data_3S64 # _entry.id 3S64 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3S64 RCSB RCSB065808 WWPDB D_1000065808 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3S63 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3S64 _pdbx_database_status.recvd_initial_deposition_date 2011-05-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Willis, C.' 1 'Wang, C.K.' 2 'Osman, A.' 3 'Simon, A.' 4 'Mulvenna, J.' 5 'Pickering, D.' 6 'Riboldi-Tunicliffe, A.' 7 'Jones, M.K.' 8 'Loukas, A.' 9 'Hofmann, A.' 10 # _citation.id primary _citation.title 'Insights into the membrane interactions of the saposin-like proteins Na-SLP-1 and Ac-SLP-1 from human and dog hookworm.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 6 _citation.page_first e25369 _citation.page_last e25369 _citation.year 2011 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21991310 _citation.pdbx_database_id_DOI 10.1371/journal.pone.0025369 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Willis, C.' 1 primary 'Wang, C.K.' 2 primary 'Osman, A.' 3 primary 'Simon, A.' 4 primary 'Pickering, D.' 5 primary 'Mulvenna, J.' 6 primary 'Riboldi-Tunicliffe, A.' 7 primary 'Jones, M.K.' 8 primary 'Loukas, A.' 9 primary 'Hofmann, A.' 10 # _cell.entry_id 3S64 _cell.length_a 72.053 _cell.length_b 72.053 _cell.length_c 90.888 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3S64 _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Saposin-like protein 1' 9544.258 1 ? ? 'UNP RESIDUES 18-104' ? 2 non-polymer syn 'CITRIC ACID' 192.124 1 ? ? ? ? 3 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305 1 ? ? ? ? 4 water nat water 18.015 32 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Ac-SLP-1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TPVVINNSNVIVCEICKMAVKLIVPEADKDLDQLEKEFIQGCMTLIGWLPYAEKECKALAKIEMGAIKTLLENGSAPEEI CTTLHAC ; _entity_poly.pdbx_seq_one_letter_code_can ;TPVVINNSNVIVCEICKMAVKLIVPEADKDLDQLEKEFIQGCMTLIGWLPYAEKECKALAKIEMGAIKTLLENGSAPEEI CTTLHAC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 PRO n 1 3 VAL n 1 4 VAL n 1 5 ILE n 1 6 ASN n 1 7 ASN n 1 8 SER n 1 9 ASN n 1 10 VAL n 1 11 ILE n 1 12 VAL n 1 13 CYS n 1 14 GLU n 1 15 ILE n 1 16 CYS n 1 17 LYS n 1 18 MET n 1 19 ALA n 1 20 VAL n 1 21 LYS n 1 22 LEU n 1 23 ILE n 1 24 VAL n 1 25 PRO n 1 26 GLU n 1 27 ALA n 1 28 ASP n 1 29 LYS n 1 30 ASP n 1 31 LEU n 1 32 ASP n 1 33 GLN n 1 34 LEU n 1 35 GLU n 1 36 LYS n 1 37 GLU n 1 38 PHE n 1 39 ILE n 1 40 GLN n 1 41 GLY n 1 42 CYS n 1 43 MET n 1 44 THR n 1 45 LEU n 1 46 ILE n 1 47 GLY n 1 48 TRP n 1 49 LEU n 1 50 PRO n 1 51 TYR n 1 52 ALA n 1 53 GLU n 1 54 LYS n 1 55 GLU n 1 56 CYS n 1 57 LYS n 1 58 ALA n 1 59 LEU n 1 60 ALA n 1 61 LYS n 1 62 ILE n 1 63 GLU n 1 64 MET n 1 65 GLY n 1 66 ALA n 1 67 ILE n 1 68 LYS n 1 69 THR n 1 70 LEU n 1 71 LEU n 1 72 GLU n 1 73 ASN n 1 74 GLY n 1 75 SER n 1 76 ALA n 1 77 PRO n 1 78 GLU n 1 79 GLU n 1 80 ILE n 1 81 CYS n 1 82 THR n 1 83 THR n 1 84 LEU n 1 85 HIS n 1 86 ALA n 1 87 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Dog hookworm' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SLP1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ancylostoma caninum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 29170 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q0MRQ4_ANCCA _struct_ref.pdbx_db_accession Q0MRQ4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TPVVINNSNVIVCEICKMAVKLIVPEADKDLDQLEKEFIQGCMTLIGWLPYAEKECKALAKIEMGAIKTLLENGSAPEEI CTTLHAC ; _struct_ref.pdbx_align_begin 18 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3S64 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q0MRQ4 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CIT non-polymer . 'CITRIC ACID' ? 'C6 H8 O7' 192.124 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EPE non-polymer . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES 'C8 H18 N2 O4 S' 238.305 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3S64 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.57 _exptl_crystal.density_percent_sol 65.53 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.8 _exptl_crystal_grow.pdbx_details '1.35M sodium citrate, 0.1M HEPES, pH 7.8, VAPOR DIFFUSION, SITTING DROP, temperature 289K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2009-11-05 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9536 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9536 # _reflns.entry_id 3S64 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 37 _reflns.d_resolution_high 2.2 _reflns.number_obs 6649 _reflns.number_all ? _reflns.percent_possible_obs 100 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 49 _reflns.pdbx_redundancy 18.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.3 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.461 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 14.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3S64 _refine.ls_number_reflns_obs 6313 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.45 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 23.585 _refine.ls_d_res_high 2.301 _refine.ls_percent_reflns_obs 99.87 _refine.ls_R_factor_obs 0.2261 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2249 _refine.ls_R_factor_R_free 0.2522 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.57 _refine.ls_number_reflns_R_free 535 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] 7.2479 _refine.aniso_B[2][2] 7.2479 _refine.aniso_B[3][3] -14.4957 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.362 _refine.solvent_model_param_bsol 48.500 _refine.pdbx_solvent_vdw_probe_radii 1.30 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 1.06 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SIRAS _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.31 _refine.pdbx_overall_phase_error 25.59 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 606 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 666 _refine_hist.d_res_high 2.301 _refine_hist.d_res_low 23.585 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.008 ? ? 643 ? 'X-RAY DIFFRACTION' f_angle_d 1.183 ? ? 866 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 20.618 ? ? 258 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.078 ? ? 102 ? 'X-RAY DIFFRACTION' f_plane_restr 0.004 ? ? 107 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs 'X-RAY DIFFRACTION' 4 2.3014 2.5328 2778 0.2709 100.00 0.3402 . . 145 . . . . 'X-RAY DIFFRACTION' 4 2.5328 2.8987 2814 0.2544 100.00 0.3216 . . 127 . . . . 'X-RAY DIFFRACTION' 4 2.8987 3.6499 2791 0.2239 100.00 0.2878 . . 115 . . . . 'X-RAY DIFFRACTION' 4 3.6499 23.5862 2791 0.2065 100.00 0.2079 . . 148 . . . . # _struct.entry_id 3S64 _struct.title 'Saposin-like protein Ac-SLP-1' _struct.pdbx_descriptor 'Saposin-like protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3S64 _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text 'Saposin, Lipid-binding, LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 11 ? VAL A 24 ? ILE A 11 VAL A 24 1 ? 14 HELX_P HELX_P2 2 GLN A 33 ? GLY A 47 ? GLN A 33 GLY A 47 1 ? 15 HELX_P HELX_P3 3 TYR A 51 ? ASN A 73 ? TYR A 51 ASN A 73 1 ? 23 HELX_P HELX_P4 4 GLU A 79 ? ALA A 86 ? GLU A 79 ALA A 86 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 87 SG ? ? A CYS 13 A CYS 87 1_555 ? ? ? ? ? ? ? 2.043 ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 81 SG ? ? A CYS 16 A CYS 81 1_555 ? ? ? ? ? ? ? 2.040 ? disulf3 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 56 SG ? ? A CYS 42 A CYS 56 1_555 ? ? ? ? ? ? ? 2.066 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CIT A 100' AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE EPE A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ILE A 62 ? ILE A 62 . ? 11_655 ? 2 AC1 7 LEU A 84 ? LEU A 84 . ? 1_555 ? 3 AC1 7 LEU A 84 ? LEU A 84 . ? 11_655 ? 4 AC1 7 HIS A 85 ? HIS A 85 . ? 11_655 ? 5 AC1 7 HIS A 85 ? HIS A 85 . ? 1_555 ? 6 AC1 7 EPE C . ? EPE A 101 . ? 1_555 ? 7 AC1 7 EPE C . ? EPE A 101 . ? 11_655 ? 8 AC2 10 ASN A 7 ? ASN A 7 . ? 11_655 ? 9 AC2 10 GLY A 47 ? GLY A 47 . ? 3_655 ? 10 AC2 10 TRP A 48 ? TRP A 48 . ? 3_655 ? 11 AC2 10 LEU A 49 ? LEU A 49 . ? 3_655 ? 12 AC2 10 THR A 83 ? THR A 83 . ? 1_555 ? 13 AC2 10 LEU A 84 ? LEU A 84 . ? 1_555 ? 14 AC2 10 CIT B . ? CIT A 100 . ? 11_655 ? 15 AC2 10 CIT B . ? CIT A 100 . ? 1_555 ? 16 AC2 10 HOH D . ? HOH A 203 . ? 3_655 ? 17 AC2 10 HOH D . ? HOH A 224 . ? 11_655 ? # _database_PDB_matrix.entry_id 3S64 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3S64 _atom_sites.fract_transf_matrix[1][1] 0.013879 _atom_sites.fract_transf_matrix[1][2] 0.008013 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016026 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011002 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 VAL 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 ILE 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ASP 30 30 30 ASP ALA A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLN 33 33 33 GLN ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS ALA A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 CYS 87 87 87 CYS CYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1610 ? 1 MORE -16 ? 1 'SSA (A^2)' 8470 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_554 -y,-x,-z-1/3 0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -30.2960000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2012-01-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 SHARP phasing . ? 2 PHENIX refinement '(phenix.refine: 1.6.4_486)' ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 9 ? ? 86.38 -2.62 2 1 ASP A 32 ? ? -29.17 84.42 3 1 GLN A 33 ? ? 42.73 17.60 4 1 ILE A 46 ? ? -147.10 30.39 5 1 TRP A 48 ? ? -93.57 48.88 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 30 ? CG ? A ASP 30 CG 2 1 Y 1 A ASP 30 ? OD1 ? A ASP 30 OD1 3 1 Y 1 A ASP 30 ? OD2 ? A ASP 30 OD2 4 1 Y 1 A GLN 33 ? CG ? A GLN 33 CG 5 1 Y 1 A GLN 33 ? CD ? A GLN 33 CD 6 1 Y 1 A GLN 33 ? OE1 ? A GLN 33 OE1 7 1 Y 1 A GLN 33 ? NE2 ? A GLN 33 NE2 8 1 Y 1 A LYS 36 ? CG ? A LYS 36 CG 9 1 Y 1 A LYS 36 ? CD ? A LYS 36 CD 10 1 Y 1 A LYS 36 ? CE ? A LYS 36 CE 11 1 Y 1 A LYS 36 ? NZ ? A LYS 36 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 1 ? A THR 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A VAL 3 ? A VAL 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A ILE 5 ? A ILE 5 6 1 Y 1 A ASN 6 ? A ASN 6 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CITRIC ACID' CIT 3 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CIT 1 100 100 CIT CIT A . C 3 EPE 1 101 101 EPE HEP A . D 4 HOH 1 200 200 HOH HOH A . D 4 HOH 2 201 201 HOH HOH A . D 4 HOH 3 202 202 HOH HOH A . D 4 HOH 4 203 203 HOH HOH A . D 4 HOH 5 204 204 HOH HOH A . D 4 HOH 6 205 205 HOH HOH A . D 4 HOH 7 206 206 HOH HOH A . D 4 HOH 8 207 207 HOH HOH A . D 4 HOH 9 208 208 HOH HOH A . D 4 HOH 10 209 209 HOH HOH A . D 4 HOH 11 210 210 HOH HOH A . D 4 HOH 12 211 211 HOH HOH A . D 4 HOH 13 212 212 HOH HOH A . D 4 HOH 14 213 213 HOH HOH A . D 4 HOH 15 214 214 HOH HOH A . D 4 HOH 16 215 215 HOH HOH A . D 4 HOH 17 216 216 HOH HOH A . D 4 HOH 18 217 217 HOH HOH A . D 4 HOH 19 218 218 HOH HOH A . D 4 HOH 20 219 219 HOH HOH A . D 4 HOH 21 220 220 HOH HOH A . D 4 HOH 22 221 221 HOH HOH A . D 4 HOH 23 222 222 HOH HOH A . D 4 HOH 24 223 223 HOH HOH A . D 4 HOH 25 224 224 HOH HOH A . D 4 HOH 26 225 225 HOH HOH A . D 4 HOH 27 226 226 HOH HOH A . D 4 HOH 28 227 227 HOH HOH A . D 4 HOH 29 228 228 HOH HOH A . D 4 HOH 30 229 229 HOH HOH A . D 4 HOH 31 230 230 HOH HOH A . D 4 HOH 32 231 231 HOH HOH A . #