ASP B . n B 1 28 MSE 28 28 28 MSE MSE B . n B 1 29 GLY 29 29 29 GLY GLY B . n B 1 30 GLY 30 30 30 GLY GLY B . n B 1 31 ASP 31 31 31 ASP ASP B . n B 1 32 TYR 32 32 32 TYR TYR B . n B 1 33 LYS 33 33 33 LYS LYS B . n B 1 34 VAL 34 34 34 VAL VAL B . n B 1 35 LEU 35 35 35 LEU LEU B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 PHE 37 37 37 PHE PHE B . n B 1 38 GLU 38 38 38 GLU GLU B . n B 1 39 ILE 39 39 39 ILE ILE B . n B 1 40 GLY 40 40 40 GLY GLY B . n B 1 41 LYS 41 41 41 LYS LYS B . n B 1 42 ARG 42 42 42 ARG ALA B . n B 1 43 LYS 43 43 43 LYS ALA B . n B 1 44 THR 44 44 44 THR THR B . n B 1 45 ASP 45 45 45 ASP ASP B . n B 1 46 PRO 46 46 46 PRO PRO B . n B 1 47 SER 47 47 47 SER SER B . n B 1 48 TYR 48 48 48 TYR TYR B . n B 1 49 ALA 49 49 49 ALA ALA B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 ILE 51 51 51 ILE ILE B . n B 1 52 LEU 52 52 52 LEU LEU B . n B 1 53 VAL 53 53 53 VAL VAL B . n B 1 54 ILE 54 54 54 ILE ILE B . n B 1 55 GLY 55 55 55 GLY GLY B . n B 1 56 ARG 56 56 56 ARG ARG B . n B 1 57 ASP 57 57 57 ASP ASP B . n B 1 58 GLU 58 58 58 GLU GLU B . n B 1 59 ARG 59 59 59 ARG ARG B . n B 1 60 HIS 60 60 60 HIS HIS B . n B 1 61 VAL 61 61 61 VAL VAL B . n B 1 62 ASP 62 62 62 ASP ASP B . n B 1 63 GLU 63 63 63 GLU GLU B . n B 1 64 ILE 64 64 64 ILE ILE B . n B 1 65 LEU 65 65 65 LEU LEU B . n B 1 66 ASN 66 66 66 ASN ASN B . n B 1 67 GLU 67 67 67 GLU GLU B . n B 1 68 LEU 68 68 68 LEU LEU B . n B 1 69 ARG 69 69 69 ARG ARG B . n B 1 70 ASP 70 70 70 ASP ASP B . n B 1 71 LEU 71 71 71 LEU LEU B . n B 1 72 GLY 72 72 72 GLY GLY B . n B 1 73 ALA 73 73 73 ALA ALA B . n B 1 74 GLU 74 74 74 GLU GLU B . n B 1 75 ILE 75 75 75 ILE ILE B . n B 1 76 PRO 76 76 76 PRO PRO B . n B 1 77 GLU 77 77 77 GLU GLU B . n B 1 78 ILE 78 78 78 ILE ILE B . n B 1 79 GLU 79 79 79 GLU GLU B . n B 1 80 GLU 80 80 80 GLU GLU B . n B 1 81 VAL 81 81 81 VAL VAL B . n B 1 82 GLU 82 82 82 GLU GLU B . n B 1 83 LEU 83 83 83 LEU LEU B . n B 1 84 GLN 84 84 84 GLN ALA B . n B 1 85 PRO 85 85 85 PRO PRO B . n B 1 86 ALA 86 86 86 ALA ALA B . n B 1 87 GLU 87 87 ? ? ? B . n B 1 88 LYS 88 88 ? ? ? B . n B 1 89 ASP 89 89 ? ? ? B . n B 1 90 MSE 90 90 ? ? ? B . n B 1 91 VAL 91 91 ? ? ? B . n B 1 92 LEU 92 92 ? ? ? B . n B 1 93 PRO 93 93 ? ? ? B . n B 1 94 GLU 94 94 ? ? ? B . n B 1 95 GLY 95 95 ? ? ? B . n B 1 96 PHE 96 96 ? ? ? B . n B 1 97 TYR 97 97 ? ? ? B . n B 1 98 SER 98 98 ? ? ? B . n B 1 99 THR 99 99 ? ? ? B . n B 1 100 THR 100 100 ? ? ? B . n B 1 101 ASN 101 101 ? ? ? B . n B 1 102 HIS 102 102 ? ? ? B . n B 1 103 LYS 103 103 ? ? ? B . n B 1 104 THR 104 104 ? ? ? B . n B 1 105 PHE 105 105 ? ? ? B . n B 1 106 ILE 106 106 ? ? ? B . n B 1 107 ARG 107 107 ? ? ? B . n B 1 108 PHE 108 108 ? ? ? B . n B 1 109 LYS 109 109 ? ? ? B . n B 1 110 GLY 110 110 ? ? ? B . n B 1 111 LEU 111 111 ? ? ? B . n B 1 112 GLU 112 112 ? ? ? B . n B 1 113 HIS 113 113 ? ? ? B . n B 1 114 HIS 114 114 ? ? ? B . n B 1 115 HIS 115 115 ? ? ? B . n B 1 116 HIS 116 116 ? ? ? B . n B 1 117 HIS 117 117 ? ? ? B . n B 1 118 HIS 118 118 ? ? ? B . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 202 202 HOH WAT A . C 2 HOH 2 204 204 HOH WAT A . C 2 HOH 3 205 205 HOH WAT A . C 2 HOH 4 208 208 HOH WAT A . C 2 HOH 5 209 209 HOH WAT A . C 2 HOH 6 210 210 HOH WAT A . C 2 HOH 7 211 211 HOH WAT A . C 2 HOH 8 213 213 HOH WAT A . C 2 HOH 9 217 217 HOH WAT A . C 2 HOH 10 218 218 HOH WAT A . C 2 HOH 11 219 219 HOH WAT A . C 2 HOH 12 221 221 HOH WAT A . C 2 HOH 13 224 224 HOH WAT A . C 2 HOH 14 225 225 HOH WAT A . C 2 HOH 15 226 226 HOH WAT A . C 2 HOH 16 228 228 HOH WAT A . C 2 HOH 17 229 229 HOH WAT A . C 2 HOH 18 231 231 HOH WAT A . C 2 HOH 19 234 234 HOH WAT A . C 2 HOH 20 236 236 HOH WAT A . D 2 HOH 1 201 201 HOH WAT B . D 2 HOH 2 206 206 HOH WAT B . D 2 HOH 3 212 212 HOH WAT B . D 2 HOH 4 214 214 HOH WAT B . D 2 HOH 5 222 222 HOH WAT B . D 2 HOH 6 223 223 HOH WAT B . D 2 HOH 7 227 227 HOH WAT B . D 2 HOH 8 230 230 HOH WAT B . D 2 HOH 9 232 232 HOH WAT B . D 2 HOH 10 233 233 HOH WAT B . D 2 HOH 11 235 235 HOH WAT B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 3 A MSE 3 ? MET SELENOMETHIONINE 3 A MSE 28 A MSE 28 ? MET SELENOMETHIONINE 4 A MSE 90 A MSE 90 ? MET SELENOMETHIONINE 5 B MSE 1 B MSE 1 ? MET SELENOMETHIONINE 6 B MSE 3 B MSE 3 ? MET SELENOMETHIONINE 7 B MSE 28 B MSE 28 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1370 ? 1 MORE -9 ? 1 'SSA (A^2)' 10440 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-04-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Author supporting evidence' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_struct_assembly_auth_evidence # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -4.8168 61.3411 40.8279 0.2300 0.2303 0.2375 -0.0058 0.0057 0.0224 0.3804 0.6854 1.5698 -0.3014 -0.0302 0.0335 0.0848 -0.0242 0.0287 -0.1086 -0.1360 0.1106 -0.0294 0.1496 0.0702 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 0.1886 0.2333 0.2495 0.0220 -0.0028 -0.0119 1.6108 1.6489 1.6110 0.2222 1.4992 0.7598 0.0502 0.0371 -0.0842 -0.1405 -0.0871 0.2390 -0.1126 -0.2178 0.0511 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details 'chain B' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 SHELXDE phasing . ? 2 PHENIX refinement '(phenix.refine: 1.5_2)' ? 3 DENZO 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 11 ? ? -103.36 66.64 2 1 ASP A 14 ? ? 84.56 8.19 3 1 LYS A 43 ? ? -56.59 -7.97 4 1 LYS B 43 ? ? -70.34 47.74 5 1 THR B 44 ? ? -142.91 -31.29 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 88 ? CG ? A LYS 88 CG 2 1 Y 1 A LYS 88 ? CD ? A LYS 88 CD 3 1 Y 1 A LYS 88 ? CE ? A LYS 88 CE 4 1 Y 1 A LYS 88 ? NZ ? A LYS 88 NZ 5 1 Y 1 A TYR 97 ? CG ? A TYR 97 CG 6 1 Y 1 A TYR 97 ? CD1 ? A TYR 97 CD1 7 1 Y 1 A TYR 97 ? CD2 ? A TYR 97 CD2 8 1 Y 1 A TYR 97 ? CE1 ? A TYR 97 CE1 9 1 Y 1 A TYR 97 ? CE2 ? A TYR 97 CE2 10 1 Y 1 A TYR 97 ? CZ ? A TYR 97 CZ 11 1 Y 1 A TYR 97 ? OH ? A TYR 97 OH 12 1 Y 1 B ARG 4 ? CG ? B ARG 4 CG 13 1 Y 1 B ARG 4 ? CD ? B ARG 4 CD 14 1 Y 1 B ARG 4 ? NE ? B ARG 4 NE 15 1 Y 1 B ARG 4 ? CZ ? B ARG 4 CZ 16 1 Y 1 B ARG 4 ? NH1 ? B ARG 4 NH1 17 1 Y 1 B ARG 4 ? NH2 ? B ARG 4 NH2 18 1 Y 1 B ARG 42 ? CG ? B ARG 42 CG 19 1 Y 1 B ARG 42 ? CD ? B ARG 42 CD 20 1 Y 1 B ARG 42 ? NE ? B ARG 42 NE 21 1 Y 1 B ARG 42 ? CZ ? B ARG 42 CZ 22 1 Y 1 B ARG 42 ? NH1 ? B ARG 42 NH1 23 1 Y 1 B ARG 42 ? NH2 ? B ARG 42 NH2 24 1 Y 1 B LYS 43 ? CG ? B LYS 43 CG 25 1 Y 1 B LYS 43 ? CD ? B LYS 43 CD 26 1 Y 1 B LYS 43 ? CE ? B LYS 43 CE 27 1 Y 1 B LYS 43 ? NZ ? B LYS 43 NZ 28 1 Y 1 B GLN 84 ? CG ? B GLN 84 CG 29 1 Y 1 B GLN 84 ? CD ? B GLN 84 CD 30 1 Y 1 B GLN 84 ? OE1 ? B GLN 84 OE1 31 1 Y 1 B GLN 84 ? NE2 ? B GLN 84 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 98 ? A SER 98 2 1 Y 1 A THR 99 ? A THR 99 3 1 Y 1 A THR 100 ? A THR 100 4 1 Y 1 A ASN 101 ? A ASN 101 5 1 Y 1 A HIS 102 ? A HIS 102 6 1 Y 1 A LYS 103 ? A LYS 103 7 1 Y 1 A THR 104 ? A THR 104 8 1 Y 1 A PHE 105 ? A PHE 105 9 1 Y 1 A ILE 106 ? A ILE 106 10 1 Y 1 A ARG 107 ? A ARG 107 11 1 Y 1 A PHE 108 ? A PHE 108 12 1 Y 1 A LYS 109 ? A LYS 109 13 1 Y 1 A GLY 110 ? A GLY 110 14 1 Y 1 A LEU 111 ? A LEU 111 15 1 Y 1 A GLU 112 ? A GLU 112 16 1 Y 1 A HIS 113 ? A HIS 113 17 1 Y 1 A HIS 114 ? A HIS 114 18 1 Y 1 A HIS 115 ? A HIS 115 19 1 Y 1 A HIS 116 ? A HIS 116 20 1 Y 1 A HIS 117 ? A HIS 117 21 1 Y 1 A HIS 118 ? A HIS 118 22 1 Y 1 B GLU 87 ? B GLU 87 23 1 Y 1 B LYS 88 ? B LYS 88 24 1 Y 1 B ASP 89 ? B ASP 89 25 1 Y 1 B MSE 90 ? B MSE 90 26 1 Y 1 B VAL 91 ? B VAL 91 27 1 Y 1 B LEU 92 ? B LEU 92 28 1 Y 1 B PRO 93 ? B PRO 93 29 1 Y 1 B GLU 94 ? B GLU 94 30 1 Y 1 B GLY 95 ? B GLY 95 31 1 Y 1 B PHE 96 ? B PHE 96 32 1 Y 1 B TYR 97 ? B TYR 97 33 1 Y 1 B SER 98 ? B SER 98 34 1 Y 1 B THR 99 ? B THR 99 35 1 Y 1 B THR 100 ? B THR 100 36 1 Y 1 B ASN 101 ? B ASN 101 37 1 Y 1 B HIS 102 ? B HIS 102 38 1 Y 1 B LYS 103 ? B LYS 103 39 1 Y 1 B THR 104 ? B THR 104 40 1 Y 1 B PHE 105 ? B PHE 105 41 1 Y 1 B ILE 106 ? B ILE 106 42 1 Y 1 B ARG 107 ? B ARG 107 43 1 Y 1 B PHE 108 ? B PHE 108 44 1 Y 1 B LYS 109 ? B LYS 109 45 1 Y 1 B GLY 110 ? B GLY 110 46 1 Y 1 B LEU 111 ? B LEU 111 47 1 Y 1 B GLU 112 ? B GLU 112 48 1 Y 1 B HIS 113 ? B HIS 113 49 1 Y 1 B HIS 114 ? B HIS 114 50 1 Y 1 B HIS 115 ? B HIS 115 51 1 Y 1 B HIS 116 ? B HIS 116 52 1 Y 1 B HIS 117 ? B HIS 117 53 1 Y 1 B HIS 118 ? B HIS 118 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details ? #