data_3S8L # _entry.id 3S8L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3S8L pdb_00003s8l 10.2210/pdb3s8l/pdb RCSB RCSB065897 ? ? WWPDB D_1000065897 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-11-02 2 'Structure model' 1 1 2011-12-07 3 'Structure model' 1 2 2023-09-13 4 'Structure model' 1 3 2023-12-06 5 'Structure model' 1 4 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_conn.pdbx_dist_value' 4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 9 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 10 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 11 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 12 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 13 3 'Structure model' '_struct_ref_seq_dif.details' 14 4 'Structure model' '_chem_comp_atom.atom_id' 15 4 'Structure model' '_chem_comp_bond.atom_id_2' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3S8L _pdbx_database_status.recvd_initial_deposition_date 2011-05-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3OV1 . unspecified PDB 3OVE . unspecified PDB 3S8N . unspecified PDB 3S8O . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clements, J.H.' 1 'Stephen, F.M.' 2 # _citation.id primary _citation.title 'Protein-ligand interactions: thermodynamic effects associated with increasing nonpolar surface area.' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 133 _citation.page_first 18518 _citation.page_last 18521 _citation.year 2011 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22007755 _citation.pdbx_database_id_DOI 10.1021/ja2068752 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Myslinski, J.M.' 1 ? primary 'Delorbe, J.E.' 2 ? primary 'Clements, J.H.' 3 ? primary 'Martin, S.F.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Growth factor receptor-bound protein 2' 13758.543 1 ? ? 'unp residues 53-163' ? 2 polymer syn pYAc4cN 496.431 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 58 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Adapter protein GRB2, Protein Ash, SH2/SH3 adapter GRB2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH ; ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH ; A ? 2 'polypeptide(L)' no yes '(ACE)(PTR)(192)N(NH2)' XYXNX B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CHLORIDE ION' CL 4 GLYCEROL GOL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 GLU n 1 3 MET n 1 4 LYS n 1 5 PRO n 1 6 HIS n 1 7 PRO n 1 8 TRP n 1 9 PHE n 1 10 PHE n 1 11 GLY n 1 12 LYS n 1 13 ILE n 1 14 PRO n 1 15 ARG n 1 16 ALA n 1 17 LYS n 1 18 ALA n 1 19 GLU n 1 20 GLU n 1 21 MET n 1 22 LEU n 1 23 SER n 1 24 LYS n 1 25 GLN n 1 26 ARG n 1 27 HIS n 1 28 ASP n 1 29 GLY n 1 30 ALA n 1 31 PHE n 1 32 LEU n 1 33 ILE n 1 34 ARG n 1 35 GLU n 1 36 SER n 1 37 GLU n 1 38 SER n 1 39 ALA n 1 40 PRO n 1 41 GLY n 1 42 ASP n 1 43 PHE n 1 44 SER n 1 45 LEU n 1 46 SER n 1 47 VAL n 1 48 LYS n 1 49 PHE n 1 50 GLY n 1 51 ASN n 1 52 ASP n 1 53 VAL n 1 54 GLN n 1 55 HIS n 1 56 PHE n 1 57 LYS n 1 58 VAL n 1 59 LEU n 1 60 ARG n 1 61 ASP n 1 62 GLY n 1 63 ALA n 1 64 GLY n 1 65 LYS n 1 66 TYR n 1 67 PHE n 1 68 LEU n 1 69 TRP n 1 70 VAL n 1 71 VAL n 1 72 LYS n 1 73 PHE n 1 74 ASN n 1 75 SER n 1 76 LEU n 1 77 ASN n 1 78 GLU n 1 79 LEU n 1 80 VAL n 1 81 ASP n 1 82 TYR n 1 83 HIS n 1 84 ARG n 1 85 SER n 1 86 THR n 1 87 SER n 1 88 VAL n 1 89 SER n 1 90 ARG n 1 91 ASN n 1 92 GLN n 1 93 GLN n 1 94 ILE n 1 95 PHE n 1 96 LEU n 1 97 ARG n 1 98 ASP n 1 99 ILE n 1 100 GLU n 1 101 GLN n 1 102 VAL n 1 103 PRO n 1 104 GLN n 1 105 GLN n 1 106 PRO n 1 107 THR n 1 108 TYR n 1 109 VAL n 1 110 GLN n 1 111 ALA n 1 112 HIS n 1 113 HIS n 1 114 HIS n 1 115 HIS n 1 116 HIS n 1 117 HIS n 2 1 ACE n 2 2 PTR n 2 3 192 n 2 4 ASN n 2 5 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GRB2, ASH' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain SG13009 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pQE-60 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 192 'peptide linking' . '1-AMINOCYCLOBUTANECARBOXLIC ACID' ? 'C5 H9 N O2' 115.130 ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 53 ? ? ? A . n A 1 2 GLU 2 54 54 GLU GLU A . n A 1 3 MET 3 55 55 MET MET A . n A 1 4 LYS 4 56 56 LYS LYS A . n A 1 5 PRO 5 57 57 PRO PRO A . n A 1 6 HIS 6 58 58 HIS HIS A . n A 1 7 PRO 7 59 59 PRO PRO A . n A 1 8 TRP 8 60 60 TRP TRP A . n A 1 9 PHE 9 61 61 PHE PHE A . n A 1 10 PHE 10 62 62 PHE PHE A . n A 1 11 GLY 11 63 63 GLY GLY A . n A 1 12 LYS 12 64 64 LYS LYS A . n A 1 13 ILE 13 65 65 ILE ILE A . n A 1 14 PRO 14 66 66 PRO PRO A . n A 1 15 ARG 15 67 67 ARG ARG A . n A 1 16 ALA 16 68 68 ALA ALA A . n A 1 17 LYS 17 69 69 LYS LYS A . n A 1 18 ALA 18 70 70 ALA ALA A . n A 1 19 GLU 19 71 71 GLU GLU A . n A 1 20 GLU 20 72 72 GLU GLU A . n A 1 21 MET 21 73 73 MET MET A . n A 1 22 LEU 22 74 74 LEU LEU A . n A 1 23 SER 23 75 75 SER SER A . n A 1 24 LYS 24 76 76 LYS LYS A . n A 1 25 GLN 25 77 77 GLN GLN A . n A 1 26 ARG 26 78 78 ARG ARG A . n A 1 27 HIS 27 79 79 HIS HIS A . n A 1 28 ASP 28 80 80 ASP ASP A . n A 1 29 GLY 29 81 81 GLY GLY A . n A 1 30 ALA 30 82 82 ALA ALA A . n A 1 31 PHE 31 83 83 PHE PHE A . n A 1 32 LEU 32 84 84 LEU LEU A . n A 1 33 ILE 33 85 85 ILE ILE A . n A 1 34 ARG 34 86 86 ARG ARG A . n A 1 35 GLU 35 87 87 GLU GLU A . n A 1 36 SER 36 88 88 SER SER A . n A 1 37 GLU 37 89 89 GLU GLU A . n A 1 38 SER 38 90 90 SER SER A . n A 1 39 ALA 39 91 91 ALA ALA A . n A 1 40 PRO 40 92 92 PRO PRO A . n A 1 41 GLY 41 93 93 GLY GLY A . n A 1 42 ASP 42 94 94 ASP ASP A . n A 1 43 PHE 43 95 95 PHE PHE A . n A 1 44 SER 44 96 96 SER SER A . n A 1 45 LEU 45 97 97 LEU LEU A . n A 1 46 SER 46 98 98 SER SER A . n A 1 47 VAL 47 99 99 VAL VAL A . n A 1 48 LYS 48 100 100 LYS LYS A . n A 1 49 PHE 49 101 101 PHE PHE A . n A 1 50 GLY 50 102 102 GLY GLY A . n A 1 51 ASN 51 103 103 ASN ASN A . n A 1 52 ASP 52 104 104 ASP ASP A . n A 1 53 VAL 53 105 105 VAL VAL A . n A 1 54 GLN 54 106 106 GLN GLN A . n A 1 55 HIS 55 107 107 HIS HIS A . n A 1 56 PHE 56 108 108 PHE PHE A . n A 1 57 LYS 57 109 109 LYS LYS A . n A 1 58 VAL 58 110 110 VAL VAL A . n A 1 59 LEU 59 111 111 LEU LEU A . n A 1 60 ARG 60 112 112 ARG ARG A . n A 1 61 ASP 61 113 113 ASP ASP A . n A 1 62 GLY 62 114 114 GLY GLY A . n A 1 63 ALA 63 115 115 ALA ALA A . n A 1 64 GLY 64 116 116 GLY GLY A . n A 1 65 LYS 65 117 117 LYS LYS A . n A 1 66 TYR 66 118 118 TYR TYR A . n A 1 67 PHE 67 119 119 PHE PHE A . n A 1 68 LEU 68 120 120 LEU LEU A . n A 1 69 TRP 69 121 121 TRP TRP A . n A 1 70 VAL 70 122 122 VAL VAL A . n A 1 71 VAL 71 123 123 VAL VAL A . n A 1 72 LYS 72 124 124 LYS LYS A . n A 1 73 PHE 73 125 125 PHE PHE A . n A 1 74 ASN 74 126 126 ASN ASN A . n A 1 75 SER 75 127 127 SER SER A . n A 1 76 LEU 76 128 128 LEU LEU A . n A 1 77 ASN 77 129 129 ASN ASN A . n A 1 78 GLU 78 130 130 GLU GLU A . n A 1 79 LEU 79 131 131 LEU LEU A . n A 1 80 VAL 80 132 132 VAL VAL A . n A 1 81 ASP 81 133 133 ASP ASP A . n A 1 82 TYR 82 134 134 TYR TYR A . n A 1 83 HIS 83 135 135 HIS HIS A . n A 1 84 ARG 84 136 136 ARG ARG A . n A 1 85 SER 85 137 137 SER SER A . n A 1 86 THR 86 138 138 THR THR A . n A 1 87 SER 87 139 139 SER SER A . n A 1 88 VAL 88 140 140 VAL VAL A . n A 1 89 SER 89 141 141 SER SER A . n A 1 90 ARG 90 142 142 ARG ARG A . n A 1 91 ASN 91 143 143 ASN ASN A . n A 1 92 GLN 92 144 144 GLN GLN A . n A 1 93 GLN 93 145 145 GLN GLN A . n A 1 94 ILE 94 146 146 ILE ILE A . n A 1 95 PHE 95 147 147 PHE PHE A . n A 1 96 LEU 96 148 148 LEU LEU A . n A 1 97 ARG 97 149 149 ARG ARG A . n A 1 98 ASP 98 150 150 ASP ASP A . n A 1 99 ILE 99 151 151 ILE ILE A . n A 1 100 GLU 100 152 152 GLU GLU A . n A 1 101 GLN 101 153 153 GLN GLN A . n A 1 102 VAL 102 154 154 VAL VAL A . n A 1 103 PRO 103 155 ? ? ? A . n A 1 104 GLN 104 156 ? ? ? A . n A 1 105 GLN 105 157 ? ? ? A . n A 1 106 PRO 106 158 ? ? ? A . n A 1 107 THR 107 159 ? ? ? A . n A 1 108 TYR 108 160 ? ? ? A . n A 1 109 VAL 109 161 ? ? ? A . n A 1 110 GLN 110 162 ? ? ? A . n A 1 111 ALA 111 163 ? ? ? A . n A 1 112 HIS 112 164 ? ? ? A . n A 1 113 HIS 113 165 ? ? ? A . n A 1 114 HIS 114 166 ? ? ? A . n A 1 115 HIS 115 167 ? ? ? A . n A 1 116 HIS 116 168 ? ? ? A . n A 1 117 HIS 117 169 ? ? ? A . n B 2 1 ACE 1 1 1 ACE ACE B . n B 2 2 PTR 2 2 2 PTR PTR B . n B 2 3 192 3 3 3 192 192 B . n B 2 4 ASN 4 4 4 ASN ASN B . n B 2 5 NH2 5 5 5 NH2 NH2 B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CL 1 1 1 CL CL A . D 4 GOL 1 2 2 GOL GOL A . E 5 HOH 1 4 4 HOH HOH A . E 5 HOH 2 5 5 HOH HOH A . E 5 HOH 3 6 6 HOH HOH A . E 5 HOH 4 7 7 HOH HOH A . E 5 HOH 5 8 8 HOH HOH A . E 5 HOH 6 9 9 HOH HOH A . E 5 HOH 7 10 10 HOH HOH A . E 5 HOH 8 11 11 HOH HOH A . E 5 HOH 9 12 12 HOH HOH A . E 5 HOH 10 13 13 HOH HOH A . E 5 HOH 11 14 14 HOH HOH A . E 5 HOH 12 15 15 HOH HOH A . E 5 HOH 13 16 16 HOH HOH A . E 5 HOH 14 17 17 HOH HOH A . E 5 HOH 15 18 18 HOH HOH A . E 5 HOH 16 19 19 HOH HOH A . E 5 HOH 17 20 20 HOH HOH A . E 5 HOH 18 21 21 HOH HOH A . E 5 HOH 19 22 22 HOH HOH A . E 5 HOH 20 23 23 HOH HOH A . E 5 HOH 21 24 24 HOH HOH A . E 5 HOH 22 25 25 HOH HOH A . E 5 HOH 23 26 26 HOH HOH A . E 5 HOH 24 27 27 HOH HOH A . E 5 HOH 25 28 28 HOH HOH A . E 5 HOH 26 29 29 HOH HOH A . E 5 HOH 27 30 30 HOH HOH A . E 5 HOH 28 31 31 HOH HOH A . E 5 HOH 29 32 32 HOH HOH A . E 5 HOH 30 33 33 HOH HOH A . E 5 HOH 31 34 34 HOH HOH A . E 5 HOH 32 35 35 HOH HOH A . E 5 HOH 33 36 36 HOH HOH A . E 5 HOH 34 37 37 HOH HOH A . E 5 HOH 35 38 38 HOH HOH A . E 5 HOH 36 39 39 HOH HOH A . E 5 HOH 37 40 40 HOH HOH A . E 5 HOH 38 41 41 HOH HOH A . E 5 HOH 39 42 42 HOH HOH A . E 5 HOH 40 43 43 HOH HOH A . E 5 HOH 41 44 44 HOH HOH A . E 5 HOH 42 45 45 HOH HOH A . E 5 HOH 43 49 49 HOH HOH A . E 5 HOH 44 50 50 HOH HOH A . E 5 HOH 45 51 51 HOH HOH A . E 5 HOH 46 52 52 HOH HOH A . E 5 HOH 47 170 1 HOH HOH A . E 5 HOH 48 171 2 HOH HOH A . E 5 HOH 49 172 53 HOH HOH A . E 5 HOH 50 173 54 HOH HOH A . E 5 HOH 51 174 55 HOH HOH A . E 5 HOH 52 175 56 HOH HOH A . E 5 HOH 53 176 57 HOH HOH A . E 5 HOH 54 177 58 HOH HOH A . F 5 HOH 1 6 3 HOH HOH B . F 5 HOH 2 46 46 HOH HOH B . F 5 HOH 3 47 47 HOH HOH B . F 5 HOH 4 48 48 HOH HOH B . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CrystalClear 'data collection' . ? 1 PHASER phasing . ? 2 REFMAC refinement 5.5.0109 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # _cell.entry_id 3S8L _cell.length_a 42.072 _cell.length_b 42.072 _cell.length_c 108.755 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3S8L _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # _exptl.entry_id 3S8L _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.69 _exptl_crystal.density_percent_sol 27.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '0.1 M HEPES, 3.5 M sodium chloride, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.pdbx_collection_date 2011-05-22 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Blue max-flux confocal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 3S8L _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 1.71 _reflns.number_obs 9628 _reflns.number_all 11314 _reflns.percent_possible_obs 85.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.073 _reflns.pdbx_netI_over_sigmaI 12.8 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.71 _reflns_shell.d_res_low 1.77 _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.334 _reflns_shell.meanI_over_sigI_obs 3.8 _reflns_shell.pdbx_redundancy 2.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1100 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3S8L _refine.ls_number_reflns_obs 9086 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.24 _refine.ls_d_res_high 1.71 _refine.ls_percent_reflns_obs 85.24 _refine.ls_R_factor_obs 0.19887 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19602 _refine.ls_R_factor_R_free 0.25558 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 459 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.956 _refine.correlation_coeff_Fo_to_Fc_free 0.924 _refine.B_iso_mean 26.500 _refine.aniso_B[1][1] -1.10 _refine.aniso_B[2][2] -1.10 _refine.aniso_B[3][3] 2.21 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'pdb entry 3OV1' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.152 _refine.overall_SU_ML 0.000 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 0.007 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 869 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 58 _refine_hist.number_atoms_total 934 _refine_hist.d_res_high 1.71 _refine_hist.d_res_low 39.24 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.022 ? ? ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.99 ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.711 _refine_ls_shell.d_res_low 1.756 _refine_ls_shell.number_reflns_R_work 702 _refine_ls_shell.R_factor_R_work 0.397 _refine_ls_shell.percent_reflns_obs 89.57 _refine_ls_shell.R_factor_R_free 0.349 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 28 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 3S8L _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 3S8L _struct.title 'Protein-Ligand Interactions: Thermodynamic Effects Associated with Increasing Hydrophobic Surface Area' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3S8L _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN/ANTAGONIST' _struct_keywords.text 'Grb2 SH2 domain, phosphotyrosine-containing tripeptide, SIGNALING PROTEIN-ANTAGONIST complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP GRB2_HUMAN P62993 1 ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQA ; 53 ? 2 PDB 3S8L 3S8L 2 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3S8L A 1 ? 111 ? P62993 53 ? 163 ? 53 163 2 2 3S8L B 1 ? 5 ? 3S8L 1 ? 5 ? 1 5 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3S8L HIS A 112 ? UNP P62993 ? ? 'expression tag' 164 1 1 3S8L HIS A 113 ? UNP P62993 ? ? 'expression tag' 165 2 1 3S8L HIS A 114 ? UNP P62993 ? ? 'expression tag' 166 3 1 3S8L HIS A 115 ? UNP P62993 ? ? 'expression tag' 167 4 1 3S8L HIS A 116 ? UNP P62993 ? ? 'expression tag' 168 5 1 3S8L HIS A 117 ? UNP P62993 ? ? 'expression tag' 169 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1320 ? 1 MORE -15 ? 1 'SSA (A^2)' 6340 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 14 ? SER A 23 ? PRO A 66 SER A 75 1 ? 10 HELX_P HELX_P2 2 SER A 75 ? HIS A 83 ? SER A 127 HIS A 135 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ACE 1 C ? ? ? 1_555 B PTR 2 N ? ? B ACE 1 B PTR 2 1_555 ? ? ? ? ? ? ? 1.349 ? ? covale2 covale both ? B PTR 2 C ? ? ? 1_555 B 192 3 N ? ? B PTR 2 B 192 3 1_555 ? ? ? ? ? ? ? 1.307 ? ? covale3 covale both ? B 192 3 C ? ? ? 1_555 B ASN 4 N ? ? B 192 3 B ASN 4 1_555 ? ? ? ? ? ? ? 1.306 ? ? covale4 covale both ? B ASN 4 C ? ? ? 1_555 B NH2 5 N ? ? B ASN 4 B NH2 5 1_555 ? ? ? ? ? ? ? 1.349 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 PTR B 2 ? . . . . PTR B 2 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' 2 192 B 3 ? . . . . 192 B 3 ? 1_555 . . . . . . . ? 1 192 None 'Non-standard residue' 3 ACE B 1 ? PTR B 2 ? ACE B 1 ? 1_555 PTR B 2 ? 1_555 . . PTR 42 ACE None 'Terminal acetylation' 4 NH2 B 5 ? ASN B 4 ? NH2 B 5 ? 1_555 ASN B 4 ? 1_555 . . ASN 17 NH2 None 'Terminal amidation' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 52 ? LYS A 57 ? ASP A 104 LYS A 109 A 2 PHE A 43 ? PHE A 49 ? PHE A 95 PHE A 101 A 3 ALA A 30 ? GLU A 35 ? ALA A 82 GLU A 87 A 4 ARG A 97 ? ASP A 98 ? ARG A 149 ASP A 150 B 1 LEU A 59 ? ARG A 60 ? LEU A 111 ARG A 112 B 2 TYR A 66 ? PHE A 67 ? TYR A 118 PHE A 119 B 3 LYS A 72 ? PHE A 73 ? LYS A 124 PHE A 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 54 ? O GLN A 106 N VAL A 47 ? N VAL A 99 A 2 3 O LYS A 48 ? O LYS A 100 N ALA A 30 ? N ALA A 82 A 3 4 N PHE A 31 ? N PHE A 83 O ARG A 97 ? O ARG A 149 B 1 2 N LEU A 59 ? N LEU A 111 O PHE A 67 ? O PHE A 119 B 2 3 N TYR A 66 ? N TYR A 118 O PHE A 73 ? O PHE A 125 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 1 ? 2 'BINDING SITE FOR RESIDUE CL A 1' AC2 Software A GOL 2 ? 7 'BINDING SITE FOR RESIDUE GOL A 2' AC3 Software ? ? ? ? 17 'BINDING SITE FOR CHAIN B OF PYAC4CN' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 SER A 87 ? SER A 139 . ? 1_555 ? 2 AC1 2 GLN A 93 ? GLN A 145 . ? 1_555 ? 3 AC2 7 SER A 23 ? SER A 75 . ? 1_555 ? 4 AC2 7 GLN A 25 ? GLN A 77 . ? 1_555 ? 5 AC2 7 ARG A 26 ? ARG A 78 . ? 1_555 ? 6 AC2 7 ASP A 42 ? ASP A 94 . ? 7_455 ? 7 AC2 7 LYS A 48 ? LYS A 100 . ? 1_555 ? 8 AC2 7 ARG A 60 ? ARG A 112 . ? 7_455 ? 9 AC2 7 HOH E . ? HOH A 174 . ? 1_555 ? 10 AC3 17 HOH E . ? HOH A 7 . ? 1_555 ? 11 AC3 17 ARG A 15 ? ARG A 67 . ? 1_555 ? 12 AC3 17 ARG A 26 ? ARG A 78 . ? 7_565 ? 13 AC3 17 ARG A 34 ? ARG A 86 . ? 1_555 ? 14 AC3 17 SER A 36 ? SER A 88 . ? 1_555 ? 15 AC3 17 SER A 38 ? SER A 90 . ? 1_555 ? 16 AC3 17 SER A 44 ? SER A 96 . ? 1_555 ? 17 AC3 17 HIS A 55 ? HIS A 107 . ? 1_555 ? 18 AC3 17 PHE A 56 ? PHE A 108 . ? 1_555 ? 19 AC3 17 LYS A 57 ? LYS A 109 . ? 1_555 ? 20 AC3 17 LEU A 68 ? LEU A 120 . ? 1_555 ? 21 AC3 17 TRP A 69 ? TRP A 121 . ? 1_555 ? 22 AC3 17 VAL A 102 ? VAL A 154 . ? 7_565 ? 23 AC3 17 HOH F . ? HOH B 6 . ? 1_555 ? 24 AC3 17 HOH F . ? HOH B 46 . ? 1_555 ? 25 AC3 17 HOH F . ? HOH B 47 . ? 1_555 ? 26 AC3 17 HOH F . ? HOH B 48 . ? 1_555 ? # _pdbx_entry_details.entry_id 3S8L _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 54 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 41 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 1_455 _pdbx_validate_symm_contact.dist 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 121 ? ? -124.68 -71.76 2 1 VAL A 122 ? ? -132.46 -48.15 3 1 GLN A 153 ? ? 98.85 114.33 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 2 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 2 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details O-PHOSPHOTYROSINE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 53 ? A ILE 1 2 1 Y 1 A PRO 155 ? A PRO 103 3 1 Y 1 A GLN 156 ? A GLN 104 4 1 Y 1 A GLN 157 ? A GLN 105 5 1 Y 1 A PRO 158 ? A PRO 106 6 1 Y 1 A THR 159 ? A THR 107 7 1 Y 1 A TYR 160 ? A TYR 108 8 1 Y 1 A VAL 161 ? A VAL 109 9 1 Y 1 A GLN 162 ? A GLN 110 10 1 Y 1 A ALA 163 ? A ALA 111 11 1 Y 1 A HIS 164 ? A HIS 112 12 1 Y 1 A HIS 165 ? A HIS 113 13 1 Y 1 A HIS 166 ? A HIS 114 14 1 Y 1 A HIS 167 ? A HIS 115 15 1 Y 1 A HIS 168 ? A HIS 116 16 1 Y 1 A HIS 169 ? A HIS 117 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 192 N N N N 1 192 O O N N 2 192 CA C N N 3 192 C C N N 4 192 CB1 C N N 5 192 CG C N N 6 192 CB2 C N N 7 192 OXT O N N 8 192 H H N N 9 192 H2 H N N 10 192 HB11 H N N 11 192 HB12 H N N 12 192 HG1 H N N 13 192 HG2 H N N 14 192 HB21 H N N 15 192 HB22 H N N 16 192 HXT H N N 17 ACE C C N N 18 ACE O O N N 19 ACE CH3 C N N 20 ACE H H N N 21 ACE H1 H N N 22 ACE H2 H N N 23 ACE H3 H N N 24 ALA N N N N 25 ALA CA C N S 26 ALA C C N N 27 ALA O O N N 28 ALA CB C N N 29 ALA OXT O N N 30 ALA H H N N 31 ALA H2 H N N 32 ALA HA H N N 33 ALA HB1 H N N 34 ALA HB2 H N N 35 ALA HB3 H N N 36 ALA HXT H N N 37 ARG N N N N 38 ARG CA C N S 39 ARG C C N N 40 ARG O O N N 41 ARG CB C N N 42 ARG CG C N N 43 ARG CD C N N 44 ARG NE N N N 45 ARG CZ C N N 46 ARG NH1 N N N 47 ARG NH2 N N N 48 ARG OXT O N N 49 ARG H H N N 50 ARG H2 H N N 51 ARG HA H N N 52 ARG HB2 H N N 53 ARG HB3 H N N 54 ARG HG2 H N N 55 ARG HG3 H N N 56 ARG HD2 H N N 57 ARG HD3 H N N 58 ARG HE H N N 59 ARG HH11 H N N 60 ARG HH12 H N N 61 ARG HH21 H N N 62 ARG HH22 H N N 63 ARG HXT H N N 64 ASN N N N N 65 ASN CA C N S 66 ASN C C N N 67 ASN O O N N 68 ASN CB C N N 69 ASN CG C N N 70 ASN OD1 O N N 71 ASN ND2 N N N 72 ASN OXT O N N 73 ASN H H N N 74 ASN H2 H N N 75 ASN HA H N N 76 ASN HB2 H N N 77 ASN HB3 H N N 78 ASN HD21 H N N 79 ASN HD22 H N N 80 ASN HXT H N N 81 ASP N N N N 82 ASP CA C N S 83 ASP C C N N 84 ASP O O N N 85 ASP CB C N N 86 ASP CG C N N 87 ASP OD1 O N N 88 ASP OD2 O N N 89 ASP OXT O N N 90 ASP H H N N 91 ASP H2 H N N 92 ASP HA H N N 93 ASP HB2 H N N 94 ASP HB3 H N N 95 ASP HD2 H N N 96 ASP HXT H N N 97 CL CL CL N N 98 GLN N N N N 99 GLN CA C N S 100 GLN C C N N 101 GLN O O N N 102 GLN CB C N N 103 GLN CG C N N 104 GLN CD C N N 105 GLN OE1 O N N 106 GLN NE2 N N N 107 GLN OXT O N N 108 GLN H H N N 109 GLN H2 H N N 110 GLN HA H N N 111 GLN HB2 H N N 112 GLN HB3 H N N 113 GLN HG2 H N N 114 GLN HG3 H N N 115 GLN HE21 H N N 116 GLN HE22 H N N 117 GLN HXT H N N 118 GLU N N N N 119 GLU CA C N S 120 GLU C C N N 121 GLU O O N N 122 GLU CB C N N 123 GLU CG C N N 124 GLU CD C N N 125 GLU OE1 O N N 126 GLU OE2 O N N 127 GLU OXT O N N 128 GLU H H N N 129 GLU H2 H N N 130 GLU HA H N N 131 GLU HB2 H N N 132 GLU HB3 H N N 133 GLU HG2 H N N 134 GLU HG3 H N N 135 GLU HE2 H N N 136 GLU HXT H N N 137 GLY N N N N 138 GLY CA C N N 139 GLY C C N N 140 GLY O O N N 141 GLY OXT O N N 142 GLY H H N N 143 GLY H2 H N N 144 GLY HA2 H N N 145 GLY HA3 H N N 146 GLY HXT H N N 147 GOL C1 C N N 148 GOL O1 O N N 149 GOL C2 C N N 150 GOL O2 O N N 151 GOL C3 C N N 152 GOL O3 O N N 153 GOL H11 H N N 154 GOL H12 H N N 155 GOL HO1 H N N 156 GOL H2 H N N 157 GOL HO2 H N N 158 GOL H31 H N N 159 GOL H32 H N N 160 GOL HO3 H N N 161 HIS N N N N 162 HIS CA C N S 163 HIS C C N N 164 HIS O O N N 165 HIS CB C N N 166 HIS CG C Y N 167 HIS ND1 N Y N 168 HIS CD2 C Y N 169 HIS CE1 C Y N 170 HIS NE2 N Y N 171 HIS OXT O N N 172 HIS H H N N 173 HIS H2 H N N 174 HIS HA H N N 175 HIS HB2 H N N 176 HIS HB3 H N N 177 HIS HD1 H N N 178 HIS HD2 H N N 179 HIS HE1 H N N 180 HIS HE2 H N N 181 HIS HXT H N N 182 HOH O O N N 183 HOH H1 H N N 184 HOH H2 H N N 185 ILE N N N N 186 ILE CA C N S 187 ILE C C N N 188 ILE O O N N 189 ILE CB C N S 190 ILE CG1 C N N 191 ILE CG2 C N N 192 ILE CD1 C N N 193 ILE OXT O N N 194 ILE H H N N 195 ILE H2 H N N 196 ILE HA H N N 197 ILE HB H N N 198 ILE HG12 H N N 199 ILE HG13 H N N 200 ILE HG21 H N N 201 ILE HG22 H N N 202 ILE HG23 H N N 203 ILE HD11 H N N 204 ILE HD12 H N N 205 ILE HD13 H N N 206 ILE HXT H N N 207 LEU N N N N 208 LEU CA C N S 209 LEU C C N N 210 LEU O O N N 211 LEU CB C N N 212 LEU CG C N N 213 LEU CD1 C N N 214 LEU CD2 C N N 215 LEU OXT O N N 216 LEU H H N N 217 LEU H2 H N N 218 LEU HA H N N 219 LEU HB2 H N N 220 LEU HB3 H N N 221 LEU HG H N N 222 LEU HD11 H N N 223 LEU HD12 H N N 224 LEU HD13 H N N 225 LEU HD21 H N N 226 LEU HD22 H N N 227 LEU HD23 H N N 228 LEU HXT H N N 229 LYS N N N N 230 LYS CA C N S 231 LYS C C N N 232 LYS O O N N 233 LYS CB C N N 234 LYS CG C N N 235 LYS CD C N N 236 LYS CE C N N 237 LYS NZ N N N 238 LYS OXT O N N 239 LYS H H N N 240 LYS H2 H N N 241 LYS HA H N N 242 LYS HB2 H N N 243 LYS HB3 H N N 244 LYS HG2 H N N 245 LYS HG3 H N N 246 LYS HD2 H N N 247 LYS HD3 H N N 248 LYS HE2 H N N 249 LYS HE3 H N N 250 LYS HZ1 H N N 251 LYS HZ2 H N N 252 LYS HZ3 H N N 253 LYS HXT H N N 254 MET N N N N 255 MET CA C N S 256 MET C C N N 257 MET O O N N 258 MET CB C N N 259 MET CG C N N 260 MET SD S N N 261 MET CE C N N 262 MET OXT O N N 263 MET H H N N 264 MET H2 H N N 265 MET HA H N N 266 MET HB2 H N N 267 MET HB3 H N N 268 MET HG2 H N N 269 MET HG3 H N N 270 MET HE1 H N N 271 MET HE2 H N N 272 MET HE3 H N N 273 MET HXT H N N 274 NH2 N N N N 275 NH2 HN1 H N N 276 NH2 HN2 H N N 277 PHE N N N N 278 PHE CA C N S 279 PHE C C N N 280 PHE O O N N 281 PHE CB C N N 282 PHE CG C Y N 283 PHE CD1 C Y N 284 PHE CD2 C Y N 285 PHE CE1 C Y N 286 PHE CE2 C Y N 287 PHE CZ C Y N 288 PHE OXT O N N 289 PHE H H N N 290 PHE H2 H N N 291 PHE HA H N N 292 PHE HB2 H N N 293 PHE HB3 H N N 294 PHE HD1 H N N 295 PHE HD2 H N N 296 PHE HE1 H N N 297 PHE HE2 H N N 298 PHE HZ H N N 299 PHE HXT H N N 300 PRO N N N N 301 PRO CA C N S 302 PRO C C N N 303 PRO O O N N 304 PRO CB C N N 305 PRO CG C N N 306 PRO CD C N N 307 PRO OXT O N N 308 PRO H H N N 309 PRO HA H N N 310 PRO HB2 H N N 311 PRO HB3 H N N 312 PRO HG2 H N N 313 PRO HG3 H N N 314 PRO HD2 H N N 315 PRO HD3 H N N 316 PRO HXT H N N 317 PTR N N N N 318 PTR CA C N S 319 PTR C C N N 320 PTR O O N N 321 PTR OXT O N N 322 PTR CB C N N 323 PTR CG C Y N 324 PTR CD1 C Y N 325 PTR CD2 C Y N 326 PTR CE1 C Y N 327 PTR CE2 C Y N 328 PTR CZ C Y N 329 PTR OH O N N 330 PTR P P N N 331 PTR O1P O N N 332 PTR O2P O N N 333 PTR O3P O N N 334 PTR H H N N 335 PTR H2 H N N 336 PTR HA H N N 337 PTR HXT H N N 338 PTR HB2 H N N 339 PTR HB3 H N N 340 PTR HD1 H N N 341 PTR HD2 H N N 342 PTR HE1 H N N 343 PTR HE2 H N N 344 PTR HO2P H N N 345 PTR HO3P H N N 346 SER N N N N 347 SER CA C N S 348 SER C C N N 349 SER O O N N 350 SER CB C N N 351 SER OG O N N 352 SER OXT O N N 353 SER H H N N 354 SER H2 H N N 355 SER HA H N N 356 SER HB2 H N N 357 SER HB3 H N N 358 SER HG H N N 359 SER HXT H N N 360 THR N N N N 361 THR CA C N S 362 THR C C N N 363 THR O O N N 364 THR CB C N R 365 THR OG1 O N N 366 THR CG2 C N N 367 THR OXT O N N 368 THR H H N N 369 THR H2 H N N 370 THR HA H N N 371 THR HB H N N 372 THR HG1 H N N 373 THR HG21 H N N 374 THR HG22 H N N 375 THR HG23 H N N 376 THR HXT H N N 377 TRP N N N N 378 TRP CA C N S 379 TRP C C N N 380 TRP O O N N 381 TRP CB C N N 382 TRP CG C Y N 383 TRP CD1 C Y N 384 TRP CD2 C Y N 385 TRP NE1 N Y N 386 TRP CE2 C Y N 387 TRP CE3 C Y N 388 TRP CZ2 C Y N 389 TRP CZ3 C Y N 390 TRP CH2 C Y N 391 TRP OXT O N N 392 TRP H H N N 393 TRP H2 H N N 394 TRP HA H N N 395 TRP HB2 H N N 396 TRP HB3 H N N 397 TRP HD1 H N N 398 TRP HE1 H N N 399 TRP HE3 H N N 400 TRP HZ2 H N N 401 TRP HZ3 H N N 402 TRP HH2 H N N 403 TRP HXT H N N 404 TYR N N N N 405 TYR CA C N S 406 TYR C C N N 407 TYR O O N N 408 TYR CB C N N 409 TYR CG C Y N 410 TYR CD1 C Y N 411 TYR CD2 C Y N 412 TYR CE1 C Y N 413 TYR CE2 C Y N 414 TYR CZ C Y N 415 TYR OH O N N 416 TYR OXT O N N 417 TYR H H N N 418 TYR H2 H N N 419 TYR HA H N N 420 TYR HB2 H N N 421 TYR HB3 H N N 422 TYR HD1 H N N 423 TYR HD2 H N N 424 TYR HE1 H N N 425 TYR HE2 H N N 426 TYR HH H N N 427 TYR HXT H N N 428 VAL N N N N 429 VAL CA C N S 430 VAL C C N N 431 VAL O O N N 432 VAL CB C N N 433 VAL CG1 C N N 434 VAL CG2 C N N 435 VAL OXT O N N 436 VAL H H N N 437 VAL H2 H N N 438 VAL HA H N N 439 VAL HB H N N 440 VAL HG11 H N N 441 VAL HG12 H N N 442 VAL HG13 H N N 443 VAL HG21 H N N 444 VAL HG22 H N N 445 VAL HG23 H N N 446 VAL HXT H N N 447 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 192 N CA sing N N 1 192 N H sing N N 2 192 N H2 sing N N 3 192 O C doub N N 4 192 CA C sing N N 5 192 CA CB1 sing N N 6 192 CA CB2 sing N N 7 192 C OXT sing N N 8 192 CB1 CG sing N N 9 192 CB1 HB11 sing N N 10 192 CB1 HB12 sing N N 11 192 CG CB2 sing N N 12 192 CG HG1 sing N N 13 192 CG HG2 sing N N 14 192 CB2 HB21 sing N N 15 192 CB2 HB22 sing N N 16 192 OXT HXT sing N N 17 ACE C O doub N N 18 ACE C CH3 sing N N 19 ACE C H sing N N 20 ACE CH3 H1 sing N N 21 ACE CH3 H2 sing N N 22 ACE CH3 H3 sing N N 23 ALA N CA sing N N 24 ALA N H sing N N 25 ALA N H2 sing N N 26 ALA CA C sing N N 27 ALA CA CB sing N N 28 ALA CA HA sing N N 29 ALA C O doub N N 30 ALA C OXT sing N N 31 ALA CB HB1 sing N N 32 ALA CB HB2 sing N N 33 ALA CB HB3 sing N N 34 ALA OXT HXT sing N N 35 ARG N CA sing N N 36 ARG N H sing N N 37 ARG N H2 sing N N 38 ARG CA C sing N N 39 ARG CA CB sing N N 40 ARG CA HA sing N N 41 ARG C O doub N N 42 ARG C OXT sing N N 43 ARG CB CG sing N N 44 ARG CB HB2 sing N N 45 ARG CB HB3 sing N N 46 ARG CG CD sing N N 47 ARG CG HG2 sing N N 48 ARG CG HG3 sing N N 49 ARG CD NE sing N N 50 ARG CD HD2 sing N N 51 ARG CD HD3 sing N N 52 ARG NE CZ sing N N 53 ARG NE HE sing N N 54 ARG CZ NH1 sing N N 55 ARG CZ NH2 doub N N 56 ARG NH1 HH11 sing N N 57 ARG NH1 HH12 sing N N 58 ARG NH2 HH21 sing N N 59 ARG NH2 HH22 sing N N 60 ARG OXT HXT sing N N 61 ASN N CA sing N N 62 ASN N H sing N N 63 ASN N H2 sing N N 64 ASN CA C sing N N 65 ASN CA CB sing N N 66 ASN CA HA sing N N 67 ASN C O doub N N 68 ASN C OXT sing N N 69 ASN CB CG sing N N 70 ASN CB HB2 sing N N 71 ASN CB HB3 sing N N 72 ASN CG OD1 doub N N 73 ASN CG ND2 sing N N 74 ASN ND2 HD21 sing N N 75 ASN ND2 HD22 sing N N 76 ASN OXT HXT sing N N 77 ASP N CA sing N N 78 ASP N H sing N N 79 ASP N H2 sing N N 80 ASP CA C sing N N 81 ASP CA CB sing N N 82 ASP CA HA sing N N 83 ASP C O doub N N 84 ASP C OXT sing N N 85 ASP CB CG sing N N 86 ASP CB HB2 sing N N 87 ASP CB HB3 sing N N 88 ASP CG OD1 doub N N 89 ASP CG OD2 sing N N 90 ASP OD2 HD2 sing N N 91 ASP OXT HXT sing N N 92 GLN N CA sing N N 93 GLN N H sing N N 94 GLN N H2 sing N N 95 GLN CA C sing N N 96 GLN CA CB sing N N 97 GLN CA HA sing N N 98 GLN C O doub N N 99 GLN C OXT sing N N 100 GLN CB CG sing N N 101 GLN CB HB2 sing N N 102 GLN CB HB3 sing N N 103 GLN CG CD sing N N 104 GLN CG HG2 sing N N 105 GLN CG HG3 sing N N 106 GLN CD OE1 doub N N 107 GLN CD NE2 sing N N 108 GLN NE2 HE21 sing N N 109 GLN NE2 HE22 sing N N 110 GLN OXT HXT sing N N 111 GLU N CA sing N N 112 GLU N H sing N N 113 GLU N H2 sing N N 114 GLU CA C sing N N 115 GLU CA CB sing N N 116 GLU CA HA sing N N 117 GLU C O doub N N 118 GLU C OXT sing N N 119 GLU CB CG sing N N 120 GLU CB HB2 sing N N 121 GLU CB HB3 sing N N 122 GLU CG CD sing N N 123 GLU CG HG2 sing N N 124 GLU CG HG3 sing N N 125 GLU CD OE1 doub N N 126 GLU CD OE2 sing N N 127 GLU OE2 HE2 sing N N 128 GLU OXT HXT sing N N 129 GLY N CA sing N N 130 GLY N H sing N N 131 GLY N H2 sing N N 132 GLY CA C sing N N 133 GLY CA HA2 sing N N 134 GLY CA HA3 sing N N 135 GLY C O doub N N 136 GLY C OXT sing N N 137 GLY OXT HXT sing N N 138 GOL C1 O1 sing N N 139 GOL C1 C2 sing N N 140 GOL C1 H11 sing N N 141 GOL C1 H12 sing N N 142 GOL O1 HO1 sing N N 143 GOL C2 O2 sing N N 144 GOL C2 C3 sing N N 145 GOL C2 H2 sing N N 146 GOL O2 HO2 sing N N 147 GOL C3 O3 sing N N 148 GOL C3 H31 sing N N 149 GOL C3 H32 sing N N 150 GOL O3 HO3 sing N N 151 HIS N CA sing N N 152 HIS N H sing N N 153 HIS N H2 sing N N 154 HIS CA C sing N N 155 HIS CA CB sing N N 156 HIS CA HA sing N N 157 HIS C O doub N N 158 HIS C OXT sing N N 159 HIS CB CG sing N N 160 HIS CB HB2 sing N N 161 HIS CB HB3 sing N N 162 HIS CG ND1 sing Y N 163 HIS CG CD2 doub Y N 164 HIS ND1 CE1 doub Y N 165 HIS ND1 HD1 sing N N 166 HIS CD2 NE2 sing Y N 167 HIS CD2 HD2 sing N N 168 HIS CE1 NE2 sing Y N 169 HIS CE1 HE1 sing N N 170 HIS NE2 HE2 sing N N 171 HIS OXT HXT sing N N 172 HOH O H1 sing N N 173 HOH O H2 sing N N 174 ILE N CA sing N N 175 ILE N H sing N N 176 ILE N H2 sing N N 177 ILE CA C sing N N 178 ILE CA CB sing N N 179 ILE CA HA sing N N 180 ILE C O doub N N 181 ILE C OXT sing N N 182 ILE CB CG1 sing N N 183 ILE CB CG2 sing N N 184 ILE CB HB sing N N 185 ILE CG1 CD1 sing N N 186 ILE CG1 HG12 sing N N 187 ILE CG1 HG13 sing N N 188 ILE CG2 HG21 sing N N 189 ILE CG2 HG22 sing N N 190 ILE CG2 HG23 sing N N 191 ILE CD1 HD11 sing N N 192 ILE CD1 HD12 sing N N 193 ILE CD1 HD13 sing N N 194 ILE OXT HXT sing N N 195 LEU N CA sing N N 196 LEU N H sing N N 197 LEU N H2 sing N N 198 LEU CA C sing N N 199 LEU CA CB sing N N 200 LEU CA HA sing N N 201 LEU C O doub N N 202 LEU C OXT sing N N 203 LEU CB CG sing N N 204 LEU CB HB2 sing N N 205 LEU CB HB3 sing N N 206 LEU CG CD1 sing N N 207 LEU CG CD2 sing N N 208 LEU CG HG sing N N 209 LEU CD1 HD11 sing N N 210 LEU CD1 HD12 sing N N 211 LEU CD1 HD13 sing N N 212 LEU CD2 HD21 sing N N 213 LEU CD2 HD22 sing N N 214 LEU CD2 HD23 sing N N 215 LEU OXT HXT sing N N 216 LYS N CA sing N N 217 LYS N H sing N N 218 LYS N H2 sing N N 219 LYS CA C sing N N 220 LYS CA CB sing N N 221 LYS CA HA sing N N 222 LYS C O doub N N 223 LYS C OXT sing N N 224 LYS CB CG sing N N 225 LYS CB HB2 sing N N 226 LYS CB HB3 sing N N 227 LYS CG CD sing N N 228 LYS CG HG2 sing N N 229 LYS CG HG3 sing N N 230 LYS CD CE sing N N 231 LYS CD HD2 sing N N 232 LYS CD HD3 sing N N 233 LYS CE NZ sing N N 234 LYS CE HE2 sing N N 235 LYS CE HE3 sing N N 236 LYS NZ HZ1 sing N N 237 LYS NZ HZ2 sing N N 238 LYS NZ HZ3 sing N N 239 LYS OXT HXT sing N N 240 MET N CA sing N N 241 MET N H sing N N 242 MET N H2 sing N N 243 MET CA C sing N N 244 MET CA CB sing N N 245 MET CA HA sing N N 246 MET C O doub N N 247 MET C OXT sing N N 248 MET CB CG sing N N 249 MET CB HB2 sing N N 250 MET CB HB3 sing N N 251 MET CG SD sing N N 252 MET CG HG2 sing N N 253 MET CG HG3 sing N N 254 MET SD CE sing N N 255 MET CE HE1 sing N N 256 MET CE HE2 sing N N 257 MET CE HE3 sing N N 258 MET OXT HXT sing N N 259 NH2 N HN1 sing N N 260 NH2 N HN2 sing N N 261 PHE N CA sing N N 262 PHE N H sing N N 263 PHE N H2 sing N N 264 PHE CA C sing N N 265 PHE CA CB sing N N 266 PHE CA HA sing N N 267 PHE C O doub N N 268 PHE C OXT sing N N 269 PHE CB CG sing N N 270 PHE CB HB2 sing N N 271 PHE CB HB3 sing N N 272 PHE CG CD1 doub Y N 273 PHE CG CD2 sing Y N 274 PHE CD1 CE1 sing Y N 275 PHE CD1 HD1 sing N N 276 PHE CD2 CE2 doub Y N 277 PHE CD2 HD2 sing N N 278 PHE CE1 CZ doub Y N 279 PHE CE1 HE1 sing N N 280 PHE CE2 CZ sing Y N 281 PHE CE2 HE2 sing N N 282 PHE CZ HZ sing N N 283 PHE OXT HXT sing N N 284 PRO N CA sing N N 285 PRO N CD sing N N 286 PRO N H sing N N 287 PRO CA C sing N N 288 PRO CA CB sing N N 289 PRO CA HA sing N N 290 PRO C O doub N N 291 PRO C OXT sing N N 292 PRO CB CG sing N N 293 PRO CB HB2 sing N N 294 PRO CB HB3 sing N N 295 PRO CG CD sing N N 296 PRO CG HG2 sing N N 297 PRO CG HG3 sing N N 298 PRO CD HD2 sing N N 299 PRO CD HD3 sing N N 300 PRO OXT HXT sing N N 301 PTR N CA sing N N 302 PTR N H sing N N 303 PTR N H2 sing N N 304 PTR CA C sing N N 305 PTR CA CB sing N N 306 PTR CA HA sing N N 307 PTR C O doub N N 308 PTR C OXT sing N N 309 PTR OXT HXT sing N N 310 PTR CB CG sing N N 311 PTR CB HB2 sing N N 312 PTR CB HB3 sing N N 313 PTR CG CD1 doub Y N 314 PTR CG CD2 sing Y N 315 PTR CD1 CE1 sing Y N 316 PTR CD1 HD1 sing N N 317 PTR CD2 CE2 doub Y N 318 PTR CD2 HD2 sing N N 319 PTR CE1 CZ doub Y N 320 PTR CE1 HE1 sing N N 321 PTR CE2 CZ sing Y N 322 PTR CE2 HE2 sing N N 323 PTR CZ OH sing N N 324 PTR OH P sing N N 325 PTR P O1P doub N N 326 PTR P O2P sing N N 327 PTR P O3P sing N N 328 PTR O2P HO2P sing N N 329 PTR O3P HO3P sing N N 330 SER N CA sing N N 331 SER N H sing N N 332 SER N H2 sing N N 333 SER CA C sing N N 334 SER CA CB sing N N 335 SER CA HA sing N N 336 SER C O doub N N 337 SER C OXT sing N N 338 SER CB OG sing N N 339 SER CB HB2 sing N N 340 SER CB HB3 sing N N 341 SER OG HG sing N N 342 SER OXT HXT sing N N 343 THR N CA sing N N 344 THR N H sing N N 345 THR N H2 sing N N 346 THR CA C sing N N 347 THR CA CB sing N N 348 THR CA HA sing N N 349 THR C O doub N N 350 THR C OXT sing N N 351 THR CB OG1 sing N N 352 THR CB CG2 sing N N 353 THR CB HB sing N N 354 THR OG1 HG1 sing N N 355 THR CG2 HG21 sing N N 356 THR CG2 HG22 sing N N 357 THR CG2 HG23 sing N N 358 THR OXT HXT sing N N 359 TRP N CA sing N N 360 TRP N H sing N N 361 TRP N H2 sing N N 362 TRP CA C sing N N 363 TRP CA CB sing N N 364 TRP CA HA sing N N 365 TRP C O doub N N 366 TRP C OXT sing N N 367 TRP CB CG sing N N 368 TRP CB HB2 sing N N 369 TRP CB HB3 sing N N 370 TRP CG CD1 doub Y N 371 TRP CG CD2 sing Y N 372 TRP CD1 NE1 sing Y N 373 TRP CD1 HD1 sing N N 374 TRP CD2 CE2 doub Y N 375 TRP CD2 CE3 sing Y N 376 TRP NE1 CE2 sing Y N 377 TRP NE1 HE1 sing N N 378 TRP CE2 CZ2 sing Y N 379 TRP CE3 CZ3 doub Y N 380 TRP CE3 HE3 sing N N 381 TRP CZ2 CH2 doub Y N 382 TRP CZ2 HZ2 sing N N 383 TRP CZ3 CH2 sing Y N 384 TRP CZ3 HZ3 sing N N 385 TRP CH2 HH2 sing N N 386 TRP OXT HXT sing N N 387 TYR N CA sing N N 388 TYR N H sing N N 389 TYR N H2 sing N N 390 TYR CA C sing N N 391 TYR CA CB sing N N 392 TYR CA HA sing N N 393 TYR C O doub N N 394 TYR C OXT sing N N 395 TYR CB CG sing N N 396 TYR CB HB2 sing N N 397 TYR CB HB3 sing N N 398 TYR CG CD1 doub Y N 399 TYR CG CD2 sing Y N 400 TYR CD1 CE1 sing Y N 401 TYR CD1 HD1 sing N N 402 TYR CD2 CE2 doub Y N 403 TYR CD2 HD2 sing N N 404 TYR CE1 CZ doub Y N 405 TYR CE1 HE1 sing N N 406 TYR CE2 CZ sing Y N 407 TYR CE2 HE2 sing N N 408 TYR CZ OH sing N N 409 TYR OH HH sing N N 410 TYR OXT HXT sing N N 411 VAL N CA sing N N 412 VAL N H sing N N 413 VAL N H2 sing N N 414 VAL CA C sing N N 415 VAL CA CB sing N N 416 VAL CA HA sing N N 417 VAL C O doub N N 418 VAL C OXT sing N N 419 VAL CB CG1 sing N N 420 VAL CB CG2 sing N N 421 VAL CB HB sing N N 422 VAL CG1 HG11 sing N N 423 VAL CG1 HG12 sing N N 424 VAL CG1 HG13 sing N N 425 VAL CG2 HG21 sing N N 426 VAL CG2 HG22 sing N N 427 VAL CG2 HG23 sing N N 428 VAL OXT HXT sing N N 429 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3OV1 _pdbx_initial_refinement_model.details 'pdb entry 3OV1' # _atom_sites.entry_id 3S8L _atom_sites.fract_transf_matrix[1][1] 0.023769 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023769 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009195 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O P S # loop_