data_3QPT # _entry.id 3QPT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3QPT RCSB RCSB063950 WWPDB D_1000063950 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3Q5F _pdbx_database_related.details 'Crystal structure of the Salmonella transcriptional regulator SlyA in complex with DNA' _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3QPT _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-02-14 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dolan, K.T.' 1 'Duguid, E.M.' 2 # _citation.id primary _citation.title 'Crystal Structures of SlyA Protein, a Master Virulence Regulator of Salmonella, in Free and DNA-bound States.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 286 _citation.page_first 22178 _citation.page_last 22185 _citation.year 2011 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21550983 _citation.pdbx_database_id_DOI 10.1074/jbc.M111.245258 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Dolan, K.T.' 1 primary 'Duguid, E.M.' 2 primary 'He, C.' 3 # _cell.entry_id 3QPT _cell.length_a 50.686 _cell.length_b 50.686 _cell.length_c 173.584 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3QPT _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional regulator slyA' 16902.074 1 ? ? ? ? 2 water nat water 18.015 16 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytolysin slyA, Salmolysin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNA(MSE)ESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDK GLISRQTCASDRRAKRIKLTEKAEPLIAE(MSE)EEVIHKTRGEILAGISSEEIELLIKLIAKLEHNI(MSE)ELHSHD ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLIS RQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHSHD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MSE n 1 5 GLU n 1 6 SER n 1 7 PRO n 1 8 LEU n 1 9 GLY n 1 10 SER n 1 11 ASP n 1 12 LEU n 1 13 ALA n 1 14 ARG n 1 15 LEU n 1 16 VAL n 1 17 ARG n 1 18 ILE n 1 19 TRP n 1 20 ARG n 1 21 ALA n 1 22 LEU n 1 23 ILE n 1 24 ASP n 1 25 HIS n 1 26 ARG n 1 27 LEU n 1 28 LYS n 1 29 PRO n 1 30 LEU n 1 31 GLU n 1 32 LEU n 1 33 THR n 1 34 GLN n 1 35 THR n 1 36 HIS n 1 37 TRP n 1 38 VAL n 1 39 THR n 1 40 LEU n 1 41 HIS n 1 42 ASN n 1 43 ILE n 1 44 HIS n 1 45 GLN n 1 46 LEU n 1 47 PRO n 1 48 PRO n 1 49 ASP n 1 50 GLN n 1 51 SER n 1 52 GLN n 1 53 ILE n 1 54 GLN n 1 55 LEU n 1 56 ALA n 1 57 LYS n 1 58 ALA n 1 59 ILE n 1 60 GLY n 1 61 ILE n 1 62 GLU n 1 63 GLN n 1 64 PRO n 1 65 SER n 1 66 LEU n 1 67 VAL n 1 68 ARG n 1 69 THR n 1 70 LEU n 1 71 ASP n 1 72 GLN n 1 73 LEU n 1 74 GLU n 1 75 ASP n 1 76 LYS n 1 77 GLY n 1 78 LEU n 1 79 ILE n 1 80 SER n 1 81 ARG n 1 82 GLN n 1 83 THR n 1 84 CYS n 1 85 ALA n 1 86 SER n 1 87 ASP n 1 88 ARG n 1 89 ARG n 1 90 ALA n 1 91 LYS n 1 92 ARG n 1 93 ILE n 1 94 LYS n 1 95 LEU n 1 96 THR n 1 97 GLU n 1 98 LYS n 1 99 ALA n 1 100 GLU n 1 101 PRO n 1 102 LEU n 1 103 ILE n 1 104 ALA n 1 105 GLU n 1 106 MSE n 1 107 GLU n 1 108 GLU n 1 109 VAL n 1 110 ILE n 1 111 HIS n 1 112 LYS n 1 113 THR n 1 114 ARG n 1 115 GLY n 1 116 GLU n 1 117 ILE n 1 118 LEU n 1 119 ALA n 1 120 GLY n 1 121 ILE n 1 122 SER n 1 123 SER n 1 124 GLU n 1 125 GLU n 1 126 ILE n 1 127 GLU n 1 128 LEU n 1 129 LEU n 1 130 ILE n 1 131 LYS n 1 132 LEU n 1 133 ILE n 1 134 ALA n 1 135 LYS n 1 136 LEU n 1 137 GLU n 1 138 HIS n 1 139 ASN n 1 140 ILE n 1 141 MSE n 1 142 GLU n 1 143 LEU n 1 144 HIS n 1 145 SER n 1 146 HIS n 1 147 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'slyA, STM1444' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'subsp. enterica serovar Typhimurium' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella enterica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 90371 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG19 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SLYA_SALTY _struct_ref.pdbx_db_accession P40676 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQT CASDRRAKRIKLTEKADALIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHSHD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3QPT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P40676 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 144 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 144 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3QPT SER A 1 ? UNP P40676 ? ? 'EXPRESSION TAG' -2 1 1 3QPT ASN A 2 ? UNP P40676 ? ? 'EXPRESSION TAG' -1 2 1 3QPT ALA A 3 ? UNP P40676 ? ? 'EXPRESSION TAG' 0 3 1 3QPT GLU A 100 ? UNP P40676 ASP 97 'SEE REMARK 999' 97 4 1 3QPT PRO A 101 ? UNP P40676 ALA 98 'SEE REMARK 999' 98 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3QPT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.90 _exptl_crystal.density_percent_sol 35.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3QPT _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 2.200 _reflns.number_obs 6928 _reflns.number_all ? _reflns.percent_possible_obs 94.000 _reflns.pdbx_Rmerge_I_obs 0.096 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.400 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 10.800 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.200 2.240 58.200 0.713 ? ? 3.300 ? ? ? ? ? ? 1 1 2.240 2.280 63.900 0.400 ? ? 4.000 ? ? ? ? ? ? 2 1 2.280 2.320 78.000 0.496 ? ? 4.400 ? ? ? ? ? ? 3 1 2.320 2.370 88.100 0.496 ? ? 5.000 ? ? ? ? ? ? 4 1 2.370 2.420 90.400 0.410 ? ? 6.200 ? ? ? ? ? ? 5 1 2.420 2.480 97.400 0.401 ? ? 7.200 ? ? ? ? ? ? 6 1 2.480 2.540 100.000 0.364 ? ? 8.300 ? ? ? ? ? ? 7 1 2.540 2.610 100.000 0.321 ? ? 9.800 ? ? ? ? ? ? 8 1 2.610 2.690 100.000 0.324 ? ? 11.200 ? ? ? ? ? ? 9 1 2.690 2.770 100.000 0.263 ? ? 11.900 ? ? ? ? ? ? 10 1 2.770 2.870 100.000 0.253 ? ? 12.900 ? ? ? ? ? ? 11 1 2.870 2.990 100.000 0.231 ? ? 14.000 ? ? ? ? ? ? 12 1 2.990 3.120 100.000 0.204 ? ? 14.500 ? ? ? ? ? ? 13 1 3.120 3.290 100.000 0.146 ? ? 14.500 ? ? ? ? ? ? 14 1 3.290 3.490 100.000 0.116 ? ? 14.500 ? ? ? ? ? ? 15 1 3.490 3.760 100.000 0.094 ? ? 14.200 ? ? ? ? ? ? 16 1 3.760 4.140 100.000 0.080 ? ? 13.800 ? ? ? ? ? ? 17 1 4.140 4.740 100.000 0.062 ? ? 13.300 ? ? ? ? ? ? 18 1 4.740 5.970 100.000 0.066 ? ? 13.100 ? ? ? ? ? ? 19 1 5.970 50.000 97.500 0.050 ? ? 11.000 ? ? ? ? ? ? 20 1 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3QPT _refine.ls_number_reflns_obs 5435 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.17 _refine.ls_d_res_high 2.40 _refine.ls_percent_reflns_obs 99.56 _refine.ls_R_factor_obs 0.23736 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.23583 _refine.ls_R_factor_R_free 0.27126 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.5 _refine.ls_number_reflns_R_free 255 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min 0.500 _refine.occupancy_max 1.000 _refine.correlation_coeff_Fo_to_Fc 0.927 _refine.correlation_coeff_Fo_to_Fc_free 0.911 _refine.B_iso_mean 48.853 _refine.aniso_B[1][1] 1.92 _refine.aniso_B[2][2] 1.92 _refine.aniso_B[3][3] -2.88 _refine.aniso_B[1][2] 0.96 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.581 _refine.pdbx_overall_ESU_R_Free 0.297 _refine.overall_SU_ML 0.220 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 22.383 _refine.overall_SU_R_Cruickshank_DPI 0.5865 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1065 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 1081 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 39.17 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.022 ? 1092 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.771 1.987 ? 1476 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.344 5.000 ? 134 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 42.168 24.468 ? 47 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 20.989 15.000 ? 226 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 21.057 15.000 ? 8 'X-RAY DIFFRACTION' ? r_chiral_restr 0.100 0.200 ? 179 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.021 ? 772 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.689 1.500 ? 664 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.403 2.000 ? 1081 'X-RAY DIFFRACTION' ? r_scbond_it 2.570 3.000 ? 428 'X-RAY DIFFRACTION' ? r_scangle_it 4.392 4.500 ? 393 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.400 _refine_ls_shell.d_res_low 2.462 _refine_ls_shell.number_reflns_R_work 353 _refine_ls_shell.R_factor_R_work 0.277 _refine_ls_shell.percent_reflns_obs 94.83 _refine_ls_shell.R_factor_R_free 0.260 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 14 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 3QPT _struct.title 'Crystal structure of the Salmonella transcriptional regulator SlyA' _struct.pdbx_descriptor 'Transcriptional regulator slyA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3QPT _struct_keywords.text 'MarR/SlyA protein family, winged helix-turn-helix, transcriptonal regulator, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 8 ? LEU A 27 ? LEU A 5 LEU A 24 1 ? 20 HELX_P HELX_P2 2 LYS A 28 ? GLU A 31 ? LYS A 25 GLU A 28 5 ? 4 HELX_P HELX_P3 3 THR A 33 ? LEU A 46 ? THR A 30 LEU A 43 1 ? 14 HELX_P HELX_P4 4 SER A 51 ? GLY A 60 ? SER A 48 GLY A 57 1 ? 10 HELX_P HELX_P5 5 GLU A 62 ? ASP A 75 ? GLU A 59 ASP A 72 1 ? 14 HELX_P HELX_P6 6 LYS A 98 ? LEU A 118 ? LYS A 95 LEU A 115 1 ? 21 HELX_P HELX_P7 7 SER A 122 ? HIS A 146 ? SER A 119 HIS A 143 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A GLU 105 C ? ? ? 1_555 A MSE 106 N ? ? A GLU 102 A MSE 103 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale ? ? A MSE 106 C ? ? ? 1_555 A GLU 107 N ? ? A MSE 103 A GLU 104 1_555 ? ? ? ? ? ? ? 1.326 ? covale3 covale ? ? A ILE 140 C ? ? ? 1_555 A MSE 141 N ? ? A ILE 137 A MSE 138 1_555 ? ? ? ? ? ? ? 1.327 ? covale4 covale ? ? A MSE 141 C ? ? ? 1_555 A GLU 142 N ? ? A MSE 138 A GLU 139 1_555 ? ? ? ? ? ? ? 1.336 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 79 ? SER A 80 ? ILE A 76 SER A 77 A 2 LYS A 94 ? LEU A 95 ? LYS A 91 LEU A 92 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id SER _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 80 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id SER _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 77 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 94 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 91 # _atom_sites.entry_id 3QPT _atom_sites.fract_transf_matrix[1][1] 0.019729 _atom_sites.fract_transf_matrix[1][2] 0.011391 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022781 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005761 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 ? ? ? A . n A 1 4 MSE 4 1 ? ? ? A . n A 1 5 GLU 5 2 ? ? ? A . n A 1 6 SER 6 3 ? ? ? A . n A 1 7 PRO 7 4 ? ? ? A . n A 1 8 LEU 8 5 5 LEU LEU A . n A 1 9 GLY 9 6 6 GLY GLY A . n A 1 10 SER 10 7 7 SER SER A . n A 1 11 ASP 11 8 8 ASP ASP A . n A 1 12 LEU 12 9 9 LEU LEU A . n A 1 13 ALA 13 10 10 ALA ALA A . n A 1 14 ARG 14 11 11 ARG ARG A . n A 1 15 LEU 15 12 12 LEU LEU A . n A 1 16 VAL 16 13 13 VAL VAL A . n A 1 17 ARG 17 14 14 ARG ARG A . n A 1 18 ILE 18 15 15 ILE ILE A . n A 1 19 TRP 19 16 16 TRP TRP A . n A 1 20 ARG 20 17 17 ARG ARG A . n A 1 21 ALA 21 18 18 ALA ALA A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 ILE 23 20 20 ILE ILE A . n A 1 24 ASP 24 21 21 ASP ASP A . n A 1 25 HIS 25 22 22 HIS HIS A . n A 1 26 ARG 26 23 23 ARG ARG A . n A 1 27 LEU 27 24 24 LEU LEU A . n A 1 28 LYS 28 25 25 LYS LYS A . n A 1 29 PRO 29 26 26 PRO PRO A . n A 1 30 LEU 30 27 27 LEU LEU A . n A 1 31 GLU 31 28 28 GLU GLU A . n A 1 32 LEU 32 29 29 LEU LEU A . n A 1 33 THR 33 30 30 THR THR A . n A 1 34 GLN 34 31 31 GLN GLN A . n A 1 35 THR 35 32 32 THR THR A . n A 1 36 HIS 36 33 33 HIS HIS A . n A 1 37 TRP 37 34 34 TRP TRP A . n A 1 38 VAL 38 35 35 VAL VAL A . n A 1 39 THR 39 36 36 THR THR A . n A 1 40 LEU 40 37 37 LEU LEU A . n A 1 41 HIS 41 38 38 HIS HIS A . n A 1 42 ASN 42 39 39 ASN ASN A . n A 1 43 ILE 43 40 40 ILE ILE A . n A 1 44 HIS 44 41 41 HIS HIS A . n A 1 45 GLN 45 42 42 GLN GLN A . n A 1 46 LEU 46 43 43 LEU LEU A . n A 1 47 PRO 47 44 44 PRO PRO A . n A 1 48 PRO 48 45 45 PRO PRO A . n A 1 49 ASP 49 46 46 ASP ASP A . n A 1 50 GLN 50 47 47 GLN GLN A . n A 1 51 SER 51 48 48 SER SER A . n A 1 52 GLN 52 49 49 GLN GLN A . n A 1 53 ILE 53 50 50 ILE ILE A . n A 1 54 GLN 54 51 51 GLN GLN A . n A 1 55 LEU 55 52 52 LEU LEU A . n A 1 56 ALA 56 53 53 ALA ALA A . n A 1 57 LYS 57 54 54 LYS LYS A . n A 1 58 ALA 58 55 55 ALA ALA A . n A 1 59 ILE 59 56 56 ILE ILE A . n A 1 60 GLY 60 57 57 GLY GLY A . n A 1 61 ILE 61 58 58 ILE ILE A . n A 1 62 GLU 62 59 59 GLU GLU A . n A 1 63 GLN 63 60 60 GLN GLN A . n A 1 64 PRO 64 61 61 PRO PRO A . n A 1 65 SER 65 62 62 SER SER A . n A 1 66 LEU 66 63 63 LEU LEU A . n A 1 67 VAL 67 64 64 VAL VAL A . n A 1 68 ARG 68 65 65 ARG ARG A . n A 1 69 THR 69 66 66 THR THR A . n A 1 70 LEU 70 67 67 LEU LEU A . n A 1 71 ASP 71 68 68 ASP ASP A . n A 1 72 GLN 72 69 69 GLN GLN A . n A 1 73 LEU 73 70 70 LEU LEU A . n A 1 74 GLU 74 71 71 GLU GLU A . n A 1 75 ASP 75 72 72 ASP ASP A . n A 1 76 LYS 76 73 73 LYS LYS A . n A 1 77 GLY 77 74 74 GLY GLY A . n A 1 78 LEU 78 75 75 LEU LEU A . n A 1 79 ILE 79 76 76 ILE ILE A . n A 1 80 SER 80 77 77 SER SER A . n A 1 81 ARG 81 78 78 ARG ARG A . n A 1 82 GLN 82 79 79 GLN GLN A . n A 1 83 THR 83 80 80 THR THR A . n A 1 84 CYS 84 81 ? ? ? A . n A 1 85 ALA 85 82 ? ? ? A . n A 1 86 SER 86 83 ? ? ? A . n A 1 87 ASP 87 84 ? ? ? A . n A 1 88 ARG 88 85 ? ? ? A . n A 1 89 ARG 89 86 ? ? ? A . n A 1 90 ALA 90 87 ? ? ? A . n A 1 91 LYS 91 88 88 LYS LYS A . n A 1 92 ARG 92 89 89 ARG ARG A . n A 1 93 ILE 93 90 90 ILE ILE A . n A 1 94 LYS 94 91 91 LYS LYS A . n A 1 95 LEU 95 92 92 LEU LEU A . n A 1 96 THR 96 93 93 THR THR A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 LYS 98 95 95 LYS LYS A . n A 1 99 ALA 99 96 96 ALA ALA A . n A 1 100 GLU 100 97 97 GLU GLU A . n A 1 101 PRO 101 98 98 PRO PRO A . n A 1 102 LEU 102 99 99 LEU LEU A . n A 1 103 ILE 103 100 100 ILE ILE A . n A 1 104 ALA 104 101 101 ALA ALA A . n A 1 105 GLU 105 102 102 GLU GLU A . n A 1 106 MSE 106 103 103 MSE MSE A . n A 1 107 GLU 107 104 104 GLU GLU A . n A 1 108 GLU 108 105 105 GLU GLU A . n A 1 109 VAL 109 106 106 VAL VAL A . n A 1 110 ILE 110 107 107 ILE ILE A . n A 1 111 HIS 111 108 108 HIS HIS A . n A 1 112 LYS 112 109 109 LYS LYS A . n A 1 113 THR 113 110 110 THR THR A . n A 1 114 ARG 114 111 111 ARG ARG A . n A 1 115 GLY 115 112 112 GLY GLY A . n A 1 116 GLU 116 113 113 GLU GLU A . n A 1 117 ILE 117 114 114 ILE ILE A . n A 1 118 LEU 118 115 115 LEU LEU A . n A 1 119 ALA 119 116 116 ALA ALA A . n A 1 120 GLY 120 117 117 GLY GLY A . n A 1 121 ILE 121 118 118 ILE ILE A . n A 1 122 SER 122 119 119 SER SER A . n A 1 123 SER 123 120 120 SER SER A . n A 1 124 GLU 124 121 121 GLU GLU A . n A 1 125 GLU 125 122 122 GLU GLU A . n A 1 126 ILE 126 123 123 ILE ILE A . n A 1 127 GLU 127 124 124 GLU GLU A . n A 1 128 LEU 128 125 125 LEU LEU A . n A 1 129 LEU 129 126 126 LEU LEU A . n A 1 130 ILE 130 127 127 ILE ILE A . n A 1 131 LYS 131 128 128 LYS LYS A . n A 1 132 LEU 132 129 129 LEU LEU A . n A 1 133 ILE 133 130 130 ILE ILE A . n A 1 134 ALA 134 131 131 ALA ALA A . n A 1 135 LYS 135 132 132 LYS LYS A . n A 1 136 LEU 136 133 133 LEU LEU A . n A 1 137 GLU 137 134 134 GLU GLU A . n A 1 138 HIS 138 135 135 HIS HIS A . n A 1 139 ASN 139 136 136 ASN ASN A . n A 1 140 ILE 140 137 137 ILE ILE A . n A 1 141 MSE 141 138 138 MSE MSE A . n A 1 142 GLU 142 139 139 GLU GLU A . n A 1 143 LEU 143 140 140 LEU LEU A . n A 1 144 HIS 144 141 141 HIS HIS A . n A 1 145 SER 145 142 142 SER SER A . n A 1 146 HIS 146 143 143 HIS HIS A . n A 1 147 ASP 147 144 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 145 1 HOH HOH A . B 2 HOH 2 146 2 HOH HOH A . B 2 HOH 3 147 3 HOH HOH A . B 2 HOH 4 148 4 HOH HOH A . B 2 HOH 5 149 6 HOH HOH A . B 2 HOH 6 150 7 HOH HOH A . B 2 HOH 7 151 9 HOH HOH A . B 2 HOH 8 152 10 HOH HOH A . B 2 HOH 9 153 11 HOH HOH A . B 2 HOH 10 154 14 HOH HOH A . B 2 HOH 11 155 15 HOH HOH A . B 2 HOH 12 156 16 HOH HOH A . B 2 HOH 13 157 18 HOH HOH A . B 2 HOH 14 158 21 HOH HOH A . B 2 HOH 15 159 23 HOH HOH A . B 2 HOH 16 160 25 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 106 A MSE 103 ? MET SELENOMETHIONINE 2 A MSE 141 A MSE 138 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4290 ? 1 MORE -32 ? 1 'SSA (A^2)' 14690 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-05-04 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.contact_author' 3 3 'Structure model' '_software.contact_author_email' 4 3 'Structure model' '_software.date' 5 3 'Structure model' '_software.language' 6 3 'Structure model' '_software.location' 7 3 'Structure model' '_software.name' 8 3 'Structure model' '_software.type' 9 3 'Structure model' '_software.version' # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 2.250 _diffrn_reflns.pdbx_d_res_low 50.000 _diffrn_reflns.pdbx_number_obs 6601 _diffrn_reflns.pdbx_Rmerge_I_obs 0.097 _diffrn_reflns.pdbx_Rsym_value ? _diffrn_reflns.pdbx_chi_squared 1.81 _diffrn_reflns.av_sigmaI_over_netI 34.04 _diffrn_reflns.pdbx_redundancy 10.90 _diffrn_reflns.pdbx_percent_possible_obs 95.30 _diffrn_reflns.number 71740 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 6.10 50.00 ? ? 0.050 ? 4.009 10.90 97.10 1 4.85 6.10 ? ? 0.068 ? 3.493 12.90 100.00 1 4.23 4.85 ? ? 0.061 ? 3.430 13.40 100.00 1 3.85 4.23 ? ? 0.080 ? 3.047 13.60 100.00 1 3.57 3.85 ? ? 0.090 ? 2.193 14.10 100.00 1 3.36 3.57 ? ? 0.107 ? 1.673 14.30 100.00 1 3.19 3.36 ? ? 0.133 ? 1.464 14.70 99.70 1 3.05 3.19 ? ? 0.170 ? 1.197 14.30 100.00 1 2.94 3.05 ? ? 0.225 ? 1.099 14.30 100.00 1 2.83 2.94 ? ? 0.234 ? 0.992 13.40 100.00 1 2.75 2.83 ? ? 0.260 ? 0.865 12.30 100.00 1 2.67 2.75 ? ? 0.277 ? 0.867 11.10 100.00 1 2.60 2.67 ? ? 0.334 ? 0.833 10.30 100.00 1 2.53 2.60 ? ? 0.342 ? 0.837 9.00 100.00 1 2.48 2.53 ? ? 0.358 ? 0.770 7.30 96.80 1 2.42 2.48 ? ? 0.386 ? 0.736 6.50 96.30 1 2.38 2.42 ? ? 0.410 ? 0.847 5.20 90.80 1 2.33 2.38 ? ? 0.493 ? 0.804 4.80 81.10 1 2.29 2.33 ? ? 0.464 ? 0.966 4.00 74.50 1 2.25 2.29 ? ? 0.404 ? 1.207 3.30 66.10 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 17.2186 -3.5454 3.8528 0.3459 0.1297 0.1442 0.0924 0.0581 -0.0039 6.5239 1.5966 32.6612 1.1438 -10.2154 2.9842 -0.9537 0.0514 -0.7931 -0.4403 -0.0660 -0.1816 0.7857 -0.1906 1.0197 'X-RAY DIFFRACTION' 2 ? refined 7.1440 5.8636 12.7546 0.1836 0.0614 0.0632 -0.0197 -0.0933 -0.0127 3.8129 5.0892 7.5919 -3.5698 3.6673 -1.2223 0.1727 0.2026 -0.0665 -0.0276 -0.0864 -0.1298 -0.1469 0.4093 -0.0863 'X-RAY DIFFRACTION' 3 ? refined -0.6113 11.2051 3.9789 0.1242 0.0584 0.0742 0.0405 -0.0134 0.0109 4.9132 4.7757 10.6122 -0.3685 -1.3283 3.4002 -0.0743 0.1025 0.1463 -0.1129 0.0387 0.3691 -0.5701 -0.3167 0.0356 'X-RAY DIFFRACTION' 4 ? refined 7.4302 14.6610 14.0615 0.2373 0.0707 0.1896 -0.0517 -0.0240 0.0010 14.3854 7.3605 7.0352 -6.8684 3.2057 -1.8435 -0.2005 -0.4404 1.1503 0.2761 0.2548 -0.2474 -0.9607 -0.1602 -0.0542 'X-RAY DIFFRACTION' 5 ? refined 27.3453 4.8970 -2.9635 0.2345 0.3334 0.4466 -0.0473 0.0197 -0.0067 3.8402 0.7029 9.2253 -0.3647 2.8358 1.3297 -0.3044 0.2469 0.5041 -0.0679 -0.0069 -0.2276 -0.6996 0.7965 0.3113 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 5 ? ? A 22 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 23 ? ? A 46 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 47 ? ? A 80 ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 88 ? ? A 115 ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 116 ? ? A 143 ? ? ? ? # loop_ _pdbx_phasing_MAD_shell.d_res_high _pdbx_phasing_MAD_shell.d_res_low _pdbx_phasing_MAD_shell.reflns_acentric _pdbx_phasing_MAD_shell.fom_acentric _pdbx_phasing_MAD_shell.reflns_centric _pdbx_phasing_MAD_shell.fom_centric _pdbx_phasing_MAD_shell.reflns _pdbx_phasing_MAD_shell.fom 7.99 42.56 64 0.758 136 0.603 200 0.653 5.70 7.99 160 0.801 145 0.515 305 0.665 4.67 5.70 223 0.801 145 0.669 368 0.749 4.05 4.67 287 0.742 144 0.593 431 0.693 3.62 4.05 319 0.742 143 0.559 462 0.685 3.31 3.62 377 0.649 154 0.556 531 0.622 3.07 3.31 404 0.673 151 0.516 555 0.630 2.87 3.07 443 0.681 139 0.557 582 0.651 2.71 2.87 473 0.665 158 0.619 631 0.653 2.57 2.71 498 0.648 139 0.605 647 0.639 2.45 2.57 477 0.637 143 0.536 669 0.614 2.34 2.45 401 0.604 142 0.510 640 0.577 2.25 2.34 257 0.545 123 0.476 523 0.526 # _pdbx_phasing_dm.entry_id 3QPT _pdbx_phasing_dm.fom_acentric 0.770 _pdbx_phasing_dm.fom_centric 0.730 _pdbx_phasing_dm.fom 0.760 _pdbx_phasing_dm.reflns_acentric 4685 _pdbx_phasing_dm.reflns_centric 1862 _pdbx_phasing_dm.reflns 6547 # loop_ _pdbx_phasing_dm_shell.d_res_high _pdbx_phasing_dm_shell.d_res_low _pdbx_phasing_dm_shell.delta_phi_final _pdbx_phasing_dm_shell.delta_phi_initial _pdbx_phasing_dm_shell.fom_acentric _pdbx_phasing_dm_shell.fom_centric _pdbx_phasing_dm_shell.fom _pdbx_phasing_dm_shell.reflns_acentric _pdbx_phasing_dm_shell.reflns_centric _pdbx_phasing_dm_shell.reflns 2.300 2.400 ? ? 0.640 0.560 0.620 738 214 952 2.400 2.800 ? ? 0.720 0.660 0.710 1533 445 1978 2.800 3.200 ? ? 0.790 0.680 0.760 844 291 1135 3.200 4.000 ? ? 0.850 0.790 0.830 820 333 1153 4.000 6.400 ? ? 0.910 0.800 0.870 604 370 974 # _phasing.method SAD # _phasing_MAD.entry_id 3QPT _phasing_MAD.pdbx_d_res_high 2.25 _phasing_MAD.pdbx_d_res_low 42.56 _phasing_MAD.pdbx_reflns_acentric 4383 _phasing_MAD.pdbx_fom_acentric 0.672 _phasing_MAD.pdbx_reflns_centric 1862 _phasing_MAD.pdbx_fom_centric 0.564 _phasing_MAD.pdbx_reflns 6544 _phasing_MAD.pdbx_fom 0.636 # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 PHASER . ? program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 4 RESOLVE 2.15 20-Mar-2010 program 'Thomas C. Terwilliger' terwilliger@lanl.gov phasing http://www.solve.lanl.gov/ ? ? 5 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 6 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? # _pdbx_entry_details.entry_id 3QPT _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;AUTHORS STATE THAT THE SEQUENCING EXPERIMENTS OF THE CLONES CONFIRMED THE CODING SEQUENCE AT THESE POSITIONS IS GAGCCG (CORRESPONDING TO GLU-PRO). ; _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 142 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -43.46 _pdbx_validate_torsion.psi -76.68 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A ALA 0 ? A ALA 3 4 1 Y 1 A MSE 1 ? A MSE 4 5 1 Y 1 A GLU 2 ? A GLU 5 6 1 Y 1 A SER 3 ? A SER 6 7 1 Y 1 A PRO 4 ? A PRO 7 8 1 Y 1 A CYS 81 ? A CYS 84 9 1 Y 1 A ALA 82 ? A ALA 85 10 1 Y 1 A SER 83 ? A SER 86 11 1 Y 1 A ASP 84 ? A ASP 87 12 1 Y 1 A ARG 85 ? A ARG 88 13 1 Y 1 A ARG 86 ? A ARG 89 14 1 Y 1 A ALA 87 ? A ALA 90 15 1 Y 1 A ASP 144 ? A ASP 147 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #