data_3TKZ
# 
_entry.id   3TKZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3TKZ         pdb_00003tkz 10.2210/pdb3tkz/pdb 
RCSB  RCSB067607   ?            ?                   
WWPDB D_1000067607 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-10-26 
2 'Structure model' 1 1 2023-09-13 
3 'Structure model' 1 2 2023-12-06 
4 'Structure model' 1 3 2024-10-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Database references'    
3 2 'Structure model' 'Derived calculations'   
4 2 'Structure model' 'Refinement description' 
5 3 'Structure model' 'Data collection'        
6 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' chem_comp_atom                
2  2 'Structure model' chem_comp_bond                
3  2 'Structure model' database_2                    
4  2 'Structure model' pdbx_initial_refinement_model 
5  2 'Structure model' struct_conn                   
6  2 'Structure model' struct_ref_seq_dif            
7  2 'Structure model' struct_sheet                  
8  3 'Structure model' chem_comp_atom                
9  3 'Structure model' chem_comp_bond                
10 4 'Structure model' pdbx_entry_details            
11 4 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                
2 2 'Structure model' '_database_2.pdbx_database_accession' 
3 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
4 2 'Structure model' '_struct_ref_seq_dif.details'         
5 2 'Structure model' '_struct_sheet.number_strands'        
6 3 'Structure model' '_chem_comp_atom.atom_id'             
7 3 'Structure model' '_chem_comp_bond.atom_id_2'           
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3TKZ 
_pdbx_database_status.recvd_initial_deposition_date   2011-08-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3TL0 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'  1 
'Zhang, J.'  2 
'Yuan, C.'   3 
'Hard, R.L.' 4 
'Park, I.H.' 5 
'Li, C.'     6 
'Bell, C.E.' 7 
'Pei, D.'    8 
# 
_citation.id                        primary 
_citation.title                     'Simultaneous binding of two peptidyl ligands by a SRC homology 2 domain.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            50 
_citation.page_first                7637 
_citation.page_last                 7646 
_citation.year                      2011 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21800896 
_citation.pdbx_database_id_DOI      10.1021/bi200439v 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhang, Y.'  1 ? 
primary 'Zhang, J.'  2 ? 
primary 'Yuan, C.'   3 ? 
primary 'Hard, R.L.' 4 ? 
primary 'Park, I.H.' 5 ? 
primary 'Li, C.'     6 ? 
primary 'Bell, C.'   7 ? 
primary 'Pei, D.'    8 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Tyrosine-protein phosphatase non-receptor type 11' 12288.744 1  3.1.3.48 ? 
'N-terminal SH2 domain (UNP residues 1-106)' ?                              
2 polymer syn 'PROTEIN (RVIpYFVPLNR peptide)'                     1358.524  2  ?        ? ? 'Y4 residue is phosphorylated' 
3 water   nat water                                               18.015    81 ?        ? ? ?                              
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Protein-tyrosine phosphatase 1D, PTP-1D, Protein-tyrosine phosphatase 2C, PTP-2C, SH-PTP2, SHP-2, Shp2, SH-PTP3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GSHMTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAEL
VQYYMEHHGQLKEKNGDVIELKYPLNCAD
;
;GSHMTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAEL
VQYYMEHHGQLKEKNGDVIELKYPLNCAD
;
A   ? 
2 'polypeptide(L)' no yes 'RVI(PTR)FVPLNR' RVIYFVPLNR P,Q ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   THR n 
1 6   SER n 
1 7   ARG n 
1 8   ARG n 
1 9   TRP n 
1 10  PHE n 
1 11  HIS n 
1 12  PRO n 
1 13  ASN n 
1 14  ILE n 
1 15  THR n 
1 16  GLY n 
1 17  VAL n 
1 18  GLU n 
1 19  ALA n 
1 20  GLU n 
1 21  ASN n 
1 22  LEU n 
1 23  LEU n 
1 24  LEU n 
1 25  THR n 
1 26  ARG n 
1 27  GLY n 
1 28  VAL n 
1 29  ASP n 
1 30  GLY n 
1 31  SER n 
1 32  PHE n 
1 33  LEU n 
1 34  ALA n 
1 35  ARG n 
1 36  PRO n 
1 37  SER n 
1 38  LYS n 
1 39  SER n 
1 40  ASN n 
1 41  PRO n 
1 42  GLY n 
1 43  ASP n 
1 44  PHE n 
1 45  THR n 
1 46  LEU n 
1 47  SER n 
1 48  VAL n 
1 49  ARG n 
1 50  ARG n 
1 51  ASN n 
1 52  GLY n 
1 53  ALA n 
1 54  VAL n 
1 55  THR n 
1 56  HIS n 
1 57  ILE n 
1 58  LYS n 
1 59  ILE n 
1 60  GLN n 
1 61  ASN n 
1 62  THR n 
1 63  GLY n 
1 64  ASP n 
1 65  TYR n 
1 66  TYR n 
1 67  ASP n 
1 68  LEU n 
1 69  TYR n 
1 70  GLY n 
1 71  GLY n 
1 72  GLU n 
1 73  LYS n 
1 74  PHE n 
1 75  ALA n 
1 76  THR n 
1 77  LEU n 
1 78  ALA n 
1 79  GLU n 
1 80  LEU n 
1 81  VAL n 
1 82  GLN n 
1 83  TYR n 
1 84  TYR n 
1 85  MET n 
1 86  GLU n 
1 87  HIS n 
1 88  HIS n 
1 89  GLY n 
1 90  GLN n 
1 91  LEU n 
1 92  LYS n 
1 93  GLU n 
1 94  LYS n 
1 95  ASN n 
1 96  GLY n 
1 97  ASP n 
1 98  VAL n 
1 99  ILE n 
1 100 GLU n 
1 101 LEU n 
1 102 LYS n 
1 103 TYR n 
1 104 PRO n 
1 105 LEU n 
1 106 ASN n 
1 107 CYS n 
1 108 ALA n 
1 109 ASP n 
2 1   ARG n 
2 2   VAL n 
2 3   ILE n 
2 4   PTR n 
2 5   PHE n 
2 6   VAL n 
2 7   PRO n 
2 8   LEU n 
2 9   ASN n 
2 10  ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PTPN11, PTP2C, SHPTP2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The peptide was synthesized using standard Fmoc/HBTU chemistry' 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ?                 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   SER 2   -1  ?   ?   ?   A . n 
A 1 3   HIS 3   0   ?   ?   ?   A . n 
A 1 4   MET 4   1   ?   ?   ?   A . n 
A 1 5   THR 5   2   ?   ?   ?   A . n 
A 1 6   SER 6   3   ?   ?   ?   A . n 
A 1 7   ARG 7   4   4   ARG ARG A . n 
A 1 8   ARG 8   5   5   ARG ARG A . n 
A 1 9   TRP 9   6   6   TRP TRP A . n 
A 1 10  PHE 10  7   7   PHE PHE A . n 
A 1 11  HIS 11  8   8   HIS HIS A . n 
A 1 12  PRO 12  9   9   PRO PRO A . n 
A 1 13  ASN 13  10  10  ASN ASN A . n 
A 1 14  ILE 14  11  11  ILE ILE A . n 
A 1 15  THR 15  12  12  THR THR A . n 
A 1 16  GLY 16  13  13  GLY GLY A . n 
A 1 17  VAL 17  14  14  VAL VAL A . n 
A 1 18  GLU 18  15  15  GLU GLU A . n 
A 1 19  ALA 19  16  16  ALA ALA A . n 
A 1 20  GLU 20  17  17  GLU GLU A . n 
A 1 21  ASN 21  18  18  ASN ASN A . n 
A 1 22  LEU 22  19  19  LEU LEU A . n 
A 1 23  LEU 23  20  20  LEU LEU A . n 
A 1 24  LEU 24  21  21  LEU LEU A . n 
A 1 25  THR 25  22  22  THR THR A . n 
A 1 26  ARG 26  23  23  ARG ARG A . n 
A 1 27  GLY 27  24  24  GLY GLY A . n 
A 1 28  VAL 28  25  25  VAL VAL A . n 
A 1 29  ASP 29  26  26  ASP ASP A . n 
A 1 30  GLY 30  27  27  GLY GLY A . n 
A 1 31  SER 31  28  28  SER SER A . n 
A 1 32  PHE 32  29  29  PHE PHE A . n 
A 1 33  LEU 33  30  30  LEU LEU A . n 
A 1 34  ALA 34  31  31  ALA ALA A . n 
A 1 35  ARG 35  32  32  ARG ARG A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  SER 37  34  34  SER SER A . n 
A 1 38  LYS 38  35  35  LYS LYS A . n 
A 1 39  SER 39  36  36  SER SER A . n 
A 1 40  ASN 40  37  37  ASN ASN A . n 
A 1 41  PRO 41  38  38  PRO PRO A . n 
A 1 42  GLY 42  39  39  GLY GLY A . n 
A 1 43  ASP 43  40  40  ASP ASP A . n 
A 1 44  PHE 44  41  41  PHE PHE A . n 
A 1 45  THR 45  42  42  THR THR A . n 
A 1 46  LEU 46  43  43  LEU LEU A . n 
A 1 47  SER 47  44  44  SER SER A . n 
A 1 48  VAL 48  45  45  VAL VAL A . n 
A 1 49  ARG 49  46  46  ARG ARG A . n 
A 1 50  ARG 50  47  47  ARG ARG A . n 
A 1 51  ASN 51  48  48  ASN ASN A . n 
A 1 52  GLY 52  49  49  GLY GLY A . n 
A 1 53  ALA 53  50  50  ALA ALA A . n 
A 1 54  VAL 54  51  51  VAL VAL A . n 
A 1 55  THR 55  52  52  THR THR A . n 
A 1 56  HIS 56  53  53  HIS HIS A . n 
A 1 57  ILE 57  54  54  ILE ILE A . n 
A 1 58  LYS 58  55  55  LYS LYS A . n 
A 1 59  ILE 59  56  56  ILE ILE A . n 
A 1 60  GLN 60  57  57  GLN GLN A . n 
A 1 61  ASN 61  58  58  ASN ASN A . n 
A 1 62  THR 62  59  59  THR THR A . n 
A 1 63  GLY 63  60  60  GLY GLY A . n 
A 1 64  ASP 64  61  61  ASP ASP A . n 
A 1 65  TYR 65  62  62  TYR TYR A . n 
A 1 66  TYR 66  63  63  TYR TYR A . n 
A 1 67  ASP 67  64  64  ASP ASP A . n 
A 1 68  LEU 68  65  65  LEU LEU A . n 
A 1 69  TYR 69  66  66  TYR TYR A . n 
A 1 70  GLY 70  67  67  GLY GLY A . n 
A 1 71  GLY 71  68  68  GLY GLY A . n 
A 1 72  GLU 72  69  69  GLU GLU A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  PHE 74  71  71  PHE PHE A . n 
A 1 75  ALA 75  72  72  ALA ALA A . n 
A 1 76  THR 76  73  73  THR THR A . n 
A 1 77  LEU 77  74  74  LEU LEU A . n 
A 1 78  ALA 78  75  75  ALA ALA A . n 
A 1 79  GLU 79  76  76  GLU GLU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  VAL 81  78  78  VAL VAL A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  TYR 83  80  80  TYR TYR A . n 
A 1 84  TYR 84  81  81  TYR TYR A . n 
A 1 85  MET 85  82  82  MET MET A . n 
A 1 86  GLU 86  83  83  GLU GLU A . n 
A 1 87  HIS 87  84  84  HIS HIS A . n 
A 1 88  HIS 88  85  85  HIS HIS A . n 
A 1 89  GLY 89  86  86  GLY GLY A . n 
A 1 90  GLN 90  87  87  GLN GLN A . n 
A 1 91  LEU 91  88  88  LEU LEU A . n 
A 1 92  LYS 92  89  89  LYS LYS A . n 
A 1 93  GLU 93  90  90  GLU GLU A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  ASN 95  92  92  ASN ASN A . n 
A 1 96  GLY 96  93  93  GLY GLY A . n 
A 1 97  ASP 97  94  94  ASP ASP A . n 
A 1 98  VAL 98  95  95  VAL VAL A . n 
A 1 99  ILE 99  96  96  ILE ILE A . n 
A 1 100 GLU 100 97  97  GLU GLU A . n 
A 1 101 LEU 101 98  98  LEU LEU A . n 
A 1 102 LYS 102 99  99  LYS LYS A . n 
A 1 103 TYR 103 100 100 TYR TYR A . n 
A 1 104 PRO 104 101 101 PRO PRO A . n 
A 1 105 LEU 105 102 102 LEU LEU A . n 
A 1 106 ASN 106 103 103 ASN ASN A . n 
A 1 107 CYS 107 104 ?   ?   ?   A . n 
A 1 108 ALA 108 105 ?   ?   ?   A . n 
A 1 109 ASP 109 106 ?   ?   ?   A . n 
B 2 1   ARG 1   1   ?   ?   ?   P . n 
B 2 2   VAL 2   2   2   VAL VAL P . n 
B 2 3   ILE 3   3   3   ILE ILE P . n 
B 2 4   PTR 4   4   4   PTR PTR P . n 
B 2 5   PHE 5   5   5   PHE PHE P . n 
B 2 6   VAL 6   6   6   VAL VAL P . n 
B 2 7   PRO 7   7   7   PRO PRO P . n 
B 2 8   LEU 8   8   8   LEU LEU P . n 
B 2 9   ASN 9   9   ?   ?   ?   P . n 
B 2 10  ARG 10  10  ?   ?   ?   P . n 
C 2 1   ARG 1   1   ?   ?   ?   Q . n 
C 2 2   VAL 2   2   2   VAL VAL Q . n 
C 2 3   ILE 3   3   3   ILE ILE Q . n 
C 2 4   PTR 4   4   4   PTR PTR Q . n 
C 2 5   PHE 5   5   5   PHE PHE Q . n 
C 2 6   VAL 6   6   6   VAL VAL Q . n 
C 2 7   PRO 7   7   7   PRO PRO Q . n 
C 2 8   LEU 8   8   ?   ?   ?   Q . n 
C 2 9   ASN 9   9   ?   ?   ?   Q . n 
C 2 10  ARG 10  10  ?   ?   ?   Q . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 HOH 1  107 1  HOH HOH A . 
D 3 HOH 2  108 2  HOH HOH A . 
D 3 HOH 3  109 3  HOH HOH A . 
D 3 HOH 4  110 5  HOH HOH A . 
D 3 HOH 5  111 6  HOH HOH A . 
D 3 HOH 6  112 7  HOH HOH A . 
D 3 HOH 7  113 8  HOH HOH A . 
D 3 HOH 8  114 9  HOH HOH A . 
D 3 HOH 9  115 10 HOH HOH A . 
D 3 HOH 10 116 11 HOH HOH A . 
D 3 HOH 11 117 12 HOH HOH A . 
D 3 HOH 12 118 13 HOH HOH A . 
D 3 HOH 13 119 14 HOH HOH A . 
D 3 HOH 14 120 17 HOH HOH A . 
D 3 HOH 15 121 18 HOH HOH A . 
D 3 HOH 16 122 19 HOH HOH A . 
D 3 HOH 17 123 20 HOH HOH A . 
D 3 HOH 18 124 21 HOH HOH A . 
D 3 HOH 19 125 22 HOH HOH A . 
D 3 HOH 20 126 23 HOH HOH A . 
D 3 HOH 21 127 26 HOH HOH A . 
D 3 HOH 22 128 27 HOH HOH A . 
D 3 HOH 23 129 29 HOH HOH A . 
D 3 HOH 24 130 30 HOH HOH A . 
D 3 HOH 25 131 31 HOH HOH A . 
D 3 HOH 26 132 32 HOH HOH A . 
D 3 HOH 27 133 33 HOH HOH A . 
D 3 HOH 28 134 34 HOH HOH A . 
D 3 HOH 29 135 35 HOH HOH A . 
D 3 HOH 30 136 36 HOH HOH A . 
D 3 HOH 31 137 40 HOH HOH A . 
D 3 HOH 32 138 41 HOH HOH A . 
D 3 HOH 33 139 42 HOH HOH A . 
D 3 HOH 34 140 43 HOH HOH A . 
D 3 HOH 35 141 45 HOH HOH A . 
D 3 HOH 36 142 48 HOH HOH A . 
D 3 HOH 37 143 50 HOH HOH A . 
D 3 HOH 38 144 51 HOH HOH A . 
D 3 HOH 39 145 52 HOH HOH A . 
D 3 HOH 40 146 54 HOH HOH A . 
D 3 HOH 41 147 56 HOH HOH A . 
D 3 HOH 42 148 57 HOH HOH A . 
D 3 HOH 43 149 58 HOH HOH A . 
D 3 HOH 44 150 59 HOH HOH A . 
D 3 HOH 45 151 60 HOH HOH A . 
D 3 HOH 46 152 61 HOH HOH A . 
D 3 HOH 47 153 62 HOH HOH A . 
D 3 HOH 48 154 63 HOH HOH A . 
D 3 HOH 49 155 64 HOH HOH A . 
D 3 HOH 50 156 65 HOH HOH A . 
D 3 HOH 51 157 66 HOH HOH A . 
D 3 HOH 52 158 67 HOH HOH A . 
D 3 HOH 53 159 68 HOH HOH A . 
D 3 HOH 54 160 69 HOH HOH A . 
D 3 HOH 55 161 70 HOH HOH A . 
D 3 HOH 56 162 71 HOH HOH A . 
D 3 HOH 57 163 72 HOH HOH A . 
D 3 HOH 58 164 73 HOH HOH A . 
D 3 HOH 59 165 74 HOH HOH A . 
D 3 HOH 60 166 75 HOH HOH A . 
D 3 HOH 61 167 76 HOH HOH A . 
D 3 HOH 62 168 77 HOH HOH A . 
D 3 HOH 63 169 1  HOH HOH A . 
D 3 HOH 64 170 2  HOH HOH A . 
D 3 HOH 65 171 3  HOH HOH A . 
D 3 HOH 66 172 4  HOH HOH A . 
D 3 HOH 67 173 6  HOH HOH A . 
D 3 HOH 68 174 7  HOH HOH A . 
D 3 HOH 69 175 8  HOH HOH A . 
D 3 HOH 70 176 9  HOH HOH A . 
D 3 HOH 71 177 12 HOH HOH A . 
D 3 HOH 72 178 13 HOH HOH A . 
D 3 HOH 73 179 14 HOH HOH A . 
D 3 HOH 74 180 25 HOH HOH A . 
E 3 HOH 1  18  11 HOH HOH P . 
E 3 HOH 2  24  24 HOH HOH P . 
E 3 HOH 3  25  10 HOH HOH P . 
E 3 HOH 4  37  37 HOH HOH P . 
E 3 HOH 5  46  46 HOH HOH P . 
F 3 HOH 1  17  16 HOH HOH Q . 
F 3 HOH 2  38  38 HOH HOH Q . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 4  ? CG  ? A ARG 7  CG  
2  1 Y 1 A ARG 4  ? CD  ? A ARG 7  CD  
3  1 Y 1 A ARG 4  ? NE  ? A ARG 7  NE  
4  1 Y 1 A ARG 4  ? CZ  ? A ARG 7  CZ  
5  1 Y 1 A ARG 4  ? NH1 ? A ARG 7  NH1 
6  1 Y 1 A ARG 4  ? NH2 ? A ARG 7  NH2 
7  1 Y 1 A LYS 35 ? CG  ? A LYS 38 CG  
8  1 Y 1 A LYS 35 ? CD  ? A LYS 38 CD  
9  1 Y 1 A LYS 35 ? CE  ? A LYS 38 CE  
10 1 Y 1 A LYS 35 ? NZ  ? A LYS 38 NZ  
11 1 Y 1 A LYS 91 ? CG  ? A LYS 94 CG  
12 1 Y 1 A LYS 91 ? CD  ? A LYS 94 CD  
13 1 Y 1 A LYS 91 ? CE  ? A LYS 94 CE  
14 1 Y 1 A LYS 91 ? NZ  ? A LYS 94 NZ  
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .         ? 1 
MOLREP    phasing           'of CCP4' ? 2 
REFMAC    refinement        5.5.0100  ? 3 
DENZO     'data reduction'  .         ? 4 
SCALEPACK 'data scaling'    .         ? 5 
# 
_cell.entry_id           3TKZ 
_cell.length_a           62.865 
_cell.length_b           62.865 
_cell.length_c           75.322 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3TKZ 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
_exptl.entry_id          3TKZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.density_percent_sol   50.40 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'20% PEG 3350, 0.1M Bis-Tris, 0.2M Li2SO4, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2007-03-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98 
# 
_reflns.entry_id                     3TKZ 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             48.3 
_reflns.d_resolution_high            1.80 
_reflns.number_obs                   15827 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.030 
_reflns.pdbx_netI_over_sigmaI        61.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              11.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.89 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.382 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.0 
_reflns_shell.pdbx_redundancy        11.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3TKZ 
_refine.ls_number_reflns_obs                     13727 
_refine.ls_number_reflns_all                     13727 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.31 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    99.27 
_refine.ls_R_factor_obs                          0.19776 
_refine.ls_R_factor_R_work                       0.19679 
_refine.ls_R_factor_R_free                       0.21602 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  728 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.955 
_refine.B_iso_mean                               43.354 
_refine.aniso_B[1][1]                            0.03 
_refine.aniso_B[2][2]                            0.03 
_refine.aniso_B[3][3]                            -0.05 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 1AYD' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.107 
_refine.overall_SU_ML                            0.079 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             5.508 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        911 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             81 
_refine_hist.number_atoms_total               992 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        32.31 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.021  0.022  ? 934  ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.960  1.967  ? 1272 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       7.397  5.000  ? 110  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       39.781 23.696 ? 46   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       15.929 15.000 ? 141  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       17.219 15.000 ? 5    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.146  0.200  ? 137  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.011  0.021  ? 717  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  1.277  1.500  ? 558  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 2.291  2.000  ? 897  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  3.376  3.000  ? 376  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 5.397  4.500  ? 375  ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.800 
_refine_ls_shell.d_res_low                        1.847 
_refine_ls_shell.number_reflns_R_work             992 
_refine_ls_shell.R_factor_R_work                  0.297 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.431 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             61 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_database_PDB_matrix.entry_id          3TKZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  3TKZ 
_struct.title                     'Structure of the SHP-2 N-SH2 domain in a 1:2 complex with RVIpYFVPLNR peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3TKZ 
_struct_keywords.pdbx_keywords   HYDROLASE/Peptide 
_struct_keywords.text            'SH2 domain, Protein Protein Interactions, PTR Residues, HYDROLASE-Peptide complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PTN11_HUMAN Q06124 1 
;MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQY
YMEHHGQLKEKNGDVIELKYPLNCAD
;
1 ? 
2 PDB 3TKZ        3TKZ   2 RVIYFVPLNR ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3TKZ A 4 ? 109 ? Q06124 1 ? 106 ? 1 106 
2 2 3TKZ P 1 ? 10  ? 3TKZ   1 ? 10  ? 1 10  
3 2 3TKZ Q 1 ? 10  ? 3TKZ   1 ? 10  ? 1 10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3TKZ GLY A 1 ? UNP Q06124 ? ? 'expression tag' -2 1 
1 3TKZ SER A 2 ? UNP Q06124 ? ? 'expression tag' -1 2 
1 3TKZ HIS A 3 ? UNP Q06124 ? ? 'expression tag' 0  3 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2130 ? 
1 MORE         -22  ? 
1 'SSA (A^2)'  5700 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 ? 
0 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 15 ? GLY A 27 ? THR A 12 GLY A 24 1 ? 13 
HELX_P HELX_P2 2 THR A 76 ? HIS A 87 ? THR A 73 HIS A 84 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? B ILE 3 C ? ? ? 1_555 B PTR 4 N ? ? P ILE 3 P PTR 4 1_555 ? ? ? ? ? ? ? 1.342 ? ? 
covale2 covale both ? B PTR 4 C ? ? ? 1_555 B PHE 5 N ? ? P PTR 4 P PHE 5 1_555 ? ? ? ? ? ? ? 1.309 ? ? 
covale3 covale both ? C ILE 3 C ? ? ? 1_555 C PTR 4 N ? ? Q ILE 3 Q PTR 4 1_555 ? ? ? ? ? ? ? 1.346 ? ? 
covale4 covale both ? C PTR 4 C ? ? ? 1_555 C PHE 5 N ? ? Q PTR 4 Q PHE 5 1_555 ? ? ? ? ? ? ? 1.322 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 PTR B 4 ? . . . . PTR P 4 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' 
2 PTR C 4 ? . . . . PTR Q 4 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 7  A . ? ARG 4  A ARG 8  A ? ARG 5  A 1 18.07 
2 ASN 95 A . ? ASN 92 A GLY 96 A ? GLY 93 A 1 10.93 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 1 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 66  ? ASP A 67  ? TYR A 63  ASP A 64  
A 2 ALA A 53  ? ASN A 61  ? ALA A 50  ASN A 58  
A 3 PHE A 44  ? ARG A 50  ? PHE A 41  ARG A 47  
A 4 SER A 31  ? PRO A 36  ? SER A 28  PRO A 33  
A 5 TYR A 103 ? PRO A 104 ? TYR A 100 PRO A 101 
B 1 LEU A 91  ? GLU A 93  ? LEU A 88  GLU A 90  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ASP A 67 ? O ASP A 64 N GLN A 60  ? N GLN A 57  
A 2 3 O ILE A 57 ? O ILE A 54 N LEU A 46  ? N LEU A 43  
A 3 4 O ARG A 49 ? O ARG A 46 N SER A 31  ? N SER A 28  
A 4 5 N PHE A 32 ? N PHE A 29 O TYR A 103 ? O TYR A 100 
# 
_pdbx_entry_details.entry_id                   3TKZ 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 OE2 A GLU 76 ? ? 1_555 OE2 A GLU 76 ? ? 7_555 0.99 
2 1 CD  A GLU 76 ? ? 1_555 OE2 A GLU 76 ? ? 7_555 2.18 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              64 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              64 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              64 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                124.13 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            5.83 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 91 ? ? -67.63  19.64 
2 1 ASN A 92 ? ? -177.65 33.28 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B PTR 4 P PTR 4 ? TYR O-PHOSPHOTYROSINE 
2 C PTR 4 Q PTR 4 ? TYR O-PHOSPHOTYROSINE 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     167 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 4.3280  26.7700 11.0270 0.1816 0.2177 0.2268 0.0149  0.0536 0.0131  6.7029 7.6224 18.7069 0.9577 
-3.7751 5.4317  0.5925  0.2835  0.5659  -0.0385 -0.5522 0.0884  -1.0321 -0.8278 -0.0403 
'X-RAY DIFFRACTION' 2 ? refined 1.2560  24.0480 22.5780 0.3023 0.3232 0.1495 -0.1626 0.1130 -0.1118 9.4046 7.8926 3.2981  6.3330 
-1.0112 0.6101  0.5100  -0.9650 0.6350  0.2458  -0.2827 0.7107  -0.8073 0.5294  -0.2274 
'X-RAY DIFFRACTION' 3 ? refined 8.0600  19.7350 18.5610 0.1357 0.4002 0.1379 -0.0911 0.0288 0.0380  4.7631 2.1978 2.9983  2.3145 
-0.6914 -0.1741 0.2107  -0.5491 0.0255  0.1815  -0.4404 0.1762  -0.2377 0.7722  0.2297  
'X-RAY DIFFRACTION' 4 ? refined 19.7060 18.9930 8.8010  0.0905 0.2471 0.2351 -0.0181 0.0074 0.1179  3.1009 1.3255 2.9968  1.8937 
-0.4768 0.0295  0.1125  -0.5317 -0.2698 -0.1184 -0.1985 -0.2925 -0.0988 0.1152  0.0860  
'X-RAY DIFFRACTION' 5 ? refined 10.3330 14.8570 5.3310  0.1466 0.1802 0.1767 -0.0070 0.0141 0.0398  3.5334 8.0975 1.9688  2.7493 
-2.2905 -0.0203 -0.1452 -0.0318 -0.2625 -0.1871 -0.1053 -0.1827 0.0344  -0.0375 0.2505  
'X-RAY DIFFRACTION' 6 ? refined 11.3830 5.3400  15.7090 0.2259 0.3879 0.4733 -0.0505 0.0310 0.4282  9.1190 5.2815 26.2324 0.5141 
-2.9926 -4.5675 -0.1402 -1.5718 -1.9338 0.1266  0.0009  -0.0498 1.4490  -0.3029 0.1393  
'X-RAY DIFFRACTION' 7 ? refined 1.9900  14.1230 13.0600 0.0973 0.2312 0.3249 0.0014  0.0121 0.0068  6.3435 2.8936 4.9276  3.6393 
-1.2723 -0.5997 -0.0730 -0.2035 -0.4136 -0.1641 -0.2987 0.2708  -0.1339 0.1537  0.3717  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 4  ? ? A 10  ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 11 ? ? A 23  ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 24 ? ? A 53  ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 A 54 ? ? A 73  ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 A 74 ? ? A 83  ? ? ? ? 
'X-RAY DIFFRACTION' 6 6 A 84 ? ? A 95  ? ? ? ? 
'X-RAY DIFFRACTION' 7 7 A 96 ? ? A 103 ? ? ? ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2  ? A GLY 1   
2  1 Y 1 A SER -1  ? A SER 2   
3  1 Y 1 A HIS 0   ? A HIS 3   
4  1 Y 1 A MET 1   ? A MET 4   
5  1 Y 1 A THR 2   ? A THR 5   
6  1 Y 1 A SER 3   ? A SER 6   
7  1 Y 1 A CYS 104 ? A CYS 107 
8  1 Y 1 A ALA 105 ? A ALA 108 
9  1 Y 1 A ASP 106 ? A ASP 109 
10 1 Y 1 P ARG 1   ? B ARG 1   
11 1 Y 1 P ASN 9   ? B ASN 9   
12 1 Y 1 P ARG 10  ? B ARG 10  
13 1 Y 1 Q ARG 1   ? C ARG 1   
14 1 Y 1 Q LEU 8   ? C LEU 8   
15 1 Y 1 Q ASN 9   ? C ASN 9   
16 1 Y 1 Q ARG 10  ? C ARG 10  
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
HOH O    O N N 158 
HOH H1   H N N 159 
HOH H2   H N N 160 
ILE N    N N N 161 
ILE CA   C N S 162 
ILE C    C N N 163 
ILE O    O N N 164 
ILE CB   C N S 165 
ILE CG1  C N N 166 
ILE CG2  C N N 167 
ILE CD1  C N N 168 
ILE OXT  O N N 169 
ILE H    H N N 170 
ILE H2   H N N 171 
ILE HA   H N N 172 
ILE HB   H N N 173 
ILE HG12 H N N 174 
ILE HG13 H N N 175 
ILE HG21 H N N 176 
ILE HG22 H N N 177 
ILE HG23 H N N 178 
ILE HD11 H N N 179 
ILE HD12 H N N 180 
ILE HD13 H N N 181 
ILE HXT  H N N 182 
LEU N    N N N 183 
LEU CA   C N S 184 
LEU C    C N N 185 
LEU O    O N N 186 
LEU CB   C N N 187 
LEU CG   C N N 188 
LEU CD1  C N N 189 
LEU CD2  C N N 190 
LEU OXT  O N N 191 
LEU H    H N N 192 
LEU H2   H N N 193 
LEU HA   H N N 194 
LEU HB2  H N N 195 
LEU HB3  H N N 196 
LEU HG   H N N 197 
LEU HD11 H N N 198 
LEU HD12 H N N 199 
LEU HD13 H N N 200 
LEU HD21 H N N 201 
LEU HD22 H N N 202 
LEU HD23 H N N 203 
LEU HXT  H N N 204 
LYS N    N N N 205 
LYS CA   C N S 206 
LYS C    C N N 207 
LYS O    O N N 208 
LYS CB   C N N 209 
LYS CG   C N N 210 
LYS CD   C N N 211 
LYS CE   C N N 212 
LYS NZ   N N N 213 
LYS OXT  O N N 214 
LYS H    H N N 215 
LYS H2   H N N 216 
LYS HA   H N N 217 
LYS HB2  H N N 218 
LYS HB3  H N N 219 
LYS HG2  H N N 220 
LYS HG3  H N N 221 
LYS HD2  H N N 222 
LYS HD3  H N N 223 
LYS HE2  H N N 224 
LYS HE3  H N N 225 
LYS HZ1  H N N 226 
LYS HZ2  H N N 227 
LYS HZ3  H N N 228 
LYS HXT  H N N 229 
MET N    N N N 230 
MET CA   C N S 231 
MET C    C N N 232 
MET O    O N N 233 
MET CB   C N N 234 
MET CG   C N N 235 
MET SD   S N N 236 
MET CE   C N N 237 
MET OXT  O N N 238 
MET H    H N N 239 
MET H2   H N N 240 
MET HA   H N N 241 
MET HB2  H N N 242 
MET HB3  H N N 243 
MET HG2  H N N 244 
MET HG3  H N N 245 
MET HE1  H N N 246 
MET HE2  H N N 247 
MET HE3  H N N 248 
MET HXT  H N N 249 
PHE N    N N N 250 
PHE CA   C N S 251 
PHE C    C N N 252 
PHE O    O N N 253 
PHE CB   C N N 254 
PHE CG   C Y N 255 
PHE CD1  C Y N 256 
PHE CD2  C Y N 257 
PHE CE1  C Y N 258 
PHE CE2  C Y N 259 
PHE CZ   C Y N 260 
PHE OXT  O N N 261 
PHE H    H N N 262 
PHE H2   H N N 263 
PHE HA   H N N 264 
PHE HB2  H N N 265 
PHE HB3  H N N 266 
PHE HD1  H N N 267 
PHE HD2  H N N 268 
PHE HE1  H N N 269 
PHE HE2  H N N 270 
PHE HZ   H N N 271 
PHE HXT  H N N 272 
PRO N    N N N 273 
PRO CA   C N S 274 
PRO C    C N N 275 
PRO O    O N N 276 
PRO CB   C N N 277 
PRO CG   C N N 278 
PRO CD   C N N 279 
PRO OXT  O N N 280 
PRO H    H N N 281 
PRO HA   H N N 282 
PRO HB2  H N N 283 
PRO HB3  H N N 284 
PRO HG2  H N N 285 
PRO HG3  H N N 286 
PRO HD2  H N N 287 
PRO HD3  H N N 288 
PRO HXT  H N N 289 
PTR N    N N N 290 
PTR CA   C N S 291 
PTR C    C N N 292 
PTR O    O N N 293 
PTR OXT  O N N 294 
PTR CB   C N N 295 
PTR CG   C Y N 296 
PTR CD1  C Y N 297 
PTR CD2  C Y N 298 
PTR CE1  C Y N 299 
PTR CE2  C Y N 300 
PTR CZ   C Y N 301 
PTR OH   O N N 302 
PTR P    P N N 303 
PTR O1P  O N N 304 
PTR O2P  O N N 305 
PTR O3P  O N N 306 
PTR H    H N N 307 
PTR H2   H N N 308 
PTR HA   H N N 309 
PTR HXT  H N N 310 
PTR HB2  H N N 311 
PTR HB3  H N N 312 
PTR HD1  H N N 313 
PTR HD2  H N N 314 
PTR HE1  H N N 315 
PTR HE2  H N N 316 
PTR HO2P H N N 317 
PTR HO3P H N N 318 
SER N    N N N 319 
SER CA   C N S 320 
SER C    C N N 321 
SER O    O N N 322 
SER CB   C N N 323 
SER OG   O N N 324 
SER OXT  O N N 325 
SER H    H N N 326 
SER H2   H N N 327 
SER HA   H N N 328 
SER HB2  H N N 329 
SER HB3  H N N 330 
SER HG   H N N 331 
SER HXT  H N N 332 
THR N    N N N 333 
THR CA   C N S 334 
THR C    C N N 335 
THR O    O N N 336 
THR CB   C N R 337 
THR OG1  O N N 338 
THR CG2  C N N 339 
THR OXT  O N N 340 
THR H    H N N 341 
THR H2   H N N 342 
THR HA   H N N 343 
THR HB   H N N 344 
THR HG1  H N N 345 
THR HG21 H N N 346 
THR HG22 H N N 347 
THR HG23 H N N 348 
THR HXT  H N N 349 
TRP N    N N N 350 
TRP CA   C N S 351 
TRP C    C N N 352 
TRP O    O N N 353 
TRP CB   C N N 354 
TRP CG   C Y N 355 
TRP CD1  C Y N 356 
TRP CD2  C Y N 357 
TRP NE1  N Y N 358 
TRP CE2  C Y N 359 
TRP CE3  C Y N 360 
TRP CZ2  C Y N 361 
TRP CZ3  C Y N 362 
TRP CH2  C Y N 363 
TRP OXT  O N N 364 
TRP H    H N N 365 
TRP H2   H N N 366 
TRP HA   H N N 367 
TRP HB2  H N N 368 
TRP HB3  H N N 369 
TRP HD1  H N N 370 
TRP HE1  H N N 371 
TRP HE3  H N N 372 
TRP HZ2  H N N 373 
TRP HZ3  H N N 374 
TRP HH2  H N N 375 
TRP HXT  H N N 376 
TYR N    N N N 377 
TYR CA   C N S 378 
TYR C    C N N 379 
TYR O    O N N 380 
TYR CB   C N N 381 
TYR CG   C Y N 382 
TYR CD1  C Y N 383 
TYR CD2  C Y N 384 
TYR CE1  C Y N 385 
TYR CE2  C Y N 386 
TYR CZ   C Y N 387 
TYR OH   O N N 388 
TYR OXT  O N N 389 
TYR H    H N N 390 
TYR H2   H N N 391 
TYR HA   H N N 392 
TYR HB2  H N N 393 
TYR HB3  H N N 394 
TYR HD1  H N N 395 
TYR HD2  H N N 396 
TYR HE1  H N N 397 
TYR HE2  H N N 398 
TYR HH   H N N 399 
TYR HXT  H N N 400 
VAL N    N N N 401 
VAL CA   C N S 402 
VAL C    C N N 403 
VAL O    O N N 404 
VAL CB   C N N 405 
VAL CG1  C N N 406 
VAL CG2  C N N 407 
VAL OXT  O N N 408 
VAL H    H N N 409 
VAL H2   H N N 410 
VAL HA   H N N 411 
VAL HB   H N N 412 
VAL HG11 H N N 413 
VAL HG12 H N N 414 
VAL HG13 H N N 415 
VAL HG21 H N N 416 
VAL HG22 H N N 417 
VAL HG23 H N N 418 
VAL HXT  H N N 419 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
HOH O   H1   sing N N 150 
HOH O   H2   sing N N 151 
ILE N   CA   sing N N 152 
ILE N   H    sing N N 153 
ILE N   H2   sing N N 154 
ILE CA  C    sing N N 155 
ILE CA  CB   sing N N 156 
ILE CA  HA   sing N N 157 
ILE C   O    doub N N 158 
ILE C   OXT  sing N N 159 
ILE CB  CG1  sing N N 160 
ILE CB  CG2  sing N N 161 
ILE CB  HB   sing N N 162 
ILE CG1 CD1  sing N N 163 
ILE CG1 HG12 sing N N 164 
ILE CG1 HG13 sing N N 165 
ILE CG2 HG21 sing N N 166 
ILE CG2 HG22 sing N N 167 
ILE CG2 HG23 sing N N 168 
ILE CD1 HD11 sing N N 169 
ILE CD1 HD12 sing N N 170 
ILE CD1 HD13 sing N N 171 
ILE OXT HXT  sing N N 172 
LEU N   CA   sing N N 173 
LEU N   H    sing N N 174 
LEU N   H2   sing N N 175 
LEU CA  C    sing N N 176 
LEU CA  CB   sing N N 177 
LEU CA  HA   sing N N 178 
LEU C   O    doub N N 179 
LEU C   OXT  sing N N 180 
LEU CB  CG   sing N N 181 
LEU CB  HB2  sing N N 182 
LEU CB  HB3  sing N N 183 
LEU CG  CD1  sing N N 184 
LEU CG  CD2  sing N N 185 
LEU CG  HG   sing N N 186 
LEU CD1 HD11 sing N N 187 
LEU CD1 HD12 sing N N 188 
LEU CD1 HD13 sing N N 189 
LEU CD2 HD21 sing N N 190 
LEU CD2 HD22 sing N N 191 
LEU CD2 HD23 sing N N 192 
LEU OXT HXT  sing N N 193 
LYS N   CA   sing N N 194 
LYS N   H    sing N N 195 
LYS N   H2   sing N N 196 
LYS CA  C    sing N N 197 
LYS CA  CB   sing N N 198 
LYS CA  HA   sing N N 199 
LYS C   O    doub N N 200 
LYS C   OXT  sing N N 201 
LYS CB  CG   sing N N 202 
LYS CB  HB2  sing N N 203 
LYS CB  HB3  sing N N 204 
LYS CG  CD   sing N N 205 
LYS CG  HG2  sing N N 206 
LYS CG  HG3  sing N N 207 
LYS CD  CE   sing N N 208 
LYS CD  HD2  sing N N 209 
LYS CD  HD3  sing N N 210 
LYS CE  NZ   sing N N 211 
LYS CE  HE2  sing N N 212 
LYS CE  HE3  sing N N 213 
LYS NZ  HZ1  sing N N 214 
LYS NZ  HZ2  sing N N 215 
LYS NZ  HZ3  sing N N 216 
LYS OXT HXT  sing N N 217 
MET N   CA   sing N N 218 
MET N   H    sing N N 219 
MET N   H2   sing N N 220 
MET CA  C    sing N N 221 
MET CA  CB   sing N N 222 
MET CA  HA   sing N N 223 
MET C   O    doub N N 224 
MET C   OXT  sing N N 225 
MET CB  CG   sing N N 226 
MET CB  HB2  sing N N 227 
MET CB  HB3  sing N N 228 
MET CG  SD   sing N N 229 
MET CG  HG2  sing N N 230 
MET CG  HG3  sing N N 231 
MET SD  CE   sing N N 232 
MET CE  HE1  sing N N 233 
MET CE  HE2  sing N N 234 
MET CE  HE3  sing N N 235 
MET OXT HXT  sing N N 236 
PHE N   CA   sing N N 237 
PHE N   H    sing N N 238 
PHE N   H2   sing N N 239 
PHE CA  C    sing N N 240 
PHE CA  CB   sing N N 241 
PHE CA  HA   sing N N 242 
PHE C   O    doub N N 243 
PHE C   OXT  sing N N 244 
PHE CB  CG   sing N N 245 
PHE CB  HB2  sing N N 246 
PHE CB  HB3  sing N N 247 
PHE CG  CD1  doub Y N 248 
PHE CG  CD2  sing Y N 249 
PHE CD1 CE1  sing Y N 250 
PHE CD1 HD1  sing N N 251 
PHE CD2 CE2  doub Y N 252 
PHE CD2 HD2  sing N N 253 
PHE CE1 CZ   doub Y N 254 
PHE CE1 HE1  sing N N 255 
PHE CE2 CZ   sing Y N 256 
PHE CE2 HE2  sing N N 257 
PHE CZ  HZ   sing N N 258 
PHE OXT HXT  sing N N 259 
PRO N   CA   sing N N 260 
PRO N   CD   sing N N 261 
PRO N   H    sing N N 262 
PRO CA  C    sing N N 263 
PRO CA  CB   sing N N 264 
PRO CA  HA   sing N N 265 
PRO C   O    doub N N 266 
PRO C   OXT  sing N N 267 
PRO CB  CG   sing N N 268 
PRO CB  HB2  sing N N 269 
PRO CB  HB3  sing N N 270 
PRO CG  CD   sing N N 271 
PRO CG  HG2  sing N N 272 
PRO CG  HG3  sing N N 273 
PRO CD  HD2  sing N N 274 
PRO CD  HD3  sing N N 275 
PRO OXT HXT  sing N N 276 
PTR N   CA   sing N N 277 
PTR N   H    sing N N 278 
PTR N   H2   sing N N 279 
PTR CA  C    sing N N 280 
PTR CA  CB   sing N N 281 
PTR CA  HA   sing N N 282 
PTR C   O    doub N N 283 
PTR C   OXT  sing N N 284 
PTR OXT HXT  sing N N 285 
PTR CB  CG   sing N N 286 
PTR CB  HB2  sing N N 287 
PTR CB  HB3  sing N N 288 
PTR CG  CD1  doub Y N 289 
PTR CG  CD2  sing Y N 290 
PTR CD1 CE1  sing Y N 291 
PTR CD1 HD1  sing N N 292 
PTR CD2 CE2  doub Y N 293 
PTR CD2 HD2  sing N N 294 
PTR CE1 CZ   doub Y N 295 
PTR CE1 HE1  sing N N 296 
PTR CE2 CZ   sing Y N 297 
PTR CE2 HE2  sing N N 298 
PTR CZ  OH   sing N N 299 
PTR OH  P    sing N N 300 
PTR P   O1P  doub N N 301 
PTR P   O2P  sing N N 302 
PTR P   O3P  sing N N 303 
PTR O2P HO2P sing N N 304 
PTR O3P HO3P sing N N 305 
SER N   CA   sing N N 306 
SER N   H    sing N N 307 
SER N   H2   sing N N 308 
SER CA  C    sing N N 309 
SER CA  CB   sing N N 310 
SER CA  HA   sing N N 311 
SER C   O    doub N N 312 
SER C   OXT  sing N N 313 
SER CB  OG   sing N N 314 
SER CB  HB2  sing N N 315 
SER CB  HB3  sing N N 316 
SER OG  HG   sing N N 317 
SER OXT HXT  sing N N 318 
THR N   CA   sing N N 319 
THR N   H    sing N N 320 
THR N   H2   sing N N 321 
THR CA  C    sing N N 322 
THR CA  CB   sing N N 323 
THR CA  HA   sing N N 324 
THR C   O    doub N N 325 
THR C   OXT  sing N N 326 
THR CB  OG1  sing N N 327 
THR CB  CG2  sing N N 328 
THR CB  HB   sing N N 329 
THR OG1 HG1  sing N N 330 
THR CG2 HG21 sing N N 331 
THR CG2 HG22 sing N N 332 
THR CG2 HG23 sing N N 333 
THR OXT HXT  sing N N 334 
TRP N   CA   sing N N 335 
TRP N   H    sing N N 336 
TRP N   H2   sing N N 337 
TRP CA  C    sing N N 338 
TRP CA  CB   sing N N 339 
TRP CA  HA   sing N N 340 
TRP C   O    doub N N 341 
TRP C   OXT  sing N N 342 
TRP CB  CG   sing N N 343 
TRP CB  HB2  sing N N 344 
TRP CB  HB3  sing N N 345 
TRP CG  CD1  doub Y N 346 
TRP CG  CD2  sing Y N 347 
TRP CD1 NE1  sing Y N 348 
TRP CD1 HD1  sing N N 349 
TRP CD2 CE2  doub Y N 350 
TRP CD2 CE3  sing Y N 351 
TRP NE1 CE2  sing Y N 352 
TRP NE1 HE1  sing N N 353 
TRP CE2 CZ2  sing Y N 354 
TRP CE3 CZ3  doub Y N 355 
TRP CE3 HE3  sing N N 356 
TRP CZ2 CH2  doub Y N 357 
TRP CZ2 HZ2  sing N N 358 
TRP CZ3 CH2  sing Y N 359 
TRP CZ3 HZ3  sing N N 360 
TRP CH2 HH2  sing N N 361 
TRP OXT HXT  sing N N 362 
TYR N   CA   sing N N 363 
TYR N   H    sing N N 364 
TYR N   H2   sing N N 365 
TYR CA  C    sing N N 366 
TYR CA  CB   sing N N 367 
TYR CA  HA   sing N N 368 
TYR C   O    doub N N 369 
TYR C   OXT  sing N N 370 
TYR CB  CG   sing N N 371 
TYR CB  HB2  sing N N 372 
TYR CB  HB3  sing N N 373 
TYR CG  CD1  doub Y N 374 
TYR CG  CD2  sing Y N 375 
TYR CD1 CE1  sing Y N 376 
TYR CD1 HD1  sing N N 377 
TYR CD2 CE2  doub Y N 378 
TYR CD2 HD2  sing N N 379 
TYR CE1 CZ   doub Y N 380 
TYR CE1 HE1  sing N N 381 
TYR CE2 CZ   sing Y N 382 
TYR CE2 HE2  sing N N 383 
TYR CZ  OH   sing N N 384 
TYR OH  HH   sing N N 385 
TYR OXT HXT  sing N N 386 
VAL N   CA   sing N N 387 
VAL N   H    sing N N 388 
VAL N   H2   sing N N 389 
VAL CA  C    sing N N 390 
VAL CA  CB   sing N N 391 
VAL CA  HA   sing N N 392 
VAL C   O    doub N N 393 
VAL C   OXT  sing N N 394 
VAL CB  CG1  sing N N 395 
VAL CB  CG2  sing N N 396 
VAL CB  HB   sing N N 397 
VAL CG1 HG11 sing N N 398 
VAL CG1 HG12 sing N N 399 
VAL CG1 HG13 sing N N 400 
VAL CG2 HG21 sing N N 401 
VAL CG2 HG22 sing N N 402 
VAL CG2 HG23 sing N N 403 
VAL OXT HXT  sing N N 404 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   1AYD 
_pdbx_initial_refinement_model.details          'PDB entry 1AYD' 
# 
_atom_sites.entry_id                    3TKZ 
_atom_sites.fract_transf_matrix[1][1]   0.015907 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015907 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013276 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_