data_3PTJ # _entry.id 3PTJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3PTJ pdb_00003ptj 10.2210/pdb3ptj/pdb RCSB RCSB062794 ? ? WWPDB D_1000062794 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-10-26 2 'Structure model' 1 1 2012-01-25 3 'Structure model' 1 2 2014-11-12 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_entry_details 5 4 'Structure model' pdbx_modification_feature 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3PTJ _pdbx_database_status.recvd_initial_deposition_date 2010-12-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3PVH . unspecified PDB 3PW9 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, H.Y.' 1 'Liu, M.S.' 2 'Lin, T.P.' 3 'Cheng, Y.S.' 4 # _citation.id primary _citation.title 'Structural and functional assays of AtTLP18.3 identify its novel acid phosphatase activity in thylakoid lumen' _citation.journal_abbrev 'Plant Physiol.' _citation.journal_volume 157 _citation.page_first 1015 _citation.page_last 1025 _citation.year 2011 _citation.journal_id_ASTM PLPHAY _citation.country US _citation.journal_id_ISSN 0032-0889 _citation.journal_id_CSD 0765 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21908686 _citation.pdbx_database_id_DOI 10.1104/pp.111.184739 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, H.Y.' 1 ? primary 'Liu, M.S.' 2 ? primary 'Lin, T.P.' 3 ? primary 'Cheng, Y.S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'UPF0603 protein At1g54780, chloroplastic' 16779.549 1 ? 'L128M, I159M' 'Phosphatase domain, UNP residues 84-235' ? 2 water nat water 18.015 67 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AtTLP18.3, Thylakoid lumen 18.3 kDa protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SASEFNILNDGPPKETYVVDDAGVLSRVTKSDLKKLLSDLEYRKK(MSE)RLNFITVRKLTSKADAFEYADQVLEKWYPS (MSE)EEGNNKGIVVLITSQKEGAITGGPAFIEAVGENILDATVSENLPVLATDEKYNEAVYSSAKRLVAAIDGQPDPGG P ; _entity_poly.pdbx_seq_one_letter_code_can ;SASEFNILNDGPPKETYVVDDAGVLSRVTKSDLKKLLSDLEYRKKMRLNFITVRKLTSKADAFEYADQVLEKWYPSMEEG NNKGIVVLITSQKEGAITGGPAFIEAVGENILDATVSENLPVLATDEKYNEAVYSSAKRLVAAIDGQPDPGGP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 SER n 1 4 GLU n 1 5 PHE n 1 6 ASN n 1 7 ILE n 1 8 LEU n 1 9 ASN n 1 10 ASP n 1 11 GLY n 1 12 PRO n 1 13 PRO n 1 14 LYS n 1 15 GLU n 1 16 THR n 1 17 TYR n 1 18 VAL n 1 19 VAL n 1 20 ASP n 1 21 ASP n 1 22 ALA n 1 23 GLY n 1 24 VAL n 1 25 LEU n 1 26 SER n 1 27 ARG n 1 28 VAL n 1 29 THR n 1 30 LYS n 1 31 SER n 1 32 ASP n 1 33 LEU n 1 34 LYS n 1 35 LYS n 1 36 LEU n 1 37 LEU n 1 38 SER n 1 39 ASP n 1 40 LEU n 1 41 GLU n 1 42 TYR n 1 43 ARG n 1 44 LYS n 1 45 LYS n 1 46 MSE n 1 47 ARG n 1 48 LEU n 1 49 ASN n 1 50 PHE n 1 51 ILE n 1 52 THR n 1 53 VAL n 1 54 ARG n 1 55 LYS n 1 56 LEU n 1 57 THR n 1 58 SER n 1 59 LYS n 1 60 ALA n 1 61 ASP n 1 62 ALA n 1 63 PHE n 1 64 GLU n 1 65 TYR n 1 66 ALA n 1 67 ASP n 1 68 GLN n 1 69 VAL n 1 70 LEU n 1 71 GLU n 1 72 LYS n 1 73 TRP n 1 74 TYR n 1 75 PRO n 1 76 SER n 1 77 MSE n 1 78 GLU n 1 79 GLU n 1 80 GLY n 1 81 ASN n 1 82 ASN n 1 83 LYS n 1 84 GLY n 1 85 ILE n 1 86 VAL n 1 87 VAL n 1 88 LEU n 1 89 ILE n 1 90 THR n 1 91 SER n 1 92 GLN n 1 93 LYS n 1 94 GLU n 1 95 GLY n 1 96 ALA n 1 97 ILE n 1 98 THR n 1 99 GLY n 1 100 GLY n 1 101 PRO n 1 102 ALA n 1 103 PHE n 1 104 ILE n 1 105 GLU n 1 106 ALA n 1 107 VAL n 1 108 GLY n 1 109 GLU n 1 110 ASN n 1 111 ILE n 1 112 LEU n 1 113 ASP n 1 114 ALA n 1 115 THR n 1 116 VAL n 1 117 SER n 1 118 GLU n 1 119 ASN n 1 120 LEU n 1 121 PRO n 1 122 VAL n 1 123 LEU n 1 124 ALA n 1 125 THR n 1 126 ASP n 1 127 GLU n 1 128 LYS n 1 129 TYR n 1 130 ASN n 1 131 GLU n 1 132 ALA n 1 133 VAL n 1 134 TYR n 1 135 SER n 1 136 SER n 1 137 ALA n 1 138 LYS n 1 139 ARG n 1 140 LEU n 1 141 VAL n 1 142 ALA n 1 143 ALA n 1 144 ILE n 1 145 ASP n 1 146 GLY n 1 147 GLN n 1 148 PRO n 1 149 ASP n 1 150 PRO n 1 151 GLY n 1 152 GLY n 1 153 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'mouse-ear cress,thale-cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'At1g54780, T22H22.19' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'cv. Columbia' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX6P1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 83 83 SER SER A . n A 1 2 ALA 2 84 84 ALA ALA A . n A 1 3 SER 3 85 85 SER SER A . n A 1 4 GLU 4 86 86 GLU GLU A . n A 1 5 PHE 5 87 87 PHE PHE A . n A 1 6 ASN 6 88 88 ASN ASN A . n A 1 7 ILE 7 89 89 ILE ILE A . n A 1 8 LEU 8 90 90 LEU LEU A . n A 1 9 ASN 9 91 91 ASN ASN A . n A 1 10 ASP 10 92 92 ASP ASP A . n A 1 11 GLY 11 93 93 GLY GLY A . n A 1 12 PRO 12 94 94 PRO PRO A . n A 1 13 PRO 13 95 95 PRO PRO A . n A 1 14 LYS 14 96 96 LYS LYS A . n A 1 15 GLU 15 97 97 GLU GLU A . n A 1 16 THR 16 98 98 THR THR A . n A 1 17 TYR 17 99 99 TYR TYR A . n A 1 18 VAL 18 100 100 VAL VAL A . n A 1 19 VAL 19 101 101 VAL VAL A . n A 1 20 ASP 20 102 102 ASP ASP A . n A 1 21 ASP 21 103 103 ASP ASP A . n A 1 22 ALA 22 104 104 ALA ALA A . n A 1 23 GLY 23 105 105 GLY GLY A . n A 1 24 VAL 24 106 106 VAL VAL A . n A 1 25 LEU 25 107 107 LEU LEU A . n A 1 26 SER 26 108 108 SER SER A . n A 1 27 ARG 27 109 109 ARG ARG A . n A 1 28 VAL 28 110 110 VAL VAL A . n A 1 29 THR 29 111 111 THR THR A . n A 1 30 LYS 30 112 112 LYS LYS A . n A 1 31 SER 31 113 113 SER SER A . n A 1 32 ASP 32 114 114 ASP ASP A . n A 1 33 LEU 33 115 115 LEU LEU A . n A 1 34 LYS 34 116 116 LYS LYS A . n A 1 35 LYS 35 117 117 LYS LYS A . n A 1 36 LEU 36 118 118 LEU LEU A . n A 1 37 LEU 37 119 119 LEU LEU A . n A 1 38 SER 38 120 120 SER SER A . n A 1 39 ASP 39 121 121 ASP ASP A . n A 1 40 LEU 40 122 122 LEU LEU A . n A 1 41 GLU 41 123 123 GLU GLU A . n A 1 42 TYR 42 124 124 TYR TYR A . n A 1 43 ARG 43 125 125 ARG ARG A . n A 1 44 LYS 44 126 126 LYS LYS A . n A 1 45 LYS 45 127 127 LYS LYS A . n A 1 46 MSE 46 128 128 MSE MSE A . n A 1 47 ARG 47 129 129 ARG ARG A . n A 1 48 LEU 48 130 130 LEU LEU A . n A 1 49 ASN 49 131 131 ASN ASN A . n A 1 50 PHE 50 132 132 PHE PHE A . n A 1 51 ILE 51 133 133 ILE ILE A . n A 1 52 THR 52 134 134 THR THR A . n A 1 53 VAL 53 135 135 VAL VAL A . n A 1 54 ARG 54 136 136 ARG ARG A . n A 1 55 LYS 55 137 137 LYS LYS A . n A 1 56 LEU 56 138 138 LEU LEU A . n A 1 57 THR 57 139 139 THR THR A . n A 1 58 SER 58 140 140 SER SER A . n A 1 59 LYS 59 141 141 LYS LYS A . n A 1 60 ALA 60 142 142 ALA ALA A . n A 1 61 ASP 61 143 143 ASP ASP A . n A 1 62 ALA 62 144 144 ALA ALA A . n A 1 63 PHE 63 145 145 PHE PHE A . n A 1 64 GLU 64 146 146 GLU GLU A . n A 1 65 TYR 65 147 147 TYR TYR A . n A 1 66 ALA 66 148 148 ALA ALA A . n A 1 67 ASP 67 149 149 ASP ASP A . n A 1 68 GLN 68 150 150 GLN GLN A . n A 1 69 VAL 69 151 151 VAL VAL A . n A 1 70 LEU 70 152 152 LEU LEU A . n A 1 71 GLU 71 153 153 GLU GLU A . n A 1 72 LYS 72 154 154 LYS LYS A . n A 1 73 TRP 73 155 155 TRP TRP A . n A 1 74 TYR 74 156 156 TYR TYR A . n A 1 75 PRO 75 157 157 PRO PRO A . n A 1 76 SER 76 158 158 SER SER A . n A 1 77 MSE 77 159 159 MSE MSE A . n A 1 78 GLU 78 160 160 GLU GLU A . n A 1 79 GLU 79 161 161 GLU GLU A . n A 1 80 GLY 80 162 162 GLY GLY A . n A 1 81 ASN 81 163 163 ASN ASN A . n A 1 82 ASN 82 164 164 ASN ASN A . n A 1 83 LYS 83 165 165 LYS LYS A . n A 1 84 GLY 84 166 166 GLY GLY A . n A 1 85 ILE 85 167 167 ILE ILE A . n A 1 86 VAL 86 168 168 VAL VAL A . n A 1 87 VAL 87 169 169 VAL VAL A . n A 1 88 LEU 88 170 170 LEU LEU A . n A 1 89 ILE 89 171 171 ILE ILE A . n A 1 90 THR 90 172 172 THR THR A . n A 1 91 SER 91 173 173 SER SER A . n A 1 92 GLN 92 174 174 GLN GLN A . n A 1 93 LYS 93 175 175 LYS LYS A . n A 1 94 GLU 94 176 176 GLU GLU A . n A 1 95 GLY 95 177 177 GLY GLY A . n A 1 96 ALA 96 178 178 ALA ALA A . n A 1 97 ILE 97 179 179 ILE ILE A . n A 1 98 THR 98 180 180 THR THR A . n A 1 99 GLY 99 181 181 GLY GLY A . n A 1 100 GLY 100 182 182 GLY GLY A . n A 1 101 PRO 101 183 183 PRO PRO A . n A 1 102 ALA 102 184 184 ALA ALA A . n A 1 103 PHE 103 185 185 PHE PHE A . n A 1 104 ILE 104 186 186 ILE ILE A . n A 1 105 GLU 105 187 187 GLU GLU A . n A 1 106 ALA 106 188 188 ALA ALA A . n A 1 107 VAL 107 189 189 VAL VAL A . n A 1 108 GLY 108 190 190 GLY GLY A . n A 1 109 GLU 109 191 191 GLU GLU A . n A 1 110 ASN 110 192 192 ASN ASN A . n A 1 111 ILE 111 193 193 ILE ILE A . n A 1 112 LEU 112 194 194 LEU LEU A . n A 1 113 ASP 113 195 195 ASP ASP A . n A 1 114 ALA 114 196 196 ALA ALA A . n A 1 115 THR 115 197 197 THR THR A . n A 1 116 VAL 116 198 198 VAL VAL A . n A 1 117 SER 117 199 199 SER SER A . n A 1 118 GLU 118 200 200 GLU GLU A . n A 1 119 ASN 119 201 201 ASN ASN A . n A 1 120 LEU 120 202 202 LEU LEU A . n A 1 121 PRO 121 203 203 PRO PRO A . n A 1 122 VAL 122 204 204 VAL VAL A . n A 1 123 LEU 123 205 205 LEU LEU A . n A 1 124 ALA 124 206 206 ALA ALA A . n A 1 125 THR 125 207 207 THR THR A . n A 1 126 ASP 126 208 208 ASP ASP A . n A 1 127 GLU 127 209 209 GLU GLU A . n A 1 128 LYS 128 210 210 LYS LYS A . n A 1 129 TYR 129 211 211 TYR TYR A . n A 1 130 ASN 130 212 212 ASN ASN A . n A 1 131 GLU 131 213 213 GLU GLU A . n A 1 132 ALA 132 214 214 ALA ALA A . n A 1 133 VAL 133 215 215 VAL VAL A . n A 1 134 TYR 134 216 216 TYR TYR A . n A 1 135 SER 135 217 217 SER SER A . n A 1 136 SER 136 218 218 SER SER A . n A 1 137 ALA 137 219 219 ALA ALA A . n A 1 138 LYS 138 220 220 LYS LYS A . n A 1 139 ARG 139 221 221 ARG ARG A . n A 1 140 LEU 140 222 222 LEU LEU A . n A 1 141 VAL 141 223 223 VAL VAL A . n A 1 142 ALA 142 224 224 ALA ALA A . n A 1 143 ALA 143 225 225 ALA ALA A . n A 1 144 ILE 144 226 226 ILE ILE A . n A 1 145 ASP 145 227 227 ASP ASP A . n A 1 146 GLY 146 228 228 GLY GLY A . n A 1 147 GLN 147 229 229 GLN GLN A . n A 1 148 PRO 148 230 230 PRO PRO A . n A 1 149 ASP 149 231 231 ASP ASP A . n A 1 150 PRO 150 232 232 PRO PRO A . n A 1 151 GLY 151 233 233 GLY GLY A . n A 1 152 GLY 152 234 234 GLY GLY A . n A 1 153 PRO 153 235 235 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 1 1 HOH WAT A . B 2 HOH 2 2 2 HOH WAT A . B 2 HOH 3 3 3 HOH WAT A . B 2 HOH 4 4 4 HOH WAT A . B 2 HOH 5 5 5 HOH WAT A . B 2 HOH 6 6 6 HOH WAT A . B 2 HOH 7 7 7 HOH WAT A . B 2 HOH 8 8 8 HOH WAT A . B 2 HOH 9 9 9 HOH WAT A . B 2 HOH 10 10 10 HOH WAT A . B 2 HOH 11 11 11 HOH WAT A . B 2 HOH 12 12 12 HOH WAT A . B 2 HOH 13 13 13 HOH WAT A . B 2 HOH 14 14 14 HOH WAT A . B 2 HOH 15 15 15 HOH WAT A . B 2 HOH 16 16 16 HOH WAT A . B 2 HOH 17 17 17 HOH WAT A . B 2 HOH 18 18 18 HOH WAT A . B 2 HOH 19 19 19 HOH WAT A . B 2 HOH 20 20 20 HOH WAT A . B 2 HOH 21 21 21 HOH WAT A . B 2 HOH 22 22 22 HOH WAT A . B 2 HOH 23 23 23 HOH WAT A . B 2 HOH 24 24 24 HOH WAT A . B 2 HOH 25 25 25 HOH WAT A . B 2 HOH 26 26 26 HOH WAT A . B 2 HOH 27 27 27 HOH WAT A . B 2 HOH 28 28 28 HOH WAT A . B 2 HOH 29 29 29 HOH WAT A . B 2 HOH 30 30 30 HOH WAT A . B 2 HOH 31 31 31 HOH WAT A . B 2 HOH 32 32 32 HOH WAT A . B 2 HOH 33 33 33 HOH WAT A . B 2 HOH 34 34 34 HOH WAT A . B 2 HOH 35 35 35 HOH WAT A . B 2 HOH 36 36 36 HOH WAT A . B 2 HOH 37 37 37 HOH WAT A . B 2 HOH 38 38 38 HOH WAT A . B 2 HOH 39 39 39 HOH WAT A . B 2 HOH 40 40 40 HOH WAT A . B 2 HOH 41 41 41 HOH WAT A . B 2 HOH 42 42 42 HOH WAT A . B 2 HOH 43 43 43 HOH WAT A . B 2 HOH 44 44 44 HOH WAT A . B 2 HOH 45 45 45 HOH WAT A . B 2 HOH 46 46 46 HOH WAT A . B 2 HOH 47 47 47 HOH WAT A . B 2 HOH 48 48 48 HOH WAT A . B 2 HOH 49 49 49 HOH WAT A . B 2 HOH 50 50 50 HOH WAT A . B 2 HOH 51 51 51 HOH WAT A . B 2 HOH 52 52 52 HOH WAT A . B 2 HOH 53 53 53 HOH WAT A . B 2 HOH 54 54 54 HOH WAT A . B 2 HOH 55 55 55 HOH WAT A . B 2 HOH 56 56 56 HOH WAT A . B 2 HOH 57 57 57 HOH WAT A . B 2 HOH 58 58 58 HOH WAT A . B 2 HOH 59 59 59 HOH WAT A . B 2 HOH 60 60 60 HOH WAT A . B 2 HOH 61 61 61 HOH WAT A . B 2 HOH 62 62 62 HOH WAT A . B 2 HOH 63 63 63 HOH WAT A . B 2 HOH 64 64 64 HOH WAT A . B 2 HOH 65 65 65 HOH WAT A . B 2 HOH 66 66 66 HOH WAT A . B 2 HOH 67 67 67 HOH WAT A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 SOLVE phasing . ? 2 CNS refinement 1.1 ? 3 HKL-2000 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 # _cell.entry_id 3PTJ _cell.length_a 46.977 _cell.length_b 49.839 _cell.length_c 76.672 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3PTJ _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # _exptl.entry_id 3PTJ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_percent_sol 54.01 _exptl_crystal.description 'THE STRUCTURE FACTOR FILE CONTAINS FRIEDEL PAIRS' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_details ;0.2M Sodium acetate trihydrate, 0.1M Sodium cacodylate, 25-30% (w/v) Polyethylene glycol 4000, 2mM TCEP , pH 6.0, VAPOR DIFFUSION, temperature 296K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2008-12-21 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si (111) Double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97884 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSRRC BEAMLINE BL13B1' _diffrn_source.pdbx_synchrotron_site NSRRC _diffrn_source.pdbx_synchrotron_beamline BL13B1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97884 # _reflns.entry_id 3PTJ _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0.00 _reflns.d_resolution_low 30 _reflns.d_resolution_high 2.60 _reflns.number_obs 11594 _reflns.number_all ? _reflns.percent_possible_obs 97.8 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_Rsym_value 0.046 _reflns.pdbx_netI_over_sigmaI 30.8 _reflns.B_iso_Wilson_estimate 33.5 _reflns.pdbx_redundancy 9.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_rejects _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.60 2.69 99.6 0.055 0.062 38.4 10.2 ? 567 ? ? ? ? ? ? ? ? ? ? ? ? ? 1 1 2.69 2.80 99.8 0.060 0.062 38.2 10.2 ? 584 ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 2.80 2.93 99.3 0.057 0.056 39.1 10.2 ? 579 ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 2.93 3.08 99.5 0.048 0.049 40.5 10.1 ? 560 ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 3.08 3.28 99.1 0.044 0.043 45.2 10.2 ? 582 ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 3.28 3.53 98.1 0.045 0.042 41.5 9.9 ? 569 ? ? ? ? ? ? ? ? ? ? ? ? ? 6 1 3.53 3.88 98.1 0.048 0.043 36.4 9.7 ? 579 ? ? ? ? ? ? ? ? ? ? ? ? ? 7 1 3.88 4.44 95.8 0.049 0.045 29.9 9.4 ? 570 ? ? ? ? ? ? ? ? ? ? ? ? ? 8 1 4.44 5.59 95.1 0.044 0.044 26.5 9.2 ? 586 ? ? ? ? ? ? ? ? ? ? ? ? ? 9 1 5.59 30.00 94.4 0.049 0.049 22.9 9.4 ? 621 ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 # _refine.entry_id 3PTJ _refine.ls_number_reflns_obs 10497 _refine.ls_number_reflns_all 10699 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30 _refine.ls_d_res_high 2.60 _refine.ls_percent_reflns_obs 98.1 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.199 _refine.ls_R_factor_R_free 0.269 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 552 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 32.44 _refine.aniso_B[1][1] 0.843 _refine.aniso_B[2][2] -8.148 _refine.aniso_B[3][3] 7.305 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_bsol 36.1400 _refine.solvent_model_param_ksol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'SF file contains Friedel pairs' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3PTJ _refine_analyze.Luzzati_coordinate_error_obs 0.25 _refine_analyze.Luzzati_sigma_a_obs 0.20 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.38 _refine_analyze.Luzzati_sigma_a_free 0.33 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1174 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 67 _refine_hist.number_atoms_total 1241 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 30 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.015 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.6 ? ? ? 'X-RAY DIFFRACTION' ? c_torsion_deg 22.5 ? ? ? 'X-RAY DIFFRACTION' ? c_torsion_impr_deg 1.17 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.429 1.500 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.351 2.000 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.382 2.000 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.473 2.500 ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs 'X-RAY DIFFRACTION' . 2.60 2.72 . 0.211 98.4 0.304 0.035 . 74 . . 1307 . 'X-RAY DIFFRACTION' . 2.72 2.86 . 0.221 98.8 0.369 0.051 . 52 . . 1353 . 'X-RAY DIFFRACTION' . 2.86 3.04 . 0.224 99.5 0.323 0.037 . 78 . . 1307 . 'X-RAY DIFFRACTION' . 3.04 3.27 . 0.194 99.2 0.234 0.028 . 68 . . 1335 . 'X-RAY DIFFRACTION' . 3.27 3.60 . 0.177 97.9 0.236 0.027 . 79 . . 1311 . 'X-RAY DIFFRACTION' . 3.60 4.12 . 0.181 98.2 0.293 0.036 . 65 . . 1318 . 'X-RAY DIFFRACTION' . 4.12 5.19 . 0.183 95.6 0.210 0.024 . 75 . . 1267 . 'X-RAY DIFFRACTION' . 5.19 30.00 . 0.234 97.1 0.308 0.039 . 61 . . 1299 . # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water.top 'X-RAY DIFFRACTION' 3 ion.param ion.top 'X-RAY DIFFRACTION' 4 glycerol.param glycerol.top # _database_PDB_matrix.entry_id 3PTJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 3PTJ _struct.title 'Structural and functional Analysis of Arabidopsis thaliana thylakoid lumen protein AtTLP18.3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3PTJ _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'TAP domain, Rossmann fold, Acid Phosphatase, Arabidopsis thaliana thylakoid lumen, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code U603_ARATH _struct_ref.pdbx_db_accession Q9ZVL6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ASEFNILNDGPPKETYVVDDAGVLSRVTKSDLKKLLSDLEYRKKLRLNFITVRKLTSKADAFEYADQVLEKWYPSIEEGN NKGIVVLITSQKEGAITGGPAFIEAVGENILDATVSENLPVLATDEKYNEAVYSSAKRLVAAIDGQPDPGGP ; _struct_ref.pdbx_align_begin 84 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3PTJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9ZVL6 _struct_ref_seq.db_align_beg 84 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 235 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 84 _struct_ref_seq.pdbx_auth_seq_align_end 235 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3PTJ SER A 1 ? UNP Q9ZVL6 ? ? 'expression tag' 83 1 1 3PTJ MSE A 46 ? UNP Q9ZVL6 LEU 128 'engineered mutation' 128 2 1 3PTJ MSE A 77 ? UNP Q9ZVL6 ILE 159 'engineered mutation' 159 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 1 ? ASP A 10 ? SER A 83 ASP A 92 1 ? 10 HELX_P HELX_P2 2 SER A 26 ? LYS A 45 ? SER A 108 LYS A 127 1 ? 20 HELX_P HELX_P3 3 ASP A 61 ? TYR A 74 ? ASP A 143 TYR A 156 1 ? 14 HELX_P HELX_P4 4 SER A 76 ? ASN A 81 ? SER A 158 ASN A 163 1 ? 6 HELX_P HELX_P5 5 GLY A 100 ? GLY A 108 ? GLY A 182 GLY A 190 1 ? 9 HELX_P HELX_P6 6 GLY A 108 ? GLU A 118 ? GLY A 190 GLU A 200 1 ? 11 HELX_P HELX_P7 7 GLU A 118 ? ASP A 126 ? GLU A 200 ASP A 208 1 ? 9 HELX_P HELX_P8 8 LYS A 128 ? ASP A 145 ? LYS A 210 ASP A 227 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LYS 45 C ? ? ? 1_555 A MSE 46 N ? ? A LYS 127 A MSE 128 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A MSE 46 C ? ? ? 1_555 A ARG 47 N ? ? A MSE 128 A ARG 129 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale3 covale both ? A SER 76 C ? ? ? 1_555 A MSE 77 N ? ? A SER 158 A MSE 159 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? A MSE 77 C ? ? ? 1_555 A GLU 78 N ? ? A MSE 159 A GLU 160 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 46 ? . . . . MSE A 128 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 77 ? . . . . MSE A 159 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 18 ? ASP A 20 ? VAL A 100 ASP A 102 A 2 ARG A 47 ? VAL A 53 ? ARG A 129 VAL A 135 A 3 LYS A 83 ? ILE A 89 ? LYS A 165 ILE A 171 A 4 GLU A 94 ? GLY A 99 ? GLU A 176 GLY A 181 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 19 ? N VAL A 101 O THR A 52 ? O THR A 134 A 2 3 N ASN A 49 ? N ASN A 131 O GLY A 84 ? O GLY A 166 A 3 4 N ILE A 89 ? N ILE A 171 O GLU A 94 ? O GLU A 176 # _pdbx_entry_details.entry_id 3PTJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 92 ? ? -88.48 37.30 2 1 ASP A 102 ? ? -91.94 56.74 3 1 PRO A 157 ? ? -57.83 1.77 4 1 GLU A 200 ? ? -115.50 -85.19 5 1 LYS A 210 ? ? -104.36 61.08 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 46 A MSE 128 ? MET SELENOMETHIONINE 2 A MSE 77 A MSE 159 ? MET SELENOMETHIONINE # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 ILE N N N N 126 ILE CA C N S 127 ILE C C N N 128 ILE O O N N 129 ILE CB C N S 130 ILE CG1 C N N 131 ILE CG2 C N N 132 ILE CD1 C N N 133 ILE OXT O N N 134 ILE H H N N 135 ILE H2 H N N 136 ILE HA H N N 137 ILE HB H N N 138 ILE HG12 H N N 139 ILE HG13 H N N 140 ILE HG21 H N N 141 ILE HG22 H N N 142 ILE HG23 H N N 143 ILE HD11 H N N 144 ILE HD12 H N N 145 ILE HD13 H N N 146 ILE HXT H N N 147 LEU N N N N 148 LEU CA C N S 149 LEU C C N N 150 LEU O O N N 151 LEU CB C N N 152 LEU CG C N N 153 LEU CD1 C N N 154 LEU CD2 C N N 155 LEU OXT O N N 156 LEU H H N N 157 LEU H2 H N N 158 LEU HA H N N 159 LEU HB2 H N N 160 LEU HB3 H N N 161 LEU HG H N N 162 LEU HD11 H N N 163 LEU HD12 H N N 164 LEU HD13 H N N 165 LEU HD21 H N N 166 LEU HD22 H N N 167 LEU HD23 H N N 168 LEU HXT H N N 169 LYS N N N N 170 LYS CA C N S 171 LYS C C N N 172 LYS O O N N 173 LYS CB C N N 174 LYS CG C N N 175 LYS CD C N N 176 LYS CE C N N 177 LYS NZ N N N 178 LYS OXT O N N 179 LYS H H N N 180 LYS H2 H N N 181 LYS HA H N N 182 LYS HB2 H N N 183 LYS HB3 H N N 184 LYS HG2 H N N 185 LYS HG3 H N N 186 LYS HD2 H N N 187 LYS HD3 H N N 188 LYS HE2 H N N 189 LYS HE3 H N N 190 LYS HZ1 H N N 191 LYS HZ2 H N N 192 LYS HZ3 H N N 193 LYS HXT H N N 194 MSE N N N N 195 MSE CA C N S 196 MSE C C N N 197 MSE O O N N 198 MSE OXT O N N 199 MSE CB C N N 200 MSE CG C N N 201 MSE SE SE N N 202 MSE CE C N N 203 MSE H H N N 204 MSE H2 H N N 205 MSE HA H N N 206 MSE HXT H N N 207 MSE HB2 H N N 208 MSE HB3 H N N 209 MSE HG2 H N N 210 MSE HG3 H N N 211 MSE HE1 H N N 212 MSE HE2 H N N 213 MSE HE3 H N N 214 PHE N N N N 215 PHE CA C N S 216 PHE C C N N 217 PHE O O N N 218 PHE CB C N N 219 PHE CG C Y N 220 PHE CD1 C Y N 221 PHE CD2 C Y N 222 PHE CE1 C Y N 223 PHE CE2 C Y N 224 PHE CZ C Y N 225 PHE OXT O N N 226 PHE H H N N 227 PHE H2 H N N 228 PHE HA H N N 229 PHE HB2 H N N 230 PHE HB3 H N N 231 PHE HD1 H N N 232 PHE HD2 H N N 233 PHE HE1 H N N 234 PHE HE2 H N N 235 PHE HZ H N N 236 PHE HXT H N N 237 PRO N N N N 238 PRO CA C N S 239 PRO C C N N 240 PRO O O N N 241 PRO CB C N N 242 PRO CG C N N 243 PRO CD C N N 244 PRO OXT O N N 245 PRO H H N N 246 PRO HA H N N 247 PRO HB2 H N N 248 PRO HB3 H N N 249 PRO HG2 H N N 250 PRO HG3 H N N 251 PRO HD2 H N N 252 PRO HD3 H N N 253 PRO HXT H N N 254 SER N N N N 255 SER CA C N S 256 SER C C N N 257 SER O O N N 258 SER CB C N N 259 SER OG O N N 260 SER OXT O N N 261 SER H H N N 262 SER H2 H N N 263 SER HA H N N 264 SER HB2 H N N 265 SER HB3 H N N 266 SER HG H N N 267 SER HXT H N N 268 THR N N N N 269 THR CA C N S 270 THR C C N N 271 THR O O N N 272 THR CB C N R 273 THR OG1 O N N 274 THR CG2 C N N 275 THR OXT O N N 276 THR H H N N 277 THR H2 H N N 278 THR HA H N N 279 THR HB H N N 280 THR HG1 H N N 281 THR HG21 H N N 282 THR HG22 H N N 283 THR HG23 H N N 284 THR HXT H N N 285 TRP N N N N 286 TRP CA C N S 287 TRP C C N N 288 TRP O O N N 289 TRP CB C N N 290 TRP CG C Y N 291 TRP CD1 C Y N 292 TRP CD2 C Y N 293 TRP NE1 N Y N 294 TRP CE2 C Y N 295 TRP CE3 C Y N 296 TRP CZ2 C Y N 297 TRP CZ3 C Y N 298 TRP CH2 C Y N 299 TRP OXT O N N 300 TRP H H N N 301 TRP H2 H N N 302 TRP HA H N N 303 TRP HB2 H N N 304 TRP HB3 H N N 305 TRP HD1 H N N 306 TRP HE1 H N N 307 TRP HE3 H N N 308 TRP HZ2 H N N 309 TRP HZ3 H N N 310 TRP HH2 H N N 311 TRP HXT H N N 312 TYR N N N N 313 TYR CA C N S 314 TYR C C N N 315 TYR O O N N 316 TYR CB C N N 317 TYR CG C Y N 318 TYR CD1 C Y N 319 TYR CD2 C Y N 320 TYR CE1 C Y N 321 TYR CE2 C Y N 322 TYR CZ C Y N 323 TYR OH O N N 324 TYR OXT O N N 325 TYR H H N N 326 TYR H2 H N N 327 TYR HA H N N 328 TYR HB2 H N N 329 TYR HB3 H N N 330 TYR HD1 H N N 331 TYR HD2 H N N 332 TYR HE1 H N N 333 TYR HE2 H N N 334 TYR HH H N N 335 TYR HXT H N N 336 VAL N N N N 337 VAL CA C N S 338 VAL C C N N 339 VAL O O N N 340 VAL CB C N N 341 VAL CG1 C N N 342 VAL CG2 C N N 343 VAL OXT O N N 344 VAL H H N N 345 VAL H2 H N N 346 VAL HA H N N 347 VAL HB H N N 348 VAL HG11 H N N 349 VAL HG12 H N N 350 VAL HG13 H N N 351 VAL HG21 H N N 352 VAL HG22 H N N 353 VAL HG23 H N N 354 VAL HXT H N N 355 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MSE N CA sing N N 184 MSE N H sing N N 185 MSE N H2 sing N N 186 MSE CA C sing N N 187 MSE CA CB sing N N 188 MSE CA HA sing N N 189 MSE C O doub N N 190 MSE C OXT sing N N 191 MSE OXT HXT sing N N 192 MSE CB CG sing N N 193 MSE CB HB2 sing N N 194 MSE CB HB3 sing N N 195 MSE CG SE sing N N 196 MSE CG HG2 sing N N 197 MSE CG HG3 sing N N 198 MSE SE CE sing N N 199 MSE CE HE1 sing N N 200 MSE CE HE2 sing N N 201 MSE CE HE3 sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 TRP N CA sing N N 272 TRP N H sing N N 273 TRP N H2 sing N N 274 TRP CA C sing N N 275 TRP CA CB sing N N 276 TRP CA HA sing N N 277 TRP C O doub N N 278 TRP C OXT sing N N 279 TRP CB CG sing N N 280 TRP CB HB2 sing N N 281 TRP CB HB3 sing N N 282 TRP CG CD1 doub Y N 283 TRP CG CD2 sing Y N 284 TRP CD1 NE1 sing Y N 285 TRP CD1 HD1 sing N N 286 TRP CD2 CE2 doub Y N 287 TRP CD2 CE3 sing Y N 288 TRP NE1 CE2 sing Y N 289 TRP NE1 HE1 sing N N 290 TRP CE2 CZ2 sing Y N 291 TRP CE3 CZ3 doub Y N 292 TRP CE3 HE3 sing N N 293 TRP CZ2 CH2 doub Y N 294 TRP CZ2 HZ2 sing N N 295 TRP CZ3 CH2 sing Y N 296 TRP CZ3 HZ3 sing N N 297 TRP CH2 HH2 sing N N 298 TRP OXT HXT sing N N 299 TYR N CA sing N N 300 TYR N H sing N N 301 TYR N H2 sing N N 302 TYR CA C sing N N 303 TYR CA CB sing N N 304 TYR CA HA sing N N 305 TYR C O doub N N 306 TYR C OXT sing N N 307 TYR CB CG sing N N 308 TYR CB HB2 sing N N 309 TYR CB HB3 sing N N 310 TYR CG CD1 doub Y N 311 TYR CG CD2 sing Y N 312 TYR CD1 CE1 sing Y N 313 TYR CD1 HD1 sing N N 314 TYR CD2 CE2 doub Y N 315 TYR CD2 HD2 sing N N 316 TYR CE1 CZ doub Y N 317 TYR CE1 HE1 sing N N 318 TYR CE2 CZ sing Y N 319 TYR CE2 HE2 sing N N 320 TYR CZ OH sing N N 321 TYR OH HH sing N N 322 TYR OXT HXT sing N N 323 VAL N CA sing N N 324 VAL N H sing N N 325 VAL N H2 sing N N 326 VAL CA C sing N N 327 VAL CA CB sing N N 328 VAL CA HA sing N N 329 VAL C O doub N N 330 VAL C OXT sing N N 331 VAL CB CG1 sing N N 332 VAL CB CG2 sing N N 333 VAL CB HB sing N N 334 VAL CG1 HG11 sing N N 335 VAL CG1 HG12 sing N N 336 VAL CG1 HG13 sing N N 337 VAL CG2 HG21 sing N N 338 VAL CG2 HG22 sing N N 339 VAL CG2 HG23 sing N N 340 VAL OXT HXT sing N N 341 # _atom_sites.entry_id 3PTJ _atom_sites.fract_transf_matrix[1][1] 0.021287 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020065 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013043 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_