data_3VN9 # _entry.id 3VN9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3VN9 pdb_00003vn9 10.2210/pdb3vn9/pdb RCSB RCSB095257 ? ? WWPDB D_1000095257 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2012-02-29 _pdbx_database_PDB_obs_spr.pdb_id 3VN9 _pdbx_database_PDB_obs_spr.replace_pdb_id 3AN0 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3VN9 _pdbx_database_status.recvd_initial_deposition_date 2012-01-05 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kinoshita, T.' 1 'Matsuzaka, H.' 2 'Nakai, R.' 3 'Kirii, Y.' 4 'Yokota, K.' 5 'Tada, T.' 6 'Matsumoto, T.' 7 # _citation.id primary _citation.title 'Crystal structure of non-phosphorylated MAP2K6 in a putative auto-inhibition state' _citation.journal_abbrev J.Biochem. _citation.journal_volume 151 _citation.page_first 541 _citation.page_last 549 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country JP _citation.journal_id_ISSN 0021-924X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22383536 _citation.pdbx_database_id_DOI 10.1093/jb/mvs023 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Matsumoto, T.' 1 ? primary 'Kinoshita, T.' 2 ? primary 'Matsuzaka, H.' 3 ? primary 'Nakai, R.' 4 ? primary 'Kirii, Y.' 5 ? primary 'Yokota, K.' 6 ? primary 'Tada, T.' 7 ? # _cell.entry_id 3VN9 _cell.length_a 83.456 _cell.length_b 83.456 _cell.length_c 101.153 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3VN9 _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dual specificity mitogen-activated protein kinase kinase 6' 38369.195 1 2.7.12.2 ? ? ? 2 non-polymer syn '9-{5-O-[(R)-hydroxy{[(S)-hydroxy(phosphonoamino)phosphoryl]oxy}phosphoryl]-beta-L-ribofuranosyl}-9H-purin-6-amine' 506.196 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 18 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MAP kinase kinase 6, MAPKK 6, MAPK/ERK kinase 6, MEK 6, Stress-activated protein kinase kinase 3, SAPK kinase 3, SAPKK-3, SAPKK3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMA VKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAV SIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESK GTDVASFVKLILGDHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMA VKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAV SIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESK GTDVASFVKLILGDHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLN n 1 4 SER n 1 5 LYS n 1 6 GLY n 1 7 LYS n 1 8 LYS n 1 9 ARG n 1 10 ASN n 1 11 PRO n 1 12 GLY n 1 13 LEU n 1 14 LYS n 1 15 ILE n 1 16 PRO n 1 17 LYS n 1 18 GLU n 1 19 ALA n 1 20 PHE n 1 21 GLU n 1 22 GLN n 1 23 PRO n 1 24 GLN n 1 25 THR n 1 26 SER n 1 27 SER n 1 28 THR n 1 29 PRO n 1 30 PRO n 1 31 ARG n 1 32 ASP n 1 33 LEU n 1 34 ASP n 1 35 SER n 1 36 LYS n 1 37 ALA n 1 38 CYS n 1 39 ILE n 1 40 SER n 1 41 ILE n 1 42 GLY n 1 43 ASN n 1 44 GLN n 1 45 ASN n 1 46 PHE n 1 47 GLU n 1 48 VAL n 1 49 LYS n 1 50 ALA n 1 51 ASP n 1 52 ASP n 1 53 LEU n 1 54 GLU n 1 55 PRO n 1 56 ILE n 1 57 MET n 1 58 GLU n 1 59 LEU n 1 60 GLY n 1 61 ARG n 1 62 GLY n 1 63 ALA n 1 64 TYR n 1 65 GLY n 1 66 VAL n 1 67 VAL n 1 68 GLU n 1 69 LYS n 1 70 MET n 1 71 ARG n 1 72 HIS n 1 73 VAL n 1 74 PRO n 1 75 SER n 1 76 GLY n 1 77 GLN n 1 78 ILE n 1 79 MET n 1 80 ALA n 1 81 VAL n 1 82 LYS n 1 83 ARG n 1 84 ILE n 1 85 ARG n 1 86 ALA n 1 87 THR n 1 88 VAL n 1 89 ASN n 1 90 SER n 1 91 GLN n 1 92 GLU n 1 93 GLN n 1 94 LYS n 1 95 ARG n 1 96 LEU n 1 97 LEU n 1 98 MET n 1 99 ASP n 1 100 LEU n 1 101 ASP n 1 102 ILE n 1 103 SER n 1 104 MET n 1 105 ARG n 1 106 THR n 1 107 VAL n 1 108 ASP n 1 109 CYS n 1 110 PRO n 1 111 PHE n 1 112 THR n 1 113 VAL n 1 114 THR n 1 115 PHE n 1 116 TYR n 1 117 GLY n 1 118 ALA n 1 119 LEU n 1 120 PHE n 1 121 ARG n 1 122 GLU n 1 123 GLY n 1 124 ASP n 1 125 VAL n 1 126 TRP n 1 127 ILE n 1 128 CYS n 1 129 MET n 1 130 GLU n 1 131 LEU n 1 132 MET n 1 133 ASP n 1 134 THR n 1 135 SER n 1 136 LEU n 1 137 ASP n 1 138 LYS n 1 139 PHE n 1 140 TYR n 1 141 LYS n 1 142 GLN n 1 143 VAL n 1 144 ILE n 1 145 ASP n 1 146 LYS n 1 147 GLY n 1 148 GLN n 1 149 THR n 1 150 ILE n 1 151 PRO n 1 152 GLU n 1 153 ASP n 1 154 ILE n 1 155 LEU n 1 156 GLY n 1 157 LYS n 1 158 ILE n 1 159 ALA n 1 160 VAL n 1 161 SER n 1 162 ILE n 1 163 VAL n 1 164 LYS n 1 165 ALA n 1 166 LEU n 1 167 GLU n 1 168 HIS n 1 169 LEU n 1 170 HIS n 1 171 SER n 1 172 LYS n 1 173 LEU n 1 174 SER n 1 175 VAL n 1 176 ILE n 1 177 HIS n 1 178 ARG n 1 179 ASP n 1 180 VAL n 1 181 LYS n 1 182 PRO n 1 183 SER n 1 184 ASN n 1 185 VAL n 1 186 LEU n 1 187 ILE n 1 188 ASN n 1 189 ALA n 1 190 LEU n 1 191 GLY n 1 192 GLN n 1 193 VAL n 1 194 LYS n 1 195 MET n 1 196 CYS n 1 197 ASP n 1 198 PHE n 1 199 GLY n 1 200 ILE n 1 201 SER n 1 202 GLY n 1 203 TYR n 1 204 LEU n 1 205 VAL n 1 206 ASP n 1 207 SER n 1 208 VAL n 1 209 ALA n 1 210 LYS n 1 211 THR n 1 212 ILE n 1 213 ASP n 1 214 ALA n 1 215 GLY n 1 216 CYS n 1 217 LYS n 1 218 PRO n 1 219 TYR n 1 220 MET n 1 221 ALA n 1 222 PRO n 1 223 GLU n 1 224 ARG n 1 225 ILE n 1 226 ASN n 1 227 PRO n 1 228 GLU n 1 229 LEU n 1 230 ASN n 1 231 GLN n 1 232 LYS n 1 233 GLY n 1 234 TYR n 1 235 SER n 1 236 VAL n 1 237 LYS n 1 238 SER n 1 239 ASP n 1 240 ILE n 1 241 TRP n 1 242 SER n 1 243 LEU n 1 244 GLY n 1 245 ILE n 1 246 THR n 1 247 MET n 1 248 ILE n 1 249 GLU n 1 250 LEU n 1 251 ALA n 1 252 ILE n 1 253 LEU n 1 254 ARG n 1 255 PHE n 1 256 PRO n 1 257 TYR n 1 258 ASP n 1 259 SER n 1 260 TRP n 1 261 GLY n 1 262 THR n 1 263 PRO n 1 264 PHE n 1 265 GLN n 1 266 GLN n 1 267 LEU n 1 268 LYS n 1 269 GLN n 1 270 VAL n 1 271 VAL n 1 272 GLU n 1 273 GLU n 1 274 PRO n 1 275 SER n 1 276 PRO n 1 277 GLN n 1 278 LEU n 1 279 PRO n 1 280 ALA n 1 281 ASP n 1 282 LYS n 1 283 PHE n 1 284 SER n 1 285 ALA n 1 286 GLU n 1 287 PHE n 1 288 VAL n 1 289 ASP n 1 290 PHE n 1 291 THR n 1 292 SER n 1 293 GLN n 1 294 CYS n 1 295 LEU n 1 296 LYS n 1 297 LYS n 1 298 ASN n 1 299 SER n 1 300 LYS n 1 301 GLU n 1 302 ARG n 1 303 PRO n 1 304 THR n 1 305 TYR n 1 306 PRO n 1 307 GLU n 1 308 LEU n 1 309 MET n 1 310 GLN n 1 311 HIS n 1 312 PRO n 1 313 PHE n 1 314 PHE n 1 315 THR n 1 316 LEU n 1 317 HIS n 1 318 GLU n 1 319 SER n 1 320 LYS n 1 321 GLY n 1 322 THR n 1 323 ASP n 1 324 VAL n 1 325 ALA n 1 326 SER n 1 327 PHE n 1 328 VAL n 1 329 LYS n 1 330 LEU n 1 331 ILE n 1 332 LEU n 1 333 GLY n 1 334 ASP n 1 335 HIS n 1 336 HIS n 1 337 HIS n 1 338 HIS n 1 339 HIS n 1 340 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MAP2K6 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET22(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MP2K6_HUMAN _struct_ref.pdbx_db_accession P52564 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMA VKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAV SIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESK GTDVASFVKLILGD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3VN9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 334 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P52564 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 334 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 334 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3VN9 HIS A 335 ? UNP P52564 ? ? 'expression tag' 335 1 1 3VN9 HIS A 336 ? UNP P52564 ? ? 'expression tag' 336 2 1 3VN9 HIS A 337 ? UNP P52564 ? ? 'expression tag' 337 3 1 3VN9 HIS A 338 ? UNP P52564 ? ? 'expression tag' 338 4 1 3VN9 HIS A 339 ? UNP P52564 ? ? 'expression tag' 339 5 1 3VN9 HIS A 340 ? UNP P52564 ? ? 'expression tag' 340 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ANK non-polymer . '9-{5-O-[(R)-hydroxy{[(S)-hydroxy(phosphonoamino)phosphoryl]oxy}phosphoryl]-beta-L-ribofuranosyl}-9H-purin-6-amine' ? 'C10 H17 N6 O12 P3' 506.196 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3VN9 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_percent_sol 53.59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_details '20% PEG4000, 10% 2-propanol, 0.1mol/L Na-HEPES-HCl, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.pdbx_collection_date 2010-04-28 _diffrn_detector.details MIRROR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-5A' _diffrn_source.pdbx_synchrotron_site 'Photon Factory' _diffrn_source.pdbx_synchrotron_beamline BL-5A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0 # _reflns.entry_id 3VN9 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 20 _reflns.d_resolution_high 2.6 _reflns.number_obs 12124 _reflns.number_all 12124 _reflns.percent_possible_obs 93.9 _reflns.pdbx_Rmerge_I_obs 0.124 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 9.26 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.539 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.1 _reflns_shell.pdbx_redundancy 9.72 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3VN9 _refine.ls_number_reflns_obs 10917 _refine.ls_number_reflns_all 10917 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 2.60 _refine.ls_percent_reflns_obs 93.59 _refine.ls_R_factor_obs 0.26526 _refine.ls_R_factor_all 0.26526 _refine.ls_R_factor_R_work 0.26366 _refine.ls_R_factor_R_free 0.27960 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free 1207 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.940 _refine.correlation_coeff_Fo_to_Fc_free 0.935 _refine.B_iso_mean 98.389 _refine.aniso_B[1][1] 4.88 _refine.aniso_B[2][2] 4.88 _refine.aniso_B[3][3] -7.32 _refine.aniso_B[1][2] 2.44 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][3] -0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.pdbx_starting_model 3eqd _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.355 _refine.overall_SU_ML 0.343 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 17.123 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2272 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 2322 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.030 0.020 ? 2354 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 2.594 1.990 ? 3194 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 7.581 5.000 ? 290 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 38.099 24.842 ? 95 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 21.030 15.000 ? 416 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 18.967 15.000 ? 9 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.145 0.200 ? 361 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.014 0.021 ? 1728 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.600 _refine_ls_shell.d_res_low 2.667 _refine_ls_shell.number_reflns_R_work 771 _refine_ls_shell.R_factor_R_work 0.443 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.455 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 80 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? # _struct.entry_id 3VN9 _struct.title 'Rifined Crystal structure of non-phosphorylated MAP2K6 in a putative auto-inhibition state' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3VN9 _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' _struct_keywords.text ;auto-inhibition state, activation helices, Mitogen-activated protein kinase kinase, AMP-PNP binding, TRANSFERASE-TRANSFERASE INHIBITOR complex ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 90 ? ARG A 105 ? SER A 90 ARG A 105 1 ? 16 HELX_P HELX_P2 2 LEU A 136 ? LYS A 146 ? LEU A 136 LYS A 146 1 ? 11 HELX_P HELX_P3 3 PRO A 151 ? LEU A 173 ? PRO A 151 LEU A 173 1 ? 23 HELX_P HELX_P4 4 GLY A 199 ? VAL A 205 ? GLY A 199 VAL A 205 1 ? 7 HELX_P HELX_P5 5 ASP A 206 ? ASP A 213 ? ASP A 206 ASP A 213 1 ? 8 HELX_P HELX_P6 6 ALA A 221 ? ASN A 226 ? ALA A 221 ASN A 226 1 ? 6 HELX_P HELX_P7 7 SER A 235 ? LEU A 253 ? SER A 235 LEU A 253 1 ? 19 HELX_P HELX_P8 8 THR A 262 ? GLU A 273 ? THR A 262 GLU A 273 1 ? 12 HELX_P HELX_P9 9 PRO A 279 ? PHE A 283 ? PRO A 279 PHE A 283 5 ? 5 HELX_P HELX_P10 10 SER A 284 ? LEU A 295 ? SER A 284 LEU A 295 1 ? 12 HELX_P HELX_P11 11 ASN A 298 ? ARG A 302 ? ASN A 298 ARG A 302 5 ? 5 HELX_P HELX_P12 12 THR A 304 ? MET A 309 ? THR A 304 MET A 309 1 ? 6 HELX_P HELX_P13 13 HIS A 311 ? GLU A 318 ? HIS A 311 GLU A 318 1 ? 8 HELX_P HELX_P14 14 VAL A 324 ? GLY A 333 ? VAL A 324 GLY A 333 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 197 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 197 A MG 402 1_555 ? ? ? ? ? ? ? 2.037 ? ? metalc2 metalc ? ? B ANK . O1A ? ? ? 1_555 C MG . MG ? ? A ANK 401 A MG 402 1_555 ? ? ? ? ? ? ? 1.704 ? ? metalc3 metalc ? ? B ANK . O2B ? ? ? 1_555 C MG . MG ? ? A ANK 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.513 ? ? metalc4 metalc ? ? B ANK . O1G ? ? ? 1_555 C MG . MG ? ? A ANK 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.920 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 46 A . ? PHE 46 A GLU 47 A ? GLU 47 A 1 -1.58 2 LYS 49 A . ? LYS 49 A ALA 50 A ? ALA 50 A 1 -4.92 3 ALA 50 A . ? ALA 50 A ASP 51 A ? ASP 51 A 1 -2.79 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 53 ? ARG A 61 ? LEU A 53 ARG A 61 A 2 GLY A 65 ? HIS A 72 ? GLY A 65 HIS A 72 A 3 GLN A 77 ? ILE A 84 ? GLN A 77 ILE A 84 A 4 VAL A 125 ? MET A 129 ? VAL A 125 MET A 129 A 5 PHE A 115 ? PHE A 120 ? PHE A 115 PHE A 120 B 1 THR A 134 ? SER A 135 ? THR A 134 SER A 135 B 2 VAL A 185 ? ILE A 187 ? VAL A 185 ILE A 187 B 3 VAL A 193 ? MET A 195 ? VAL A 193 MET A 195 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 60 ? N GLY A 60 O VAL A 67 ? O VAL A 67 A 2 3 N MET A 70 ? N MET A 70 O MET A 79 ? O MET A 79 A 3 4 N ILE A 84 ? N ILE A 84 O VAL A 125 ? O VAL A 125 A 4 5 O CYS A 128 ? O CYS A 128 N GLY A 117 ? N GLY A 117 B 1 2 N THR A 134 ? N THR A 134 O ILE A 187 ? O ILE A 187 B 2 3 N LEU A 186 ? N LEU A 186 O LYS A 194 ? O LYS A 194 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ANK 401 ? 19 'BINDING SITE FOR RESIDUE ANK A 401' AC2 Software A MG 402 ? 3 'BINDING SITE FOR RESIDUE MG A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 19 GLY A 60 ? GLY A 60 . ? 1_555 ? 2 AC1 19 ALA A 63 ? ALA A 63 . ? 1_555 ? 3 AC1 19 TYR A 64 ? TYR A 64 . ? 1_555 ? 4 AC1 19 VAL A 67 ? VAL A 67 . ? 1_555 ? 5 AC1 19 ALA A 80 ? ALA A 80 . ? 1_555 ? 6 AC1 19 LYS A 82 ? LYS A 82 . ? 1_555 ? 7 AC1 19 MET A 129 ? MET A 129 . ? 1_555 ? 8 AC1 19 GLU A 130 ? GLU A 130 . ? 1_555 ? 9 AC1 19 MET A 132 ? MET A 132 . ? 1_555 ? 10 AC1 19 SER A 135 ? SER A 135 . ? 1_555 ? 11 AC1 19 LYS A 138 ? LYS A 138 . ? 1_555 ? 12 AC1 19 ASP A 179 ? ASP A 179 . ? 1_555 ? 13 AC1 19 LYS A 181 ? LYS A 181 . ? 1_555 ? 14 AC1 19 SER A 183 ? SER A 183 . ? 1_555 ? 15 AC1 19 ASN A 184 ? ASN A 184 . ? 1_555 ? 16 AC1 19 ASP A 197 ? ASP A 197 . ? 1_555 ? 17 AC1 19 SER A 201 ? SER A 201 . ? 1_555 ? 18 AC1 19 LYS A 210 ? LYS A 210 . ? 1_555 ? 19 AC1 19 MG C . ? MG A 402 . ? 1_555 ? 20 AC2 3 ASN A 184 ? ASN A 184 . ? 1_555 ? 21 AC2 3 ASP A 197 ? ASP A 197 . ? 1_555 ? 22 AC2 3 ANK B . ? ANK A 401 . ? 1_555 ? # _database_PDB_matrix.entry_id 3VN9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3VN9 _atom_sites.fract_transf_matrix[1][1] 0.011982 _atom_sites.fract_transf_matrix[1][2] 0.006918 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013836 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009886 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 ARG 9 9 ? ? ? A . n A 1 10 ASN 10 10 ? ? ? A . n A 1 11 PRO 11 11 ? ? ? A . n A 1 12 GLY 12 12 ? ? ? A . n A 1 13 LEU 13 13 ? ? ? A . n A 1 14 LYS 14 14 ? ? ? A . n A 1 15 ILE 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 LYS 17 17 ? ? ? A . n A 1 18 GLU 18 18 ? ? ? A . n A 1 19 ALA 19 19 ? ? ? A . n A 1 20 PHE 20 20 ? ? ? A . n A 1 21 GLU 21 21 ? ? ? A . n A 1 22 GLN 22 22 ? ? ? A . n A 1 23 PRO 23 23 ? ? ? A . n A 1 24 GLN 24 24 ? ? ? A . n A 1 25 THR 25 25 ? ? ? A . n A 1 26 SER 26 26 ? ? ? A . n A 1 27 SER 27 27 ? ? ? A . n A 1 28 THR 28 28 ? ? ? A . n A 1 29 PRO 29 29 ? ? ? A . n A 1 30 PRO 30 30 ? ? ? A . n A 1 31 ARG 31 31 ? ? ? A . n A 1 32 ASP 32 32 ? ? ? A . n A 1 33 LEU 33 33 ? ? ? A . n A 1 34 ASP 34 34 ? ? ? A . n A 1 35 SER 35 35 ? ? ? A . n A 1 36 LYS 36 36 ? ? ? A . n A 1 37 ALA 37 37 ? ? ? A . n A 1 38 CYS 38 38 ? ? ? A . n A 1 39 ILE 39 39 ? ? ? A . n A 1 40 SER 40 40 ? ? ? A . n A 1 41 ILE 41 41 ? ? ? A . n A 1 42 GLY 42 42 ? ? ? A . n A 1 43 ASN 43 43 ? ? ? A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 MET 132 132 132 MET MET A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 HIS 168 168 168 HIS HIS A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 HIS 170 170 170 HIS HIS A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 ASN 184 184 184 ASN ASN A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ASN 188 188 188 ASN ASN A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 MET 195 195 195 MET MET A . n A 1 196 CYS 196 196 196 CYS CYS A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 PHE 198 198 198 PHE PHE A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 TYR 203 203 203 TYR TYR A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 ASP 206 206 206 ASP ASP A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 ILE 212 212 212 ILE ILE A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 CYS 216 216 216 CYS CYS A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 PRO 218 218 218 PRO PRO A . n A 1 219 TYR 219 219 219 TYR TYR A . n A 1 220 MET 220 220 220 MET MET A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 PRO 222 222 222 PRO PRO A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 ARG 224 224 224 ARG ARG A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 ASN 226 226 226 ASN ASN A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 ASN 230 230 230 ASN ASN A . n A 1 231 GLN 231 231 231 GLN GLN A . n A 1 232 LYS 232 232 232 LYS LYS A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 TYR 234 234 234 TYR TYR A . n A 1 235 SER 235 235 235 SER SER A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 SER 238 238 238 SER SER A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 ILE 240 240 240 ILE ILE A . n A 1 241 TRP 241 241 241 TRP TRP A . n A 1 242 SER 242 242 242 SER SER A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 GLY 244 244 244 GLY GLY A . n A 1 245 ILE 245 245 245 ILE ILE A . n A 1 246 THR 246 246 246 THR THR A . n A 1 247 MET 247 247 247 MET MET A . n A 1 248 ILE 248 248 248 ILE ILE A . n A 1 249 GLU 249 249 249 GLU GLU A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 ALA 251 251 251 ALA ALA A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 LEU 253 253 253 LEU LEU A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 PHE 255 255 255 PHE PHE A . n A 1 256 PRO 256 256 256 PRO PRO A . n A 1 257 TYR 257 257 257 TYR TYR A . n A 1 258 ASP 258 258 258 ASP ASP A . n A 1 259 SER 259 259 259 SER SER A . n A 1 260 TRP 260 260 260 TRP TRP A . n A 1 261 GLY 261 261 261 GLY GLY A . n A 1 262 THR 262 262 262 THR THR A . n A 1 263 PRO 263 263 263 PRO PRO A . n A 1 264 PHE 264 264 264 PHE PHE A . n A 1 265 GLN 265 265 265 GLN GLN A . n A 1 266 GLN 266 266 266 GLN GLN A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 LYS 268 268 268 LYS LYS A . n A 1 269 GLN 269 269 269 GLN GLN A . n A 1 270 VAL 270 270 270 VAL VAL A . n A 1 271 VAL 271 271 271 VAL VAL A . n A 1 272 GLU 272 272 272 GLU GLU A . n A 1 273 GLU 273 273 273 GLU GLU A . n A 1 274 PRO 274 274 274 PRO PRO A . n A 1 275 SER 275 275 275 SER SER A . n A 1 276 PRO 276 276 276 PRO PRO A . n A 1 277 GLN 277 277 277 GLN GLN A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 PRO 279 279 279 PRO PRO A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 ASP 281 281 281 ASP ASP A . n A 1 282 LYS 282 282 282 LYS LYS A . n A 1 283 PHE 283 283 283 PHE PHE A . n A 1 284 SER 284 284 284 SER SER A . n A 1 285 ALA 285 285 285 ALA ALA A . n A 1 286 GLU 286 286 286 GLU GLU A . n A 1 287 PHE 287 287 287 PHE PHE A . n A 1 288 VAL 288 288 288 VAL VAL A . n A 1 289 ASP 289 289 289 ASP ASP A . n A 1 290 PHE 290 290 290 PHE PHE A . n A 1 291 THR 291 291 291 THR THR A . n A 1 292 SER 292 292 292 SER SER A . n A 1 293 GLN 293 293 293 GLN GLN A . n A 1 294 CYS 294 294 294 CYS CYS A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 LYS 296 296 296 LYS LYS A . n A 1 297 LYS 297 297 297 LYS LYS A . n A 1 298 ASN 298 298 298 ASN ASN A . n A 1 299 SER 299 299 299 SER SER A . n A 1 300 LYS 300 300 300 LYS LYS A . n A 1 301 GLU 301 301 301 GLU GLU A . n A 1 302 ARG 302 302 302 ARG ARG A . n A 1 303 PRO 303 303 303 PRO PRO A . n A 1 304 THR 304 304 304 THR THR A . n A 1 305 TYR 305 305 305 TYR TYR A . n A 1 306 PRO 306 306 306 PRO PRO A . n A 1 307 GLU 307 307 307 GLU GLU A . n A 1 308 LEU 308 308 308 LEU LEU A . n A 1 309 MET 309 309 309 MET MET A . n A 1 310 GLN 310 310 310 GLN GLN A . n A 1 311 HIS 311 311 311 HIS HIS A . n A 1 312 PRO 312 312 312 PRO PRO A . n A 1 313 PHE 313 313 313 PHE PHE A . n A 1 314 PHE 314 314 314 PHE PHE A . n A 1 315 THR 315 315 315 THR THR A . n A 1 316 LEU 316 316 316 LEU LEU A . n A 1 317 HIS 317 317 317 HIS HIS A . n A 1 318 GLU 318 318 318 GLU GLU A . n A 1 319 SER 319 319 319 SER SER A . n A 1 320 LYS 320 320 320 LYS LYS A . n A 1 321 GLY 321 321 321 GLY GLY A . n A 1 322 THR 322 322 322 THR THR A . n A 1 323 ASP 323 323 323 ASP ASP A . n A 1 324 VAL 324 324 324 VAL VAL A . n A 1 325 ALA 325 325 325 ALA ALA A . n A 1 326 SER 326 326 326 SER SER A . n A 1 327 PHE 327 327 327 PHE PHE A . n A 1 328 VAL 328 328 328 VAL VAL A . n A 1 329 LYS 329 329 329 LYS LYS A . n A 1 330 LEU 330 330 330 LEU LEU A . n A 1 331 ILE 331 331 331 ILE ILE A . n A 1 332 LEU 332 332 332 LEU LEU A . n A 1 333 GLY 333 333 333 GLY GLY A . n A 1 334 ASP 334 334 334 ASP ASP A . n A 1 335 HIS 335 335 ? ? ? A . n A 1 336 HIS 336 336 ? ? ? A . n A 1 337 HIS 337 337 ? ? ? A . n A 1 338 HIS 338 338 ? ? ? A . n A 1 339 HIS 339 339 ? ? ? A . n A 1 340 HIS 340 340 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ANK 1 401 341 ANK ANK A . C 3 MG 1 402 342 MG MG A . D 4 HOH 1 501 1 HOH HOH A . D 4 HOH 2 502 2 HOH HOH A . D 4 HOH 3 503 3 HOH HOH A . D 4 HOH 4 504 4 HOH HOH A . D 4 HOH 5 505 5 HOH HOH A . D 4 HOH 6 506 6 HOH HOH A . D 4 HOH 7 507 7 HOH HOH A . D 4 HOH 8 508 8 HOH HOH A . D 4 HOH 9 509 9 HOH HOH A . D 4 HOH 10 510 10 HOH HOH A . D 4 HOH 11 511 11 HOH HOH A . D 4 HOH 12 512 12 HOH HOH A . D 4 HOH 13 513 13 HOH HOH A . D 4 HOH 14 514 14 HOH HOH A . D 4 HOH 15 515 15 HOH HOH A . D 4 HOH 16 516 16 HOH HOH A . D 4 HOH 17 517 17 HOH HOH A . D 4 HOH 18 518 18 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 197 ? A ASP 197 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1A ? B ANK . ? A ANK 401 ? 1_555 131.0 ? 2 OD2 ? A ASP 197 ? A ASP 197 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O2B ? B ANK . ? A ANK 401 ? 1_555 117.8 ? 3 O1A ? B ANK . ? A ANK 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O2B ? B ANK . ? A ANK 401 ? 1_555 89.5 ? 4 OD2 ? A ASP 197 ? A ASP 197 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1G ? B ANK . ? A ANK 401 ? 1_555 67.4 ? 5 O1A ? B ANK . ? A ANK 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1G ? B ANK . ? A ANK 401 ? 1_555 91.2 ? 6 O2B ? B ANK . ? A ANK 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1G ? B ANK . ? A ANK 401 ? 1_555 67.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-02-29 2 'Structure model' 1 1 2012-08-08 3 'Structure model' 1 2 2017-11-22 4 'Structure model' 1 3 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' chem_comp_atom 3 4 'Structure model' chem_comp_bond 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_struct_conn_angle 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.name' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_ref_seq_dif.details' 25 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SERGUI 'data collection' . ? 1 MOLREP phasing . ? 2 REFMAC refinement 5.6.0117 ? 3 CrystalClear 'data reduction' . ? 4 CrystalClear 'data scaling' . ? 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 54 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 CG2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 VAL _pdbx_validate_symm_contact.auth_seq_id_2 236 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_445 _pdbx_validate_symm_contact.dist 2.00 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A MET 57 ? ? CA A MET 57 ? ? C A MET 57 ? ? 90.17 111.00 -20.83 2.70 N 2 1 N A GLU 58 ? ? CA A GLU 58 ? ? C A GLU 58 ? ? 94.44 111.00 -16.56 2.70 N 3 1 CA A LEU 59 ? ? CB A LEU 59 ? ? CG A LEU 59 ? ? 134.30 115.30 19.00 2.30 N 4 1 N A GLY 62 ? ? CA A GLY 62 ? ? C A GLY 62 ? ? 92.35 113.10 -20.75 2.50 N 5 1 CA A ALA 63 ? ? C A ALA 63 ? ? N A TYR 64 ? ? 103.84 117.20 -13.36 2.20 Y 6 1 C A ALA 63 ? ? N A TYR 64 ? ? CA A TYR 64 ? ? 140.62 121.70 18.92 2.50 Y 7 1 C A ASN 226 ? ? N A PRO 227 ? ? CD A PRO 227 ? ? 106.31 128.40 -22.09 2.10 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 45 ? ? -112.56 -71.34 2 1 PHE A 46 ? ? 49.95 119.78 3 1 LYS A 49 ? ? -53.95 172.23 4 1 ALA A 50 ? ? -125.66 -154.67 5 1 LEU A 59 ? ? -177.20 72.80 6 1 TYR A 64 ? ? 70.83 -41.77 7 1 ARG A 85 ? ? -41.71 156.51 8 1 ALA A 86 ? ? -41.34 -5.39 9 1 THR A 87 ? ? 43.10 -154.06 10 1 VAL A 88 ? ? -167.55 84.25 11 1 THR A 112 ? ? -90.56 -69.77 12 1 VAL A 113 ? ? 152.61 -43.13 13 1 THR A 114 ? ? 91.14 113.33 14 1 ARG A 121 ? ? -110.22 -120.55 15 1 GLU A 122 ? ? -69.27 65.07 16 1 PHE A 139 ? ? -51.37 -71.02 17 1 TYR A 140 ? ? -52.13 -2.51 18 1 VAL A 143 ? ? -55.61 -70.37 19 1 LEU A 190 ? ? 55.31 -3.45 20 1 PHE A 198 ? ? -66.48 -73.12 21 1 THR A 211 ? ? -99.33 -72.09 22 1 ALA A 214 ? ? -100.99 -122.29 23 1 GLU A 228 ? ? -49.36 106.22 24 1 LEU A 229 ? ? 29.99 -66.62 25 1 PRO A 256 ? ? -56.39 0.11 26 1 SER A 259 ? ? -41.16 -112.35 27 1 LYS A 268 ? ? -39.40 -38.37 28 1 ALA A 280 ? ? -57.15 -72.50 29 1 ASP A 281 ? ? -20.71 -46.08 30 1 SER A 284 ? ? -39.95 125.67 31 1 MET A 309 ? ? -57.56 -9.51 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 SER _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 259 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 TRP _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 260 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -32.89 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 49 ? CG ? A LYS 49 CG 2 1 Y 1 A LYS 49 ? CD ? A LYS 49 CD 3 1 Y 1 A LYS 49 ? CE ? A LYS 49 CE 4 1 Y 1 A LYS 49 ? NZ ? A LYS 49 NZ 5 1 Y 1 A ASP 52 ? CG ? A ASP 52 CG 6 1 Y 1 A ASP 52 ? OD1 ? A ASP 52 OD1 7 1 Y 1 A ASP 52 ? OD2 ? A ASP 52 OD2 8 1 Y 1 A ARG 85 ? CG ? A ARG 85 CG 9 1 Y 1 A ARG 85 ? CD ? A ARG 85 CD 10 1 Y 1 A ARG 85 ? NE ? A ARG 85 NE 11 1 Y 1 A ARG 85 ? CZ ? A ARG 85 CZ 12 1 Y 1 A ARG 85 ? NH1 ? A ARG 85 NH1 13 1 Y 1 A ARG 85 ? NH2 ? A ARG 85 NH2 14 1 Y 1 A GLU 130 ? CG ? A GLU 130 CG 15 1 Y 1 A GLU 130 ? CD ? A GLU 130 CD 16 1 Y 1 A GLU 130 ? OE1 ? A GLU 130 OE1 17 1 Y 1 A GLU 130 ? OE2 ? A GLU 130 OE2 18 1 Y 1 A GLU 152 ? CG ? A GLU 152 CG 19 1 Y 1 A GLU 152 ? CD ? A GLU 152 CD 20 1 Y 1 A GLU 152 ? OE1 ? A GLU 152 OE1 21 1 Y 1 A GLU 152 ? OE2 ? A GLU 152 OE2 22 1 Y 1 A SER 183 ? OG ? A SER 183 OG 23 1 Y 1 A ARG 254 ? CG ? A ARG 254 CG 24 1 Y 1 A ARG 254 ? CD ? A ARG 254 CD 25 1 Y 1 A ARG 254 ? NE ? A ARG 254 NE 26 1 Y 1 A ARG 254 ? CZ ? A ARG 254 CZ 27 1 Y 1 A ARG 254 ? NH1 ? A ARG 254 NH1 28 1 Y 1 A ARG 254 ? NH2 ? A ARG 254 NH2 29 1 Y 1 A GLN 310 ? CG ? A GLN 310 CG 30 1 Y 1 A GLN 310 ? CD ? A GLN 310 CD 31 1 Y 1 A GLN 310 ? OE1 ? A GLN 310 OE1 32 1 Y 1 A GLN 310 ? NE2 ? A GLN 310 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A LYS 8 ? A LYS 8 9 1 Y 1 A ARG 9 ? A ARG 9 10 1 Y 1 A ASN 10 ? A ASN 10 11 1 Y 1 A PRO 11 ? A PRO 11 12 1 Y 1 A GLY 12 ? A GLY 12 13 1 Y 1 A LEU 13 ? A LEU 13 14 1 Y 1 A LYS 14 ? A LYS 14 15 1 Y 1 A ILE 15 ? A ILE 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A LYS 17 ? A LYS 17 18 1 Y 1 A GLU 18 ? A GLU 18 19 1 Y 1 A ALA 19 ? A ALA 19 20 1 Y 1 A PHE 20 ? A PHE 20 21 1 Y 1 A GLU 21 ? A GLU 21 22 1 Y 1 A GLN 22 ? A GLN 22 23 1 Y 1 A PRO 23 ? A PRO 23 24 1 Y 1 A GLN 24 ? A GLN 24 25 1 Y 1 A THR 25 ? A THR 25 26 1 Y 1 A SER 26 ? A SER 26 27 1 Y 1 A SER 27 ? A SER 27 28 1 Y 1 A THR 28 ? A THR 28 29 1 Y 1 A PRO 29 ? A PRO 29 30 1 Y 1 A PRO 30 ? A PRO 30 31 1 Y 1 A ARG 31 ? A ARG 31 32 1 Y 1 A ASP 32 ? A ASP 32 33 1 Y 1 A LEU 33 ? A LEU 33 34 1 Y 1 A ASP 34 ? A ASP 34 35 1 Y 1 A SER 35 ? A SER 35 36 1 Y 1 A LYS 36 ? A LYS 36 37 1 Y 1 A ALA 37 ? A ALA 37 38 1 Y 1 A CYS 38 ? A CYS 38 39 1 Y 1 A ILE 39 ? A ILE 39 40 1 Y 1 A SER 40 ? A SER 40 41 1 Y 1 A ILE 41 ? A ILE 41 42 1 Y 1 A GLY 42 ? A GLY 42 43 1 Y 1 A ASN 43 ? A ASN 43 44 1 Y 1 A HIS 335 ? A HIS 335 45 1 Y 1 A HIS 336 ? A HIS 336 46 1 Y 1 A HIS 337 ? A HIS 337 47 1 Y 1 A HIS 338 ? A HIS 338 48 1 Y 1 A HIS 339 ? A HIS 339 49 1 Y 1 A HIS 340 ? A HIS 340 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ANK N1 N Y N 14 ANK C2 C Y N 15 ANK N3 N Y N 16 ANK C4 C Y N 17 ANK C5 C Y N 18 ANK C6 C Y N 19 ANK N6 N N N 20 ANK N7 N Y N 21 ANK C8 C Y N 22 ANK N9 N Y N 23 ANK PA P N N 24 ANK PB P N N 25 ANK PG P N N 26 ANK "C1'" C N S 27 ANK O1A O N N 28 ANK O1B O N N 29 ANK O1G O N N 30 ANK "C2'" C N S 31 ANK "O2'" O N N 32 ANK O2A O N N 33 ANK O2B O N N 34 ANK O2G O N N 35 ANK "C3'" C N R 36 ANK "O3'" O N N 37 ANK O3A O N N 38 ANK N3B N N N 39 ANK O3G O N N 40 ANK "C4'" C N S 41 ANK "O4'" O N N 42 ANK "C5'" C N N 43 ANK "O5'" O N N 44 ANK H2 H N N 45 ANK HN6 H N N 46 ANK HN6A H N N 47 ANK H8 H N N 48 ANK "H1'" H N N 49 ANK HO1G H N N 50 ANK "H2'" H N N 51 ANK "HO2'" H N N 52 ANK HO2A H N N 53 ANK HO2B H N N 54 ANK "H3'" H N N 55 ANK "HO3'" H N N 56 ANK HN3B H N N 57 ANK HO3G H N N 58 ANK "H4'" H N N 59 ANK "H5'" H N N 60 ANK "H5'A" H N N 61 ARG N N N N 62 ARG CA C N S 63 ARG C C N N 64 ARG O O N N 65 ARG CB C N N 66 ARG CG C N N 67 ARG CD C N N 68 ARG NE N N N 69 ARG CZ C N N 70 ARG NH1 N N N 71 ARG NH2 N N N 72 ARG OXT O N N 73 ARG H H N N 74 ARG H2 H N N 75 ARG HA H N N 76 ARG HB2 H N N 77 ARG HB3 H N N 78 ARG HG2 H N N 79 ARG HG3 H N N 80 ARG HD2 H N N 81 ARG HD3 H N N 82 ARG HE H N N 83 ARG HH11 H N N 84 ARG HH12 H N N 85 ARG HH21 H N N 86 ARG HH22 H N N 87 ARG HXT H N N 88 ASN N N N N 89 ASN CA C N S 90 ASN C C N N 91 ASN O O N N 92 ASN CB C N N 93 ASN CG C N N 94 ASN OD1 O N N 95 ASN ND2 N N N 96 ASN OXT O N N 97 ASN H H N N 98 ASN H2 H N N 99 ASN HA H N N 100 ASN HB2 H N N 101 ASN HB3 H N N 102 ASN HD21 H N N 103 ASN HD22 H N N 104 ASN HXT H N N 105 ASP N N N N 106 ASP CA C N S 107 ASP C C N N 108 ASP O O N N 109 ASP CB C N N 110 ASP CG C N N 111 ASP OD1 O N N 112 ASP OD2 O N N 113 ASP OXT O N N 114 ASP H H N N 115 ASP H2 H N N 116 ASP HA H N N 117 ASP HB2 H N N 118 ASP HB3 H N N 119 ASP HD2 H N N 120 ASP HXT H N N 121 CYS N N N N 122 CYS CA C N R 123 CYS C C N N 124 CYS O O N N 125 CYS CB C N N 126 CYS SG S N N 127 CYS OXT O N N 128 CYS H H N N 129 CYS H2 H N N 130 CYS HA H N N 131 CYS HB2 H N N 132 CYS HB3 H N N 133 CYS HG H N N 134 CYS HXT H N N 135 GLN N N N N 136 GLN CA C N S 137 GLN C C N N 138 GLN O O N N 139 GLN CB C N N 140 GLN CG C N N 141 GLN CD C N N 142 GLN OE1 O N N 143 GLN NE2 N N N 144 GLN OXT O N N 145 GLN H H N N 146 GLN H2 H N N 147 GLN HA H N N 148 GLN HB2 H N N 149 GLN HB3 H N N 150 GLN HG2 H N N 151 GLN HG3 H N N 152 GLN HE21 H N N 153 GLN HE22 H N N 154 GLN HXT H N N 155 GLU N N N N 156 GLU CA C N S 157 GLU C C N N 158 GLU O O N N 159 GLU CB C N N 160 GLU CG C N N 161 GLU CD C N N 162 GLU OE1 O N N 163 GLU OE2 O N N 164 GLU OXT O N N 165 GLU H H N N 166 GLU H2 H N N 167 GLU HA H N N 168 GLU HB2 H N N 169 GLU HB3 H N N 170 GLU HG2 H N N 171 GLU HG3 H N N 172 GLU HE2 H N N 173 GLU HXT H N N 174 GLY N N N N 175 GLY CA C N N 176 GLY C C N N 177 GLY O O N N 178 GLY OXT O N N 179 GLY H H N N 180 GLY H2 H N N 181 GLY HA2 H N N 182 GLY HA3 H N N 183 GLY HXT H N N 184 HIS N N N N 185 HIS CA C N S 186 HIS C C N N 187 HIS O O N N 188 HIS CB C N N 189 HIS CG C Y N 190 HIS ND1 N Y N 191 HIS CD2 C Y N 192 HIS CE1 C Y N 193 HIS NE2 N Y N 194 HIS OXT O N N 195 HIS H H N N 196 HIS H2 H N N 197 HIS HA H N N 198 HIS HB2 H N N 199 HIS HB3 H N N 200 HIS HD1 H N N 201 HIS HD2 H N N 202 HIS HE1 H N N 203 HIS HE2 H N N 204 HIS HXT H N N 205 HOH O O N N 206 HOH H1 H N N 207 HOH H2 H N N 208 ILE N N N N 209 ILE CA C N S 210 ILE C C N N 211 ILE O O N N 212 ILE CB C N S 213 ILE CG1 C N N 214 ILE CG2 C N N 215 ILE CD1 C N N 216 ILE OXT O N N 217 ILE H H N N 218 ILE H2 H N N 219 ILE HA H N N 220 ILE HB H N N 221 ILE HG12 H N N 222 ILE HG13 H N N 223 ILE HG21 H N N 224 ILE HG22 H N N 225 ILE HG23 H N N 226 ILE HD11 H N N 227 ILE HD12 H N N 228 ILE HD13 H N N 229 ILE HXT H N N 230 LEU N N N N 231 LEU CA C N S 232 LEU C C N N 233 LEU O O N N 234 LEU CB C N N 235 LEU CG C N N 236 LEU CD1 C N N 237 LEU CD2 C N N 238 LEU OXT O N N 239 LEU H H N N 240 LEU H2 H N N 241 LEU HA H N N 242 LEU HB2 H N N 243 LEU HB3 H N N 244 LEU HG H N N 245 LEU HD11 H N N 246 LEU HD12 H N N 247 LEU HD13 H N N 248 LEU HD21 H N N 249 LEU HD22 H N N 250 LEU HD23 H N N 251 LEU HXT H N N 252 LYS N N N N 253 LYS CA C N S 254 LYS C C N N 255 LYS O O N N 256 LYS CB C N N 257 LYS CG C N N 258 LYS CD C N N 259 LYS CE C N N 260 LYS NZ N N N 261 LYS OXT O N N 262 LYS H H N N 263 LYS H2 H N N 264 LYS HA H N N 265 LYS HB2 H N N 266 LYS HB3 H N N 267 LYS HG2 H N N 268 LYS HG3 H N N 269 LYS HD2 H N N 270 LYS HD3 H N N 271 LYS HE2 H N N 272 LYS HE3 H N N 273 LYS HZ1 H N N 274 LYS HZ2 H N N 275 LYS HZ3 H N N 276 LYS HXT H N N 277 MET N N N N 278 MET CA C N S 279 MET C C N N 280 MET O O N N 281 MET CB C N N 282 MET CG C N N 283 MET SD S N N 284 MET CE C N N 285 MET OXT O N N 286 MET H H N N 287 MET H2 H N N 288 MET HA H N N 289 MET HB2 H N N 290 MET HB3 H N N 291 MET HG2 H N N 292 MET HG3 H N N 293 MET HE1 H N N 294 MET HE2 H N N 295 MET HE3 H N N 296 MET HXT H N N 297 MG MG MG N N 298 PHE N N N N 299 PHE CA C N S 300 PHE C C N N 301 PHE O O N N 302 PHE CB C N N 303 PHE CG C Y N 304 PHE CD1 C Y N 305 PHE CD2 C Y N 306 PHE CE1 C Y N 307 PHE CE2 C Y N 308 PHE CZ C Y N 309 PHE OXT O N N 310 PHE H H N N 311 PHE H2 H N N 312 PHE HA H N N 313 PHE HB2 H N N 314 PHE HB3 H N N 315 PHE HD1 H N N 316 PHE HD2 H N N 317 PHE HE1 H N N 318 PHE HE2 H N N 319 PHE HZ H N N 320 PHE HXT H N N 321 PRO N N N N 322 PRO CA C N S 323 PRO C C N N 324 PRO O O N N 325 PRO CB C N N 326 PRO CG C N N 327 PRO CD C N N 328 PRO OXT O N N 329 PRO H H N N 330 PRO HA H N N 331 PRO HB2 H N N 332 PRO HB3 H N N 333 PRO HG2 H N N 334 PRO HG3 H N N 335 PRO HD2 H N N 336 PRO HD3 H N N 337 PRO HXT H N N 338 SER N N N N 339 SER CA C N S 340 SER C C N N 341 SER O O N N 342 SER CB C N N 343 SER OG O N N 344 SER OXT O N N 345 SER H H N N 346 SER H2 H N N 347 SER HA H N N 348 SER HB2 H N N 349 SER HB3 H N N 350 SER HG H N N 351 SER HXT H N N 352 THR N N N N 353 THR CA C N S 354 THR C C N N 355 THR O O N N 356 THR CB C N R 357 THR OG1 O N N 358 THR CG2 C N N 359 THR OXT O N N 360 THR H H N N 361 THR H2 H N N 362 THR HA H N N 363 THR HB H N N 364 THR HG1 H N N 365 THR HG21 H N N 366 THR HG22 H N N 367 THR HG23 H N N 368 THR HXT H N N 369 TRP N N N N 370 TRP CA C N S 371 TRP C C N N 372 TRP O O N N 373 TRP CB C N N 374 TRP CG C Y N 375 TRP CD1 C Y N 376 TRP CD2 C Y N 377 TRP NE1 N Y N 378 TRP CE2 C Y N 379 TRP CE3 C Y N 380 TRP CZ2 C Y N 381 TRP CZ3 C Y N 382 TRP CH2 C Y N 383 TRP OXT O N N 384 TRP H H N N 385 TRP H2 H N N 386 TRP HA H N N 387 TRP HB2 H N N 388 TRP HB3 H N N 389 TRP HD1 H N N 390 TRP HE1 H N N 391 TRP HE3 H N N 392 TRP HZ2 H N N 393 TRP HZ3 H N N 394 TRP HH2 H N N 395 TRP HXT H N N 396 TYR N N N N 397 TYR CA C N S 398 TYR C C N N 399 TYR O O N N 400 TYR CB C N N 401 TYR CG C Y N 402 TYR CD1 C Y N 403 TYR CD2 C Y N 404 TYR CE1 C Y N 405 TYR CE2 C Y N 406 TYR CZ C Y N 407 TYR OH O N N 408 TYR OXT O N N 409 TYR H H N N 410 TYR H2 H N N 411 TYR HA H N N 412 TYR HB2 H N N 413 TYR HB3 H N N 414 TYR HD1 H N N 415 TYR HD2 H N N 416 TYR HE1 H N N 417 TYR HE2 H N N 418 TYR HH H N N 419 TYR HXT H N N 420 VAL N N N N 421 VAL CA C N S 422 VAL C C N N 423 VAL O O N N 424 VAL CB C N N 425 VAL CG1 C N N 426 VAL CG2 C N N 427 VAL OXT O N N 428 VAL H H N N 429 VAL H2 H N N 430 VAL HA H N N 431 VAL HB H N N 432 VAL HG11 H N N 433 VAL HG12 H N N 434 VAL HG13 H N N 435 VAL HG21 H N N 436 VAL HG22 H N N 437 VAL HG23 H N N 438 VAL HXT H N N 439 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ANK N1 C2 doub Y N 13 ANK N1 C6 sing Y N 14 ANK C2 N3 sing Y N 15 ANK N3 C4 doub Y N 16 ANK C4 C5 sing Y N 17 ANK C4 N9 sing Y N 18 ANK C5 C6 doub Y N 19 ANK C5 N7 sing Y N 20 ANK C6 N6 sing N N 21 ANK N7 C8 doub Y N 22 ANK C8 N9 sing Y N 23 ANK N9 "C1'" sing N N 24 ANK PA O1A doub N N 25 ANK PA O2A sing N N 26 ANK PA O3A sing N N 27 ANK PA "O5'" sing N N 28 ANK PB O1B doub N N 29 ANK PB O2B sing N N 30 ANK PB O3A sing N N 31 ANK PB N3B sing N N 32 ANK PG O1G sing N N 33 ANK PG O2G doub N N 34 ANK PG N3B sing N N 35 ANK PG O3G sing N N 36 ANK "C1'" "C2'" sing N N 37 ANK "C1'" "O4'" sing N N 38 ANK "C2'" "O2'" sing N N 39 ANK "C2'" "C3'" sing N N 40 ANK "C3'" "O3'" sing N N 41 ANK "C3'" "C4'" sing N N 42 ANK "C4'" "O4'" sing N N 43 ANK "C4'" "C5'" sing N N 44 ANK "C5'" "O5'" sing N N 45 ANK C2 H2 sing N N 46 ANK N6 HN6 sing N N 47 ANK N6 HN6A sing N N 48 ANK C8 H8 sing N N 49 ANK "C1'" "H1'" sing N N 50 ANK O1G HO1G sing N N 51 ANK "C2'" "H2'" sing N N 52 ANK "O2'" "HO2'" sing N N 53 ANK O2A HO2A sing N N 54 ANK O2B HO2B sing N N 55 ANK "C3'" "H3'" sing N N 56 ANK "O3'" "HO3'" sing N N 57 ANK N3B HN3B sing N N 58 ANK O3G HO3G sing N N 59 ANK "C4'" "H4'" sing N N 60 ANK "C5'" "H5'" sing N N 61 ANK "C5'" "H5'A" sing N N 62 ARG N CA sing N N 63 ARG N H sing N N 64 ARG N H2 sing N N 65 ARG CA C sing N N 66 ARG CA CB sing N N 67 ARG CA HA sing N N 68 ARG C O doub N N 69 ARG C OXT sing N N 70 ARG CB CG sing N N 71 ARG CB HB2 sing N N 72 ARG CB HB3 sing N N 73 ARG CG CD sing N N 74 ARG CG HG2 sing N N 75 ARG CG HG3 sing N N 76 ARG CD NE sing N N 77 ARG CD HD2 sing N N 78 ARG CD HD3 sing N N 79 ARG NE CZ sing N N 80 ARG NE HE sing N N 81 ARG CZ NH1 sing N N 82 ARG CZ NH2 doub N N 83 ARG NH1 HH11 sing N N 84 ARG NH1 HH12 sing N N 85 ARG NH2 HH21 sing N N 86 ARG NH2 HH22 sing N N 87 ARG OXT HXT sing N N 88 ASN N CA sing N N 89 ASN N H sing N N 90 ASN N H2 sing N N 91 ASN CA C sing N N 92 ASN CA CB sing N N 93 ASN CA HA sing N N 94 ASN C O doub N N 95 ASN C OXT sing N N 96 ASN CB CG sing N N 97 ASN CB HB2 sing N N 98 ASN CB HB3 sing N N 99 ASN CG OD1 doub N N 100 ASN CG ND2 sing N N 101 ASN ND2 HD21 sing N N 102 ASN ND2 HD22 sing N N 103 ASN OXT HXT sing N N 104 ASP N CA sing N N 105 ASP N H sing N N 106 ASP N H2 sing N N 107 ASP CA C sing N N 108 ASP CA CB sing N N 109 ASP CA HA sing N N 110 ASP C O doub N N 111 ASP C OXT sing N N 112 ASP CB CG sing N N 113 ASP CB HB2 sing N N 114 ASP CB HB3 sing N N 115 ASP CG OD1 doub N N 116 ASP CG OD2 sing N N 117 ASP OD2 HD2 sing N N 118 ASP OXT HXT sing N N 119 CYS N CA sing N N 120 CYS N H sing N N 121 CYS N H2 sing N N 122 CYS CA C sing N N 123 CYS CA CB sing N N 124 CYS CA HA sing N N 125 CYS C O doub N N 126 CYS C OXT sing N N 127 CYS CB SG sing N N 128 CYS CB HB2 sing N N 129 CYS CB HB3 sing N N 130 CYS SG HG sing N N 131 CYS OXT HXT sing N N 132 GLN N CA sing N N 133 GLN N H sing N N 134 GLN N H2 sing N N 135 GLN CA C sing N N 136 GLN CA CB sing N N 137 GLN CA HA sing N N 138 GLN C O doub N N 139 GLN C OXT sing N N 140 GLN CB CG sing N N 141 GLN CB HB2 sing N N 142 GLN CB HB3 sing N N 143 GLN CG CD sing N N 144 GLN CG HG2 sing N N 145 GLN CG HG3 sing N N 146 GLN CD OE1 doub N N 147 GLN CD NE2 sing N N 148 GLN NE2 HE21 sing N N 149 GLN NE2 HE22 sing N N 150 GLN OXT HXT sing N N 151 GLU N CA sing N N 152 GLU N H sing N N 153 GLU N H2 sing N N 154 GLU CA C sing N N 155 GLU CA CB sing N N 156 GLU CA HA sing N N 157 GLU C O doub N N 158 GLU C OXT sing N N 159 GLU CB CG sing N N 160 GLU CB HB2 sing N N 161 GLU CB HB3 sing N N 162 GLU CG CD sing N N 163 GLU CG HG2 sing N N 164 GLU CG HG3 sing N N 165 GLU CD OE1 doub N N 166 GLU CD OE2 sing N N 167 GLU OE2 HE2 sing N N 168 GLU OXT HXT sing N N 169 GLY N CA sing N N 170 GLY N H sing N N 171 GLY N H2 sing N N 172 GLY CA C sing N N 173 GLY CA HA2 sing N N 174 GLY CA HA3 sing N N 175 GLY C O doub N N 176 GLY C OXT sing N N 177 GLY OXT HXT sing N N 178 HIS N CA sing N N 179 HIS N H sing N N 180 HIS N H2 sing N N 181 HIS CA C sing N N 182 HIS CA CB sing N N 183 HIS CA HA sing N N 184 HIS C O doub N N 185 HIS C OXT sing N N 186 HIS CB CG sing N N 187 HIS CB HB2 sing N N 188 HIS CB HB3 sing N N 189 HIS CG ND1 sing Y N 190 HIS CG CD2 doub Y N 191 HIS ND1 CE1 doub Y N 192 HIS ND1 HD1 sing N N 193 HIS CD2 NE2 sing Y N 194 HIS CD2 HD2 sing N N 195 HIS CE1 NE2 sing Y N 196 HIS CE1 HE1 sing N N 197 HIS NE2 HE2 sing N N 198 HIS OXT HXT sing N N 199 HOH O H1 sing N N 200 HOH O H2 sing N N 201 ILE N CA sing N N 202 ILE N H sing N N 203 ILE N H2 sing N N 204 ILE CA C sing N N 205 ILE CA CB sing N N 206 ILE CA HA sing N N 207 ILE C O doub N N 208 ILE C OXT sing N N 209 ILE CB CG1 sing N N 210 ILE CB CG2 sing N N 211 ILE CB HB sing N N 212 ILE CG1 CD1 sing N N 213 ILE CG1 HG12 sing N N 214 ILE CG1 HG13 sing N N 215 ILE CG2 HG21 sing N N 216 ILE CG2 HG22 sing N N 217 ILE CG2 HG23 sing N N 218 ILE CD1 HD11 sing N N 219 ILE CD1 HD12 sing N N 220 ILE CD1 HD13 sing N N 221 ILE OXT HXT sing N N 222 LEU N CA sing N N 223 LEU N H sing N N 224 LEU N H2 sing N N 225 LEU CA C sing N N 226 LEU CA CB sing N N 227 LEU CA HA sing N N 228 LEU C O doub N N 229 LEU C OXT sing N N 230 LEU CB CG sing N N 231 LEU CB HB2 sing N N 232 LEU CB HB3 sing N N 233 LEU CG CD1 sing N N 234 LEU CG CD2 sing N N 235 LEU CG HG sing N N 236 LEU CD1 HD11 sing N N 237 LEU CD1 HD12 sing N N 238 LEU CD1 HD13 sing N N 239 LEU CD2 HD21 sing N N 240 LEU CD2 HD22 sing N N 241 LEU CD2 HD23 sing N N 242 LEU OXT HXT sing N N 243 LYS N CA sing N N 244 LYS N H sing N N 245 LYS N H2 sing N N 246 LYS CA C sing N N 247 LYS CA CB sing N N 248 LYS CA HA sing N N 249 LYS C O doub N N 250 LYS C OXT sing N N 251 LYS CB CG sing N N 252 LYS CB HB2 sing N N 253 LYS CB HB3 sing N N 254 LYS CG CD sing N N 255 LYS CG HG2 sing N N 256 LYS CG HG3 sing N N 257 LYS CD CE sing N N 258 LYS CD HD2 sing N N 259 LYS CD HD3 sing N N 260 LYS CE NZ sing N N 261 LYS CE HE2 sing N N 262 LYS CE HE3 sing N N 263 LYS NZ HZ1 sing N N 264 LYS NZ HZ2 sing N N 265 LYS NZ HZ3 sing N N 266 LYS OXT HXT sing N N 267 MET N CA sing N N 268 MET N H sing N N 269 MET N H2 sing N N 270 MET CA C sing N N 271 MET CA CB sing N N 272 MET CA HA sing N N 273 MET C O doub N N 274 MET C OXT sing N N 275 MET CB CG sing N N 276 MET CB HB2 sing N N 277 MET CB HB3 sing N N 278 MET CG SD sing N N 279 MET CG HG2 sing N N 280 MET CG HG3 sing N N 281 MET SD CE sing N N 282 MET CE HE1 sing N N 283 MET CE HE2 sing N N 284 MET CE HE3 sing N N 285 MET OXT HXT sing N N 286 PHE N CA sing N N 287 PHE N H sing N N 288 PHE N H2 sing N N 289 PHE CA C sing N N 290 PHE CA CB sing N N 291 PHE CA HA sing N N 292 PHE C O doub N N 293 PHE C OXT sing N N 294 PHE CB CG sing N N 295 PHE CB HB2 sing N N 296 PHE CB HB3 sing N N 297 PHE CG CD1 doub Y N 298 PHE CG CD2 sing Y N 299 PHE CD1 CE1 sing Y N 300 PHE CD1 HD1 sing N N 301 PHE CD2 CE2 doub Y N 302 PHE CD2 HD2 sing N N 303 PHE CE1 CZ doub Y N 304 PHE CE1 HE1 sing N N 305 PHE CE2 CZ sing Y N 306 PHE CE2 HE2 sing N N 307 PHE CZ HZ sing N N 308 PHE OXT HXT sing N N 309 PRO N CA sing N N 310 PRO N CD sing N N 311 PRO N H sing N N 312 PRO CA C sing N N 313 PRO CA CB sing N N 314 PRO CA HA sing N N 315 PRO C O doub N N 316 PRO C OXT sing N N 317 PRO CB CG sing N N 318 PRO CB HB2 sing N N 319 PRO CB HB3 sing N N 320 PRO CG CD sing N N 321 PRO CG HG2 sing N N 322 PRO CG HG3 sing N N 323 PRO CD HD2 sing N N 324 PRO CD HD3 sing N N 325 PRO OXT HXT sing N N 326 SER N CA sing N N 327 SER N H sing N N 328 SER N H2 sing N N 329 SER CA C sing N N 330 SER CA CB sing N N 331 SER CA HA sing N N 332 SER C O doub N N 333 SER C OXT sing N N 334 SER CB OG sing N N 335 SER CB HB2 sing N N 336 SER CB HB3 sing N N 337 SER OG HG sing N N 338 SER OXT HXT sing N N 339 THR N CA sing N N 340 THR N H sing N N 341 THR N H2 sing N N 342 THR CA C sing N N 343 THR CA CB sing N N 344 THR CA HA sing N N 345 THR C O doub N N 346 THR C OXT sing N N 347 THR CB OG1 sing N N 348 THR CB CG2 sing N N 349 THR CB HB sing N N 350 THR OG1 HG1 sing N N 351 THR CG2 HG21 sing N N 352 THR CG2 HG22 sing N N 353 THR CG2 HG23 sing N N 354 THR OXT HXT sing N N 355 TRP N CA sing N N 356 TRP N H sing N N 357 TRP N H2 sing N N 358 TRP CA C sing N N 359 TRP CA CB sing N N 360 TRP CA HA sing N N 361 TRP C O doub N N 362 TRP C OXT sing N N 363 TRP CB CG sing N N 364 TRP CB HB2 sing N N 365 TRP CB HB3 sing N N 366 TRP CG CD1 doub Y N 367 TRP CG CD2 sing Y N 368 TRP CD1 NE1 sing Y N 369 TRP CD1 HD1 sing N N 370 TRP CD2 CE2 doub Y N 371 TRP CD2 CE3 sing Y N 372 TRP NE1 CE2 sing Y N 373 TRP NE1 HE1 sing N N 374 TRP CE2 CZ2 sing Y N 375 TRP CE3 CZ3 doub Y N 376 TRP CE3 HE3 sing N N 377 TRP CZ2 CH2 doub Y N 378 TRP CZ2 HZ2 sing N N 379 TRP CZ3 CH2 sing Y N 380 TRP CZ3 HZ3 sing N N 381 TRP CH2 HH2 sing N N 382 TRP OXT HXT sing N N 383 TYR N CA sing N N 384 TYR N H sing N N 385 TYR N H2 sing N N 386 TYR CA C sing N N 387 TYR CA CB sing N N 388 TYR CA HA sing N N 389 TYR C O doub N N 390 TYR C OXT sing N N 391 TYR CB CG sing N N 392 TYR CB HB2 sing N N 393 TYR CB HB3 sing N N 394 TYR CG CD1 doub Y N 395 TYR CG CD2 sing Y N 396 TYR CD1 CE1 sing Y N 397 TYR CD1 HD1 sing N N 398 TYR CD2 CE2 doub Y N 399 TYR CD2 HD2 sing N N 400 TYR CE1 CZ doub Y N 401 TYR CE1 HE1 sing N N 402 TYR CE2 CZ sing Y N 403 TYR CE2 HE2 sing N N 404 TYR CZ OH sing N N 405 TYR OH HH sing N N 406 TYR OXT HXT sing N N 407 VAL N CA sing N N 408 VAL N H sing N N 409 VAL N H2 sing N N 410 VAL CA C sing N N 411 VAL CA CB sing N N 412 VAL CA HA sing N N 413 VAL C O doub N N 414 VAL C OXT sing N N 415 VAL CB CG1 sing N N 416 VAL CB CG2 sing N N 417 VAL CB HB sing N N 418 VAL CG1 HG11 sing N N 419 VAL CG1 HG12 sing N N 420 VAL CG1 HG13 sing N N 421 VAL CG2 HG21 sing N N 422 VAL CG2 HG22 sing N N 423 VAL CG2 HG23 sing N N 424 VAL OXT HXT sing N N 425 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '9-{5-O-[(R)-hydroxy{[(S)-hydroxy(phosphonoamino)phosphoryl]oxy}phosphoryl]-beta-L-ribofuranosyl}-9H-purin-6-amine' ANK 3 'MAGNESIUM ION' MG 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3EQD _pdbx_initial_refinement_model.details ? #