data_3ZFJ # _entry.id 3ZFJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3ZFJ pdb_00003zfj 10.2210/pdb3zfj/pdb PDBE EBI-54996 ? ? WWPDB D_1290054996 ? ? BMRB 18943 ? 10.13018/BMR18943 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-11-20 2 'Structure model' 1 1 2013-12-18 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Experimental preparation' 5 3 'Structure model' Other 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_exptl_sample_conditions 4 3 'Structure model' pdbx_struct_conn_angle 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_site 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_cs' 4 3 'Structure model' '_pdbx_database_status.status_code_mr' 5 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.value' 13 3 'Structure model' '_struct_conn.pdbx_dist_value' 14 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 15 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 16 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 17 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 18 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 20 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 21 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 22 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 23 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 24 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 25 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 26 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 27 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 28 3 'Structure model' '_struct_site.pdbx_auth_seq_id' 29 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3ZFJ _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2012-12-11 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 18943 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bersch, B.' 1 'Bougault, C.' 2 'Favier, A.' 3 'Gabel, F.' 4 'Roux, L.' 5 'Vernet, T.' 6 'Durmort, C.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;New Insights Into Histidine Triad Proteins: Solution Structure of a Streptococcus Pneumoniae Phtd Domain and Zinc Transfer to Adcaii. ; 'Plos One' 8 81168 ? 2013 ? US 1932-6203 ? ? 24312273 10.1371/JOURNAL.PONE.0081168 1 'Biochemical Characterization of the Histidine Triad Protein Phtd as a Cell Surface Zinc-Binding Protein of Pneumococcus.' Biochemistry 50 3551 ? 2011 BICHAW US 0006-2960 0033 ? 21425866 10.1021/BI200012F # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bersch, B.' 1 ? primary 'Bougault, C.' 2 ? primary 'Roux, L.' 3 ? primary 'Favier, A.' 4 ? primary 'Vernet, T.' 5 ? primary 'Durmort, C.' 6 ? 1 'Loisel, E.' 7 ? 1 'Chimalapati, S.' 8 ? 1 'Bougault, C.' 9 ? 1 'Imberty, A.' 10 ? 1 'Gallet, B.' 11 ? 1 'Di Guilmi, A.M.' 12 ? 1 'Brown, J.' 13 ? 1 'Vernet, T.' 14 ? 1 'Durmort, C.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PNEUMOCOCCAL HISTIDINE TRIAD PROTEIN D' 15782.420 1 ? ? 'RESIDUES 30-166' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PHTD # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GGQVKKESNRVSYIDGDQAGQKAENLTPDEVSKREGINAEQIVIKITDQGYVTSHGDHYHYYNGKVPYDAIISEELLMKD PNYQLKDSDIVNEIKGGYVIKVDGKYYVYLKDAAHADNIRTKEEIKRQKQERSHNHNS ; _entity_poly.pdbx_seq_one_letter_code_can ;GGQVKKESNRVSYIDGDQAGQKAENLTPDEVSKREGINAEQIVIKITDQGYVTSHGDHYHYYNGKVPYDAIISEELLMKD PNYQLKDSDIVNEIKGGYVIKVDGKYYVYLKDAAHADNIRTKEEIKRQKQERSHNHNS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 GLN n 1 4 VAL n 1 5 LYS n 1 6 LYS n 1 7 GLU n 1 8 SER n 1 9 ASN n 1 10 ARG n 1 11 VAL n 1 12 SER n 1 13 TYR n 1 14 ILE n 1 15 ASP n 1 16 GLY n 1 17 ASP n 1 18 GLN n 1 19 ALA n 1 20 GLY n 1 21 GLN n 1 22 LYS n 1 23 ALA n 1 24 GLU n 1 25 ASN n 1 26 LEU n 1 27 THR n 1 28 PRO n 1 29 ASP n 1 30 GLU n 1 31 VAL n 1 32 SER n 1 33 LYS n 1 34 ARG n 1 35 GLU n 1 36 GLY n 1 37 ILE n 1 38 ASN n 1 39 ALA n 1 40 GLU n 1 41 GLN n 1 42 ILE n 1 43 VAL n 1 44 ILE n 1 45 LYS n 1 46 ILE n 1 47 THR n 1 48 ASP n 1 49 GLN n 1 50 GLY n 1 51 TYR n 1 52 VAL n 1 53 THR n 1 54 SER n 1 55 HIS n 1 56 GLY n 1 57 ASP n 1 58 HIS n 1 59 TYR n 1 60 HIS n 1 61 TYR n 1 62 TYR n 1 63 ASN n 1 64 GLY n 1 65 LYS n 1 66 VAL n 1 67 PRO n 1 68 TYR n 1 69 ASP n 1 70 ALA n 1 71 ILE n 1 72 ILE n 1 73 SER n 1 74 GLU n 1 75 GLU n 1 76 LEU n 1 77 LEU n 1 78 MET n 1 79 LYS n 1 80 ASP n 1 81 PRO n 1 82 ASN n 1 83 TYR n 1 84 GLN n 1 85 LEU n 1 86 LYS n 1 87 ASP n 1 88 SER n 1 89 ASP n 1 90 ILE n 1 91 VAL n 1 92 ASN n 1 93 GLU n 1 94 ILE n 1 95 LYS n 1 96 GLY n 1 97 GLY n 1 98 TYR n 1 99 VAL n 1 100 ILE n 1 101 LYS n 1 102 VAL n 1 103 ASP n 1 104 GLY n 1 105 LYS n 1 106 TYR n 1 107 TYR n 1 108 VAL n 1 109 TYR n 1 110 LEU n 1 111 LYS n 1 112 ASP n 1 113 ALA n 1 114 ALA n 1 115 HIS n 1 116 ALA n 1 117 ASP n 1 118 ASN n 1 119 ILE n 1 120 ARG n 1 121 THR n 1 122 LYS n 1 123 GLU n 1 124 GLU n 1 125 ILE n 1 126 LYS n 1 127 ARG n 1 128 GLN n 1 129 LYS n 1 130 GLN n 1 131 GLU n 1 132 ARG n 1 133 SER n 1 134 HIS n 1 135 ASN n 1 136 HIS n 1 137 ASN n 1 138 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain D39 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'STREPTOCOCCUS PNEUMONIAE' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 373153 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant RIL _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PLIM09-T-PHTD _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 29 ? ? ? A . n A 1 2 GLY 2 30 ? ? ? A . n A 1 3 GLN 3 31 ? ? ? A . n A 1 4 VAL 4 32 ? ? ? A . n A 1 5 LYS 5 33 ? ? ? A . n A 1 6 LYS 6 34 ? ? ? A . n A 1 7 GLU 7 35 ? ? ? A . n A 1 8 SER 8 36 ? ? ? A . n A 1 9 ASN 9 37 ? ? ? A . n A 1 10 ARG 10 38 ? ? ? A . n A 1 11 VAL 11 39 ? ? ? A . n A 1 12 SER 12 40 40 SER SER A . n A 1 13 TYR 13 41 41 TYR TYR A . n A 1 14 ILE 14 42 42 ILE ILE A . n A 1 15 ASP 15 43 43 ASP ASP A . n A 1 16 GLY 16 44 44 GLY GLY A . n A 1 17 ASP 17 45 45 ASP ASP A . n A 1 18 GLN 18 46 46 GLN GLN A . n A 1 19 ALA 19 47 47 ALA ALA A . n A 1 20 GLY 20 48 48 GLY GLY A . n A 1 21 GLN 21 49 49 GLN GLN A . n A 1 22 LYS 22 50 50 LYS LYS A . n A 1 23 ALA 23 51 51 ALA ALA A . n A 1 24 GLU 24 52 52 GLU GLU A . n A 1 25 ASN 25 53 53 ASN ASN A . n A 1 26 LEU 26 54 54 LEU LEU A . n A 1 27 THR 27 55 55 THR THR A . n A 1 28 PRO 28 56 56 PRO PRO A . n A 1 29 ASP 29 57 57 ASP ASP A . n A 1 30 GLU 30 58 58 GLU GLU A . n A 1 31 VAL 31 59 59 VAL VAL A . n A 1 32 SER 32 60 60 SER SER A . n A 1 33 LYS 33 61 61 LYS LYS A . n A 1 34 ARG 34 62 62 ARG ARG A . n A 1 35 GLU 35 63 63 GLU GLU A . n A 1 36 GLY 36 64 64 GLY GLY A . n A 1 37 ILE 37 65 65 ILE ILE A . n A 1 38 ASN 38 66 66 ASN ASN A . n A 1 39 ALA 39 67 67 ALA ALA A . n A 1 40 GLU 40 68 68 GLU GLU A . n A 1 41 GLN 41 69 69 GLN GLN A . n A 1 42 ILE 42 70 70 ILE ILE A . n A 1 43 VAL 43 71 71 VAL VAL A . n A 1 44 ILE 44 72 72 ILE ILE A . n A 1 45 LYS 45 73 73 LYS LYS A . n A 1 46 ILE 46 74 74 ILE ILE A . n A 1 47 THR 47 75 75 THR THR A . n A 1 48 ASP 48 76 76 ASP ASP A . n A 1 49 GLN 49 77 77 GLN GLN A . n A 1 50 GLY 50 78 78 GLY GLY A . n A 1 51 TYR 51 79 79 TYR TYR A . n A 1 52 VAL 52 80 80 VAL VAL A . n A 1 53 THR 53 81 81 THR THR A . n A 1 54 SER 54 82 82 SER SER A . n A 1 55 HIS 55 83 83 HIS HIS A . n A 1 56 GLY 56 84 84 GLY GLY A . n A 1 57 ASP 57 85 85 ASP ASP A . n A 1 58 HIS 58 86 86 HIS HIS A . n A 1 59 TYR 59 87 87 TYR TYR A . n A 1 60 HIS 60 88 88 HIS HIS A . n A 1 61 TYR 61 89 89 TYR TYR A . n A 1 62 TYR 62 90 90 TYR TYR A . n A 1 63 ASN 63 91 91 ASN ASN A . n A 1 64 GLY 64 92 92 GLY GLY A . n A 1 65 LYS 65 93 93 LYS LYS A . n A 1 66 VAL 66 94 94 VAL VAL A . n A 1 67 PRO 67 95 95 PRO PRO A . n A 1 68 TYR 68 96 96 TYR TYR A . n A 1 69 ASP 69 97 97 ASP ASP A . n A 1 70 ALA 70 98 98 ALA ALA A . n A 1 71 ILE 71 99 99 ILE ILE A . n A 1 72 ILE 72 100 100 ILE ILE A . n A 1 73 SER 73 101 101 SER SER A . n A 1 74 GLU 74 102 102 GLU GLU A . n A 1 75 GLU 75 103 103 GLU GLU A . n A 1 76 LEU 76 104 104 LEU LEU A . n A 1 77 LEU 77 105 105 LEU LEU A . n A 1 78 MET 78 106 106 MET MET A . n A 1 79 LYS 79 107 107 LYS LYS A . n A 1 80 ASP 80 108 108 ASP ASP A . n A 1 81 PRO 81 109 109 PRO PRO A . n A 1 82 ASN 82 110 110 ASN ASN A . n A 1 83 TYR 83 111 111 TYR TYR A . n A 1 84 GLN 84 112 112 GLN GLN A . n A 1 85 LEU 85 113 113 LEU LEU A . n A 1 86 LYS 86 114 114 LYS LYS A . n A 1 87 ASP 87 115 115 ASP ASP A . n A 1 88 SER 88 116 116 SER SER A . n A 1 89 ASP 89 117 117 ASP ASP A . n A 1 90 ILE 90 118 118 ILE ILE A . n A 1 91 VAL 91 119 119 VAL VAL A . n A 1 92 ASN 92 120 120 ASN ASN A . n A 1 93 GLU 93 121 121 GLU GLU A . n A 1 94 ILE 94 122 122 ILE ILE A . n A 1 95 LYS 95 123 123 LYS LYS A . n A 1 96 GLY 96 124 124 GLY GLY A . n A 1 97 GLY 97 125 125 GLY GLY A . n A 1 98 TYR 98 126 126 TYR TYR A . n A 1 99 VAL 99 127 127 VAL VAL A . n A 1 100 ILE 100 128 128 ILE ILE A . n A 1 101 LYS 101 129 129 LYS LYS A . n A 1 102 VAL 102 130 130 VAL VAL A . n A 1 103 ASP 103 131 131 ASP ASP A . n A 1 104 GLY 104 132 132 GLY GLY A . n A 1 105 LYS 105 133 133 LYS LYS A . n A 1 106 TYR 106 134 134 TYR TYR A . n A 1 107 TYR 107 135 135 TYR TYR A . n A 1 108 VAL 108 136 136 VAL VAL A . n A 1 109 TYR 109 137 137 TYR TYR A . n A 1 110 LEU 110 138 138 LEU LEU A . n A 1 111 LYS 111 139 139 LYS LYS A . n A 1 112 ASP 112 140 140 ASP ASP A . n A 1 113 ALA 113 141 141 ALA ALA A . n A 1 114 ALA 114 142 142 ALA ALA A . n A 1 115 HIS 115 143 143 HIS HIS A . n A 1 116 ALA 116 144 144 ALA ALA A . n A 1 117 ASP 117 145 145 ASP ASP A . n A 1 118 ASN 118 146 146 ASN ASN A . n A 1 119 ILE 119 147 147 ILE ILE A . n A 1 120 ARG 120 148 148 ARG ARG A . n A 1 121 THR 121 149 149 THR THR A . n A 1 122 LYS 122 150 150 LYS LYS A . n A 1 123 GLU 123 151 151 GLU GLU A . n A 1 124 GLU 124 152 152 GLU GLU A . n A 1 125 ILE 125 153 153 ILE ILE A . n A 1 126 LYS 126 154 154 LYS LYS A . n A 1 127 ARG 127 155 155 ARG ARG A . n A 1 128 GLN 128 156 156 GLN GLN A . n A 1 129 LYS 129 157 157 LYS LYS A . n A 1 130 GLN 130 158 158 GLN GLN A . n A 1 131 GLU 131 159 159 GLU GLU A . n A 1 132 ARG 132 160 ? ? ? A . n A 1 133 SER 133 161 ? ? ? A . n A 1 134 HIS 134 162 ? ? ? A . n A 1 135 ASN 135 163 ? ? ? A . n A 1 136 HIS 136 164 ? ? ? A . n A 1 137 ASN 137 165 ? ? ? A . n A 1 138 SER 138 166 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1159 _pdbx_nonpoly_scheme.auth_seq_num 1159 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 159 ? CA ? A GLU 131 CA 2 1 Y 1 A GLU 159 ? C ? A GLU 131 C 3 1 Y 1 A GLU 159 ? O ? A GLU 131 O 4 1 Y 1 A GLU 159 ? CB ? A GLU 131 CB 5 1 Y 1 A GLU 159 ? CG ? A GLU 131 CG 6 1 Y 1 A GLU 159 ? CD ? A GLU 131 CD 7 1 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 8 1 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 9 2 Y 1 A GLU 159 ? CA ? A GLU 131 CA 10 2 Y 1 A GLU 159 ? C ? A GLU 131 C 11 2 Y 1 A GLU 159 ? O ? A GLU 131 O 12 2 Y 1 A GLU 159 ? CB ? A GLU 131 CB 13 2 Y 1 A GLU 159 ? CG ? A GLU 131 CG 14 2 Y 1 A GLU 159 ? CD ? A GLU 131 CD 15 2 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 16 2 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 17 3 Y 1 A GLU 159 ? CA ? A GLU 131 CA 18 3 Y 1 A GLU 159 ? C ? A GLU 131 C 19 3 Y 1 A GLU 159 ? O ? A GLU 131 O 20 3 Y 1 A GLU 159 ? CB ? A GLU 131 CB 21 3 Y 1 A GLU 159 ? CG ? A GLU 131 CG 22 3 Y 1 A GLU 159 ? CD ? A GLU 131 CD 23 3 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 24 3 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 25 4 Y 1 A GLU 159 ? CA ? A GLU 131 CA 26 4 Y 1 A GLU 159 ? C ? A GLU 131 C 27 4 Y 1 A GLU 159 ? O ? A GLU 131 O 28 4 Y 1 A GLU 159 ? CB ? A GLU 131 CB 29 4 Y 1 A GLU 159 ? CG ? A GLU 131 CG 30 4 Y 1 A GLU 159 ? CD ? A GLU 131 CD 31 4 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 32 4 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 33 5 Y 1 A GLU 159 ? CA ? A GLU 131 CA 34 5 Y 1 A GLU 159 ? C ? A GLU 131 C 35 5 Y 1 A GLU 159 ? O ? A GLU 131 O 36 5 Y 1 A GLU 159 ? CB ? A GLU 131 CB 37 5 Y 1 A GLU 159 ? CG ? A GLU 131 CG 38 5 Y 1 A GLU 159 ? CD ? A GLU 131 CD 39 5 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 40 5 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 41 6 Y 1 A GLU 159 ? CA ? A GLU 131 CA 42 6 Y 1 A GLU 159 ? C ? A GLU 131 C 43 6 Y 1 A GLU 159 ? O ? A GLU 131 O 44 6 Y 1 A GLU 159 ? CB ? A GLU 131 CB 45 6 Y 1 A GLU 159 ? CG ? A GLU 131 CG 46 6 Y 1 A GLU 159 ? CD ? A GLU 131 CD 47 6 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 48 6 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 49 7 Y 1 A GLU 159 ? CA ? A GLU 131 CA 50 7 Y 1 A GLU 159 ? C ? A GLU 131 C 51 7 Y 1 A GLU 159 ? O ? A GLU 131 O 52 7 Y 1 A GLU 159 ? CB ? A GLU 131 CB 53 7 Y 1 A GLU 159 ? CG ? A GLU 131 CG 54 7 Y 1 A GLU 159 ? CD ? A GLU 131 CD 55 7 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 56 7 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 57 8 Y 1 A GLU 159 ? CA ? A GLU 131 CA 58 8 Y 1 A GLU 159 ? C ? A GLU 131 C 59 8 Y 1 A GLU 159 ? O ? A GLU 131 O 60 8 Y 1 A GLU 159 ? CB ? A GLU 131 CB 61 8 Y 1 A GLU 159 ? CG ? A GLU 131 CG 62 8 Y 1 A GLU 159 ? CD ? A GLU 131 CD 63 8 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 64 8 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 65 9 Y 1 A GLU 159 ? CA ? A GLU 131 CA 66 9 Y 1 A GLU 159 ? C ? A GLU 131 C 67 9 Y 1 A GLU 159 ? O ? A GLU 131 O 68 9 Y 1 A GLU 159 ? CB ? A GLU 131 CB 69 9 Y 1 A GLU 159 ? CG ? A GLU 131 CG 70 9 Y 1 A GLU 159 ? CD ? A GLU 131 CD 71 9 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 72 9 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 73 10 Y 1 A GLU 159 ? CA ? A GLU 131 CA 74 10 Y 1 A GLU 159 ? C ? A GLU 131 C 75 10 Y 1 A GLU 159 ? O ? A GLU 131 O 76 10 Y 1 A GLU 159 ? CB ? A GLU 131 CB 77 10 Y 1 A GLU 159 ? CG ? A GLU 131 CG 78 10 Y 1 A GLU 159 ? CD ? A GLU 131 CD 79 10 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 80 10 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 81 11 Y 1 A GLU 159 ? CA ? A GLU 131 CA 82 11 Y 1 A GLU 159 ? C ? A GLU 131 C 83 11 Y 1 A GLU 159 ? O ? A GLU 131 O 84 11 Y 1 A GLU 159 ? CB ? A GLU 131 CB 85 11 Y 1 A GLU 159 ? CG ? A GLU 131 CG 86 11 Y 1 A GLU 159 ? CD ? A GLU 131 CD 87 11 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 88 11 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 89 12 Y 1 A GLU 159 ? CA ? A GLU 131 CA 90 12 Y 1 A GLU 159 ? C ? A GLU 131 C 91 12 Y 1 A GLU 159 ? O ? A GLU 131 O 92 12 Y 1 A GLU 159 ? CB ? A GLU 131 CB 93 12 Y 1 A GLU 159 ? CG ? A GLU 131 CG 94 12 Y 1 A GLU 159 ? CD ? A GLU 131 CD 95 12 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 96 12 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 97 13 Y 1 A GLU 159 ? CA ? A GLU 131 CA 98 13 Y 1 A GLU 159 ? C ? A GLU 131 C 99 13 Y 1 A GLU 159 ? O ? A GLU 131 O 100 13 Y 1 A GLU 159 ? CB ? A GLU 131 CB 101 13 Y 1 A GLU 159 ? CG ? A GLU 131 CG 102 13 Y 1 A GLU 159 ? CD ? A GLU 131 CD 103 13 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 104 13 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 105 14 Y 1 A GLU 159 ? CA ? A GLU 131 CA 106 14 Y 1 A GLU 159 ? C ? A GLU 131 C 107 14 Y 1 A GLU 159 ? O ? A GLU 131 O 108 14 Y 1 A GLU 159 ? CB ? A GLU 131 CB 109 14 Y 1 A GLU 159 ? CG ? A GLU 131 CG 110 14 Y 1 A GLU 159 ? CD ? A GLU 131 CD 111 14 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 112 14 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 113 15 Y 1 A GLU 159 ? CA ? A GLU 131 CA 114 15 Y 1 A GLU 159 ? C ? A GLU 131 C 115 15 Y 1 A GLU 159 ? O ? A GLU 131 O 116 15 Y 1 A GLU 159 ? CB ? A GLU 131 CB 117 15 Y 1 A GLU 159 ? CG ? A GLU 131 CG 118 15 Y 1 A GLU 159 ? CD ? A GLU 131 CD 119 15 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 120 15 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 121 16 Y 1 A GLU 159 ? CA ? A GLU 131 CA 122 16 Y 1 A GLU 159 ? C ? A GLU 131 C 123 16 Y 1 A GLU 159 ? O ? A GLU 131 O 124 16 Y 1 A GLU 159 ? CB ? A GLU 131 CB 125 16 Y 1 A GLU 159 ? CG ? A GLU 131 CG 126 16 Y 1 A GLU 159 ? CD ? A GLU 131 CD 127 16 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 128 16 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 129 17 Y 1 A GLU 159 ? CA ? A GLU 131 CA 130 17 Y 1 A GLU 159 ? C ? A GLU 131 C 131 17 Y 1 A GLU 159 ? O ? A GLU 131 O 132 17 Y 1 A GLU 159 ? CB ? A GLU 131 CB 133 17 Y 1 A GLU 159 ? CG ? A GLU 131 CG 134 17 Y 1 A GLU 159 ? CD ? A GLU 131 CD 135 17 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 136 17 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 137 18 Y 1 A GLU 159 ? CA ? A GLU 131 CA 138 18 Y 1 A GLU 159 ? C ? A GLU 131 C 139 18 Y 1 A GLU 159 ? O ? A GLU 131 O 140 18 Y 1 A GLU 159 ? CB ? A GLU 131 CB 141 18 Y 1 A GLU 159 ? CG ? A GLU 131 CG 142 18 Y 1 A GLU 159 ? CD ? A GLU 131 CD 143 18 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 144 18 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 145 19 Y 1 A GLU 159 ? CA ? A GLU 131 CA 146 19 Y 1 A GLU 159 ? C ? A GLU 131 C 147 19 Y 1 A GLU 159 ? O ? A GLU 131 O 148 19 Y 1 A GLU 159 ? CB ? A GLU 131 CB 149 19 Y 1 A GLU 159 ? CG ? A GLU 131 CG 150 19 Y 1 A GLU 159 ? CD ? A GLU 131 CD 151 19 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 152 19 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 153 20 Y 1 A GLU 159 ? CA ? A GLU 131 CA 154 20 Y 1 A GLU 159 ? C ? A GLU 131 C 155 20 Y 1 A GLU 159 ? O ? A GLU 131 O 156 20 Y 1 A GLU 159 ? CB ? A GLU 131 CB 157 20 Y 1 A GLU 159 ? CG ? A GLU 131 CG 158 20 Y 1 A GLU 159 ? CD ? A GLU 131 CD 159 20 Y 1 A GLU 159 ? OE1 ? A GLU 131 OE1 160 20 Y 1 A GLU 159 ? OE2 ? A GLU 131 OE2 # _cell.entry_id 3ZFJ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3ZFJ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 3ZFJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 3ZFJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 3ZFJ _struct.title 'N-terminal domain of pneumococcal PhtD protein with bound Zn(II)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3ZFJ _struct_keywords.pdbx_keywords 'ZINC-BINDING PROTEIN' _struct_keywords.text 'ZINC-BINDING PROTEIN, ZINC TRANSFER' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q04KS8_STRP2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q04KS8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3ZFJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 138 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q04KS8 _struct_ref_seq.db_align_beg 30 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 166 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 30 _struct_ref_seq.pdbx_auth_seq_align_end 166 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3ZFJ _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q04KS8 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 29 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 27 ? GLY A 36 ? THR A 55 GLY A 64 1 ? 10 HELX_P HELX_P2 2 THR A 121 ? LYS A 129 ? THR A 149 LYS A 157 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 35 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 63 A ZN 1159 1_555 ? ? ? ? ? ? ? 1.998 ? ? metalc2 metalc ? ? A HIS 55 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 83 A ZN 1159 1_555 ? ? ? ? ? ? ? 1.983 ? ? metalc3 metalc ? ? A HIS 58 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 86 A ZN 1159 1_555 ? ? ? ? ? ? ? 2.007 ? ? metalc4 metalc ? ? A HIS 60 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 88 A ZN 1159 1_555 ? ? ? ? ? ? ? 2.019 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 35 ? A GLU 63 ? 1_555 ZN ? B ZN . ? A ZN 1159 ? 1_555 NE2 ? A HIS 55 ? A HIS 83 ? 1_555 106.8 ? 2 OE2 ? A GLU 35 ? A GLU 63 ? 1_555 ZN ? B ZN . ? A ZN 1159 ? 1_555 NE2 ? A HIS 58 ? A HIS 86 ? 1_555 107.8 ? 3 NE2 ? A HIS 55 ? A HIS 83 ? 1_555 ZN ? B ZN . ? A ZN 1159 ? 1_555 NE2 ? A HIS 58 ? A HIS 86 ? 1_555 108.3 ? 4 OE2 ? A GLU 35 ? A GLU 63 ? 1_555 ZN ? B ZN . ? A ZN 1159 ? 1_555 ND1 ? A HIS 60 ? A HIS 88 ? 1_555 111.1 ? 5 NE2 ? A HIS 55 ? A HIS 83 ? 1_555 ZN ? B ZN . ? A ZN 1159 ? 1_555 ND1 ? A HIS 60 ? A HIS 88 ? 1_555 111.0 ? 6 NE2 ? A HIS 58 ? A HIS 86 ? 1_555 ZN ? B ZN . ? A ZN 1159 ? 1_555 ND1 ? A HIS 60 ? A HIS 88 ? 1_555 111.7 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? parallel AA 4 5 ? parallel AB 1 2 ? parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 HIS A 58 ? TYR A 62 ? HIS A 86 TYR A 90 AA 2 GLY A 50 ? HIS A 55 ? GLY A 78 HIS A 83 AA 3 ILE A 42 ? THR A 47 ? ILE A 70 THR A 75 AA 4 ILE A 71 ? SER A 73 ? ILE A 99 SER A 101 AA 5 ILE A 119 ? ARG A 120 ? ILE A 147 ARG A 148 AB 1 LEU A 77 ? MET A 78 ? LEU A 105 MET A 106 AB 2 LYS A 105 ? LEU A 110 ? LYS A 133 LEU A 138 AB 3 GLY A 97 ? VAL A 102 ? GLY A 125 VAL A 130 AB 4 ILE A 90 ? GLU A 93 ? ILE A 118 GLU A 121 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N TYR A 62 ? N TYR A 90 O TYR A 51 ? O TYR A 79 AA 2 3 N SER A 54 ? N SER A 82 O ILE A 42 ? O ILE A 70 AA 3 4 N VAL A 43 ? N VAL A 71 O ILE A 71 ? O ILE A 99 AA 4 5 O ILE A 72 ? O ILE A 100 N ARG A 120 ? N ARG A 148 AB 1 2 N MET A 78 ? N MET A 106 O VAL A 108 ? O VAL A 136 AB 2 3 N TYR A 109 ? N TYR A 137 O TYR A 98 ? O TYR A 126 AB 3 4 O VAL A 99 ? O VAL A 127 N VAL A 91 ? N VAL A 119 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 1159 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 1159' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLU A 35 ? GLU A 63 . ? 1_555 ? 2 AC1 5 ILE A 37 ? ILE A 65 . ? 1_555 ? 3 AC1 5 HIS A 55 ? HIS A 83 . ? 1_555 ? 4 AC1 5 HIS A 58 ? HIS A 86 . ? 1_555 ? 5 AC1 5 HIS A 60 ? HIS A 88 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 76 ? ? HZ3 A LYS 129 ? ? 1.59 2 2 HB2 A ALA 51 ? ? HB2 A ASN 91 ? ? 1.35 3 2 O A THR 149 ? ? H A ILE 153 ? ? 1.54 4 2 OD2 A ASP 131 ? ? HZ2 A LYS 133 ? ? 1.59 5 3 OD2 A ASP 131 ? ? HZ2 A LYS 133 ? ? 1.59 6 4 HA A ILE 42 ? ? HA A ALA 47 ? ? 1.25 7 4 HB3 A ASP 108 ? ? HB2 A TYR 111 ? ? 1.32 8 4 OD2 A ASP 131 ? ? HZ2 A LYS 133 ? ? 1.58 9 6 OD2 A ASP 131 ? ? HZ2 A LYS 133 ? ? 1.57 10 7 OD2 A ASP 131 ? ? HZ2 A LYS 133 ? ? 1.59 11 8 OD2 A ASP 131 ? ? HZ2 A LYS 133 ? ? 1.57 12 9 OD2 A ASP 131 ? ? HZ2 A LYS 133 ? ? 1.59 13 11 HB3 A HIS 88 ? ? HE1 A TYR 90 ? ? 1.32 14 11 OD2 A ASP 131 ? ? HZ2 A LYS 133 ? ? 1.58 15 11 HG1 A THR 55 ? ? OE1 A GLU 58 ? ? 1.58 16 12 H A ALA 51 ? ? HB3 A TYR 89 ? ? 1.10 17 12 HB3 A SER 60 ? ? HA A ASN 66 ? ? 1.30 18 12 O A THR 149 ? ? H A ILE 153 ? ? 1.59 19 13 HD13 A ILE 65 ? ? HA3 A GLY 84 ? ? 1.23 20 13 OD1 A ASP 76 ? ? HZ3 A LYS 129 ? ? 1.60 21 14 O A THR 149 ? ? H A ILE 153 ? ? 1.58 22 15 HB3 A HIS 88 ? ? HE1 A TYR 90 ? ? 1.33 23 15 HG1 A THR 55 ? ? OE1 A GLU 58 ? ? 1.60 24 18 H A ILE 100 ? ? O A ASN 146 ? ? 1.59 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 2 CE1 A TYR 79 ? ? CZ A TYR 79 ? ? 1.510 1.381 0.129 0.013 N 2 2 CZ A TYR 79 ? ? CE2 A TYR 79 ? ? 1.240 1.381 -0.141 0.013 N 3 6 CE1 A TYR 90 ? ? CZ A TYR 90 ? ? 1.496 1.381 0.115 0.013 N 4 6 CZ A TYR 90 ? ? CE2 A TYR 90 ? ? 1.255 1.381 -0.126 0.013 N 5 6 CE1 A TYR 137 ? ? CZ A TYR 137 ? ? 1.637 1.381 0.256 0.013 N 6 6 CZ A TYR 137 ? ? CE2 A TYR 137 ? ? 1.141 1.381 -0.240 0.013 N 7 7 CE1 A TYR 79 ? ? CZ A TYR 79 ? ? 1.499 1.381 0.118 0.013 N 8 7 CZ A TYR 79 ? ? CE2 A TYR 79 ? ? 1.249 1.381 -0.132 0.013 N 9 11 CE1 A TYR 79 ? ? CZ A TYR 79 ? ? 1.517 1.381 0.136 0.013 N 10 11 CZ A TYR 79 ? ? CE2 A TYR 79 ? ? 1.235 1.381 -0.146 0.013 N 11 11 CE1 A TYR 90 ? ? CZ A TYR 90 ? ? 1.478 1.381 0.097 0.013 N 12 11 CZ A TYR 90 ? ? CE2 A TYR 90 ? ? 1.277 1.381 -0.104 0.013 N 13 13 CE1 A TYR 90 ? ? CZ A TYR 90 ? ? 1.467 1.381 0.086 0.013 N 14 13 CZ A TYR 90 ? ? CE2 A TYR 90 ? ? 1.288 1.381 -0.093 0.013 N 15 15 CE1 A TYR 90 ? ? CZ A TYR 90 ? ? 1.474 1.381 0.093 0.013 N 16 15 CZ A TYR 90 ? ? CE2 A TYR 90 ? ? 1.281 1.381 -0.100 0.013 N 17 15 CE1 A TYR 134 ? ? CZ A TYR 134 ? ? 1.139 1.381 -0.242 0.013 N 18 15 CZ A TYR 134 ? ? CE2 A TYR 134 ? ? 1.624 1.381 0.243 0.013 N 19 16 CE1 A TYR 79 ? ? CZ A TYR 79 ? ? 1.511 1.381 0.130 0.013 N 20 16 CZ A TYR 79 ? ? CE2 A TYR 79 ? ? 1.241 1.381 -0.140 0.013 N 21 16 CE1 A TYR 90 ? ? CZ A TYR 90 ? ? 1.463 1.381 0.082 0.013 N 22 16 CZ A TYR 90 ? ? CE2 A TYR 90 ? ? 1.295 1.381 -0.086 0.013 N 23 17 CE1 A TYR 90 ? ? CZ A TYR 90 ? ? 1.473 1.381 0.092 0.013 N 24 17 CZ A TYR 90 ? ? CE2 A TYR 90 ? ? 1.278 1.381 -0.103 0.013 N 25 20 CE1 A TYR 90 ? ? CZ A TYR 90 ? ? 1.459 1.381 0.078 0.013 N 26 20 CZ A TYR 90 ? ? CE2 A TYR 90 ? ? 1.301 1.381 -0.080 0.013 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 6 CD1 A TYR 137 ? ? CE1 A TYR 137 ? ? CZ A TYR 137 ? ? 113.10 119.80 -6.70 0.90 N 2 6 CE1 A TYR 137 ? ? CZ A TYR 137 ? ? OH A TYR 137 ? ? 100.68 120.10 -19.42 2.70 N 3 15 CD1 A TYR 134 ? ? CE1 A TYR 134 ? ? CZ A TYR 134 ? ? 125.88 119.80 6.08 0.90 N 4 15 OH A TYR 134 ? ? CZ A TYR 134 ? ? CE2 A TYR 134 ? ? 103.22 120.10 -16.88 2.70 N 5 15 CE1 A TYR 134 ? ? CZ A TYR 134 ? ? OH A TYR 134 ? ? 137.58 120.10 17.48 2.70 N 6 15 CZ A TYR 134 ? ? CE2 A TYR 134 ? ? CD2 A TYR 134 ? ? 113.62 119.80 -6.18 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 42 ? ? -161.68 -51.69 2 1 ASP A 45 ? ? -119.96 -82.67 3 1 ALA A 47 ? ? -107.36 -168.40 4 1 LYS A 50 ? ? 74.29 145.46 5 1 ALA A 51 ? ? -179.96 78.92 6 1 ALA A 144 ? ? 65.00 92.62 7 1 ASN A 146 ? ? 85.13 41.64 8 1 GLN A 158 ? ? -81.92 -79.51 9 2 ALA A 47 ? ? -69.07 98.23 10 2 LEU A 113 ? ? -51.33 109.65 11 2 ALA A 144 ? ? 64.36 113.43 12 2 ASP A 145 ? ? -117.11 65.03 13 2 ASN A 146 ? ? 84.13 27.94 14 2 GLN A 158 ? ? -80.11 -80.22 15 3 ASP A 43 ? ? -154.04 -50.14 16 3 ASP A 45 ? ? -121.30 -58.89 17 3 GLN A 46 ? ? -84.81 -70.37 18 3 ALA A 47 ? ? 62.55 82.93 19 3 ALA A 51 ? ? 69.60 66.61 20 3 ASP A 108 ? ? -24.72 142.78 21 3 LEU A 113 ? ? -51.23 109.83 22 3 ALA A 144 ? ? 64.20 103.49 23 3 ASP A 145 ? ? -104.02 63.63 24 3 ASN A 146 ? ? 83.77 20.58 25 3 GLN A 158 ? ? -86.06 -89.85 26 4 ILE A 42 ? ? -107.73 -113.97 27 4 ASP A 43 ? ? 67.48 -20.86 28 4 ALA A 51 ? ? 167.75 59.82 29 4 ALA A 144 ? ? 65.28 115.23 30 4 ASN A 146 ? ? 83.71 17.48 31 4 GLN A 158 ? ? -76.73 -79.22 32 5 TYR A 41 ? ? -119.02 66.74 33 5 ASP A 45 ? ? -104.70 -72.60 34 5 GLN A 46 ? ? -92.76 -60.17 35 5 ALA A 47 ? ? -83.18 46.33 36 5 ALA A 51 ? ? 65.75 94.18 37 5 ASP A 108 ? ? -25.85 144.82 38 5 LEU A 113 ? ? -54.81 108.54 39 5 ALA A 144 ? ? 66.78 118.84 40 5 ASN A 146 ? ? 84.61 23.70 41 5 GLN A 158 ? ? -106.37 -106.06 42 6 TYR A 41 ? ? 69.55 122.42 43 6 ASP A 45 ? ? -36.74 -28.33 44 6 GLN A 46 ? ? -71.74 22.11 45 6 ALA A 51 ? ? 174.07 63.20 46 6 LEU A 113 ? ? -51.35 108.16 47 6 ALA A 144 ? ? 68.56 112.40 48 6 ASP A 145 ? ? -115.46 64.88 49 6 ASN A 146 ? ? 84.76 3.77 50 7 ASP A 43 ? ? 75.38 -46.25 51 7 ALA A 47 ? ? 64.55 -171.64 52 7 ALA A 51 ? ? 69.04 85.15 53 7 ASN A 66 ? ? 59.93 16.45 54 7 ALA A 144 ? ? 64.36 115.56 55 7 ASN A 146 ? ? 87.55 9.65 56 8 ILE A 42 ? ? 64.51 -71.10 57 8 ASP A 45 ? ? -112.93 -71.60 58 8 GLN A 46 ? ? -128.40 -60.49 59 8 GLN A 49 ? ? 65.50 173.29 60 8 ALA A 144 ? ? 66.39 102.11 61 8 ASP A 145 ? ? -101.24 64.10 62 8 ASN A 146 ? ? 81.16 27.87 63 9 ILE A 42 ? ? -81.41 -86.81 64 9 ASP A 43 ? ? 169.15 81.16 65 9 ASP A 45 ? ? -99.20 38.46 66 9 GLN A 46 ? ? -22.86 -40.22 67 9 ALA A 47 ? ? -164.59 36.83 68 9 ALA A 51 ? ? 61.02 68.87 69 9 ALA A 144 ? ? 62.36 115.40 70 9 ASP A 145 ? ? -118.93 65.66 71 9 ASN A 146 ? ? 86.19 18.26 72 10 ILE A 42 ? ? -167.72 -34.09 73 10 ASP A 43 ? ? -147.78 -51.78 74 10 GLN A 49 ? ? 56.61 -160.05 75 10 ALA A 51 ? ? 58.61 70.73 76 10 ASP A 108 ? ? -25.54 144.20 77 10 ALA A 144 ? ? 61.53 97.43 78 10 ASN A 146 ? ? 83.73 22.03 79 10 GLN A 158 ? ? -84.08 -71.58 80 11 ALA A 51 ? ? 176.39 65.11 81 11 GLU A 52 ? ? -33.63 109.72 82 11 ASN A 66 ? ? 51.55 4.32 83 11 ALA A 144 ? ? 66.02 122.10 84 11 ASN A 146 ? ? 83.54 7.29 85 11 GLN A 158 ? ? -93.56 -78.75 86 12 ASP A 43 ? ? 51.35 75.31 87 12 ASP A 45 ? ? -34.09 -35.89 88 12 GLN A 46 ? ? -73.22 22.14 89 12 LYS A 50 ? ? 63.11 120.00 90 12 ALA A 51 ? ? 64.58 85.48 91 12 ASP A 108 ? ? -23.82 140.61 92 12 ALA A 144 ? ? 58.14 106.01 93 12 ASP A 145 ? ? -118.99 65.09 94 12 ASN A 146 ? ? 83.01 14.62 95 13 ASP A 43 ? ? 77.60 -48.43 96 13 GLN A 49 ? ? 57.69 -156.21 97 13 ALA A 51 ? ? 166.84 48.38 98 13 GLU A 52 ? ? -38.21 115.94 99 13 ILE A 118 ? ? -57.42 109.12 100 13 ALA A 144 ? ? 67.08 119.22 101 13 ASN A 146 ? ? 83.72 10.76 102 14 GLN A 46 ? ? -128.09 -60.01 103 14 GLN A 49 ? ? -130.78 -156.98 104 14 LYS A 50 ? ? 68.50 100.79 105 14 ALA A 51 ? ? 62.12 64.25 106 14 ALA A 144 ? ? 70.32 157.05 107 14 GLN A 158 ? ? -69.94 -81.59 108 15 ASP A 45 ? ? -118.79 -71.69 109 15 GLN A 46 ? ? -125.18 -73.00 110 15 ALA A 47 ? ? 59.66 -174.11 111 15 LYS A 50 ? ? 64.33 92.28 112 15 ALA A 51 ? ? 174.83 58.16 113 15 GLU A 52 ? ? -36.67 122.25 114 15 ASN A 66 ? ? 68.78 -7.44 115 15 LEU A 113 ? ? -52.15 109.25 116 15 ALA A 144 ? ? 65.79 113.33 117 15 ASP A 145 ? ? -119.06 64.19 118 15 ASN A 146 ? ? 83.45 22.88 119 15 GLN A 158 ? ? -82.01 -80.70 120 16 ASP A 43 ? ? 72.04 -16.03 121 16 LYS A 50 ? ? 67.53 -176.05 122 16 ALA A 51 ? ? 70.95 71.05 123 16 LEU A 113 ? ? -59.92 104.86 124 16 ALA A 144 ? ? 66.20 116.61 125 16 ASN A 146 ? ? 82.52 37.95 126 16 GLN A 158 ? ? -91.64 -70.54 127 17 ILE A 42 ? ? 71.48 -67.11 128 17 GLN A 49 ? ? 61.50 -171.82 129 17 ALA A 51 ? ? 174.29 49.14 130 17 ASP A 108 ? ? -26.63 143.89 131 17 ALA A 144 ? ? 58.99 104.12 132 17 ASP A 145 ? ? -104.61 64.04 133 17 ASN A 146 ? ? 84.56 24.19 134 17 GLN A 158 ? ? -75.21 -80.34 135 18 ASP A 43 ? ? -151.56 -45.10 136 18 ALA A 51 ? ? 64.40 75.96 137 18 ALA A 144 ? ? 69.48 138.65 138 18 ASP A 145 ? ? -92.35 48.66 139 19 TYR A 41 ? ? -95.28 51.07 140 19 GLN A 49 ? ? -150.58 -154.28 141 19 ALA A 51 ? ? 145.01 85.60 142 19 LEU A 113 ? ? -52.37 108.93 143 19 ALA A 144 ? ? 65.36 109.25 144 19 ASN A 146 ? ? 85.61 11.49 145 19 GLN A 158 ? ? -107.06 72.65 146 20 ILE A 42 ? ? 64.76 81.87 147 20 ASP A 43 ? ? 170.97 99.04 148 20 LYS A 50 ? ? 72.32 161.17 149 20 ALA A 144 ? ? 62.21 108.15 150 20 ASP A 145 ? ? -114.78 68.12 151 20 ASN A 146 ? ? 85.07 39.17 152 20 GLN A 158 ? ? -79.77 -82.56 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 4 TYR A 111 ? ? 0.056 'SIDE CHAIN' 2 6 TYR A 137 ? ? 0.077 'SIDE CHAIN' # _pdbx_entry_details.entry_id 3ZFJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;RESIDUES 2-138 OF THE T-PHTD SEQUENCE CORRESPOND TO RESIDUES 30-166 OF THE Q04KS8 ENTRY ; _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble.entry_id 3ZFJ _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'TOTAL ENERGY' # _pdbx_nmr_representative.entry_id 3ZFJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '90% WATER, 10% D2O' ? ? ? ? 2 '100% D2O' ? ? ? ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 15N-HSQC 1 2 1 13C-HSQC 1 3 1 '3D-15N- NOESY' 1 4 1 3D-13C-NOESY 1 5 2 '2D- NOESY' 2 # _pdbx_nmr_details.entry_id 3ZFJ _pdbx_nmr_details.text ;BACKBONE ASSIGNMENT FROM STANDARD TRIPLE RESONANCE EXPERIMENTS. CCONH-TOCSY AND 3D-NOESY EXPERIMENTS FOR SIDECHAIN ASSIGNMENT. 2 3D-NOESY AND A 2D-NOESY IN D2O FOR THE EXTRACTION OF DISTANCE CONSTRAINTS. ; # _pdbx_nmr_refine.entry_id 3ZFJ _pdbx_nmr_refine.method 'UNIO10, ARIA' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? BRUNGER 1 'structure solution' CYANA ? ? 2 'structure solution' CNS ? ? 3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 29 ? A GLY 1 2 1 Y 1 A GLY 30 ? A GLY 2 3 1 Y 1 A GLN 31 ? A GLN 3 4 1 Y 1 A VAL 32 ? A VAL 4 5 1 Y 1 A LYS 33 ? A LYS 5 6 1 Y 1 A LYS 34 ? A LYS 6 7 1 Y 1 A GLU 35 ? A GLU 7 8 1 Y 1 A SER 36 ? A SER 8 9 1 Y 1 A ASN 37 ? A ASN 9 10 1 Y 1 A ARG 38 ? A ARG 10 11 1 Y 1 A VAL 39 ? A VAL 11 12 1 Y 1 A ARG 160 ? A ARG 132 13 1 Y 1 A SER 161 ? A SER 133 14 1 Y 1 A HIS 162 ? A HIS 134 15 1 Y 1 A ASN 163 ? A ASN 135 16 1 Y 1 A HIS 164 ? A HIS 136 17 1 Y 1 A ASN 165 ? A ASN 137 18 1 Y 1 A SER 166 ? A SER 138 19 2 Y 1 A GLY 29 ? A GLY 1 20 2 Y 1 A GLY 30 ? A GLY 2 21 2 Y 1 A GLN 31 ? A GLN 3 22 2 Y 1 A VAL 32 ? A VAL 4 23 2 Y 1 A LYS 33 ? A LYS 5 24 2 Y 1 A LYS 34 ? A LYS 6 25 2 Y 1 A GLU 35 ? A GLU 7 26 2 Y 1 A SER 36 ? A SER 8 27 2 Y 1 A ASN 37 ? A ASN 9 28 2 Y 1 A ARG 38 ? A ARG 10 29 2 Y 1 A VAL 39 ? A VAL 11 30 2 Y 1 A ARG 160 ? A ARG 132 31 2 Y 1 A SER 161 ? A SER 133 32 2 Y 1 A HIS 162 ? A HIS 134 33 2 Y 1 A ASN 163 ? A ASN 135 34 2 Y 1 A HIS 164 ? A HIS 136 35 2 Y 1 A ASN 165 ? A ASN 137 36 2 Y 1 A SER 166 ? A SER 138 37 3 Y 1 A GLY 29 ? A GLY 1 38 3 Y 1 A GLY 30 ? A GLY 2 39 3 Y 1 A GLN 31 ? A GLN 3 40 3 Y 1 A VAL 32 ? A VAL 4 41 3 Y 1 A LYS 33 ? A LYS 5 42 3 Y 1 A LYS 34 ? A LYS 6 43 3 Y 1 A GLU 35 ? A GLU 7 44 3 Y 1 A SER 36 ? A SER 8 45 3 Y 1 A ASN 37 ? A ASN 9 46 3 Y 1 A ARG 38 ? A ARG 10 47 3 Y 1 A VAL 39 ? A VAL 11 48 3 Y 1 A ARG 160 ? A ARG 132 49 3 Y 1 A SER 161 ? A SER 133 50 3 Y 1 A HIS 162 ? A HIS 134 51 3 Y 1 A ASN 163 ? A ASN 135 52 3 Y 1 A HIS 164 ? A HIS 136 53 3 Y 1 A ASN 165 ? A ASN 137 54 3 Y 1 A SER 166 ? A SER 138 55 4 Y 1 A GLY 29 ? A GLY 1 56 4 Y 1 A GLY 30 ? A GLY 2 57 4 Y 1 A GLN 31 ? A GLN 3 58 4 Y 1 A VAL 32 ? A VAL 4 59 4 Y 1 A LYS 33 ? A LYS 5 60 4 Y 1 A LYS 34 ? A LYS 6 61 4 Y 1 A GLU 35 ? A GLU 7 62 4 Y 1 A SER 36 ? A SER 8 63 4 Y 1 A ASN 37 ? A ASN 9 64 4 Y 1 A ARG 38 ? A ARG 10 65 4 Y 1 A VAL 39 ? A VAL 11 66 4 Y 1 A ARG 160 ? A ARG 132 67 4 Y 1 A SER 161 ? A SER 133 68 4 Y 1 A HIS 162 ? A HIS 134 69 4 Y 1 A ASN 163 ? A ASN 135 70 4 Y 1 A HIS 164 ? A HIS 136 71 4 Y 1 A ASN 165 ? A ASN 137 72 4 Y 1 A SER 166 ? A SER 138 73 5 Y 1 A GLY 29 ? A GLY 1 74 5 Y 1 A GLY 30 ? A GLY 2 75 5 Y 1 A GLN 31 ? A GLN 3 76 5 Y 1 A VAL 32 ? A VAL 4 77 5 Y 1 A LYS 33 ? A LYS 5 78 5 Y 1 A LYS 34 ? A LYS 6 79 5 Y 1 A GLU 35 ? A GLU 7 80 5 Y 1 A SER 36 ? A SER 8 81 5 Y 1 A ASN 37 ? A ASN 9 82 5 Y 1 A ARG 38 ? A ARG 10 83 5 Y 1 A VAL 39 ? A VAL 11 84 5 Y 1 A ARG 160 ? A ARG 132 85 5 Y 1 A SER 161 ? A SER 133 86 5 Y 1 A HIS 162 ? A HIS 134 87 5 Y 1 A ASN 163 ? A ASN 135 88 5 Y 1 A HIS 164 ? A HIS 136 89 5 Y 1 A ASN 165 ? A ASN 137 90 5 Y 1 A SER 166 ? A SER 138 91 6 Y 1 A GLY 29 ? A GLY 1 92 6 Y 1 A GLY 30 ? A GLY 2 93 6 Y 1 A GLN 31 ? A GLN 3 94 6 Y 1 A VAL 32 ? A VAL 4 95 6 Y 1 A LYS 33 ? A LYS 5 96 6 Y 1 A LYS 34 ? A LYS 6 97 6 Y 1 A GLU 35 ? A GLU 7 98 6 Y 1 A SER 36 ? A SER 8 99 6 Y 1 A ASN 37 ? A ASN 9 100 6 Y 1 A ARG 38 ? A ARG 10 101 6 Y 1 A VAL 39 ? A VAL 11 102 6 Y 1 A ARG 160 ? A ARG 132 103 6 Y 1 A SER 161 ? A SER 133 104 6 Y 1 A HIS 162 ? A HIS 134 105 6 Y 1 A ASN 163 ? A ASN 135 106 6 Y 1 A HIS 164 ? A HIS 136 107 6 Y 1 A ASN 165 ? A ASN 137 108 6 Y 1 A SER 166 ? A SER 138 109 7 Y 1 A GLY 29 ? A GLY 1 110 7 Y 1 A GLY 30 ? A GLY 2 111 7 Y 1 A GLN 31 ? A GLN 3 112 7 Y 1 A VAL 32 ? A VAL 4 113 7 Y 1 A LYS 33 ? A LYS 5 114 7 Y 1 A LYS 34 ? A LYS 6 115 7 Y 1 A GLU 35 ? A GLU 7 116 7 Y 1 A SER 36 ? A SER 8 117 7 Y 1 A ASN 37 ? A ASN 9 118 7 Y 1 A ARG 38 ? A ARG 10 119 7 Y 1 A VAL 39 ? A VAL 11 120 7 Y 1 A ARG 160 ? A ARG 132 121 7 Y 1 A SER 161 ? A SER 133 122 7 Y 1 A HIS 162 ? A HIS 134 123 7 Y 1 A ASN 163 ? A ASN 135 124 7 Y 1 A HIS 164 ? A HIS 136 125 7 Y 1 A ASN 165 ? A ASN 137 126 7 Y 1 A SER 166 ? A SER 138 127 8 Y 1 A GLY 29 ? A GLY 1 128 8 Y 1 A GLY 30 ? A GLY 2 129 8 Y 1 A GLN 31 ? A GLN 3 130 8 Y 1 A VAL 32 ? A VAL 4 131 8 Y 1 A LYS 33 ? A LYS 5 132 8 Y 1 A LYS 34 ? A LYS 6 133 8 Y 1 A GLU 35 ? A GLU 7 134 8 Y 1 A SER 36 ? A SER 8 135 8 Y 1 A ASN 37 ? A ASN 9 136 8 Y 1 A ARG 38 ? A ARG 10 137 8 Y 1 A VAL 39 ? A VAL 11 138 8 Y 1 A ARG 160 ? A ARG 132 139 8 Y 1 A SER 161 ? A SER 133 140 8 Y 1 A HIS 162 ? A HIS 134 141 8 Y 1 A ASN 163 ? A ASN 135 142 8 Y 1 A HIS 164 ? A HIS 136 143 8 Y 1 A ASN 165 ? A ASN 137 144 8 Y 1 A SER 166 ? A SER 138 145 9 Y 1 A GLY 29 ? A GLY 1 146 9 Y 1 A GLY 30 ? A GLY 2 147 9 Y 1 A GLN 31 ? A GLN 3 148 9 Y 1 A VAL 32 ? A VAL 4 149 9 Y 1 A LYS 33 ? A LYS 5 150 9 Y 1 A LYS 34 ? A LYS 6 151 9 Y 1 A GLU 35 ? A GLU 7 152 9 Y 1 A SER 36 ? A SER 8 153 9 Y 1 A ASN 37 ? A ASN 9 154 9 Y 1 A ARG 38 ? A ARG 10 155 9 Y 1 A VAL 39 ? A VAL 11 156 9 Y 1 A ARG 160 ? A ARG 132 157 9 Y 1 A SER 161 ? A SER 133 158 9 Y 1 A HIS 162 ? A HIS 134 159 9 Y 1 A ASN 163 ? A ASN 135 160 9 Y 1 A HIS 164 ? A HIS 136 161 9 Y 1 A ASN 165 ? A ASN 137 162 9 Y 1 A SER 166 ? A SER 138 163 10 Y 1 A GLY 29 ? A GLY 1 164 10 Y 1 A GLY 30 ? A GLY 2 165 10 Y 1 A GLN 31 ? A GLN 3 166 10 Y 1 A VAL 32 ? A VAL 4 167 10 Y 1 A LYS 33 ? A LYS 5 168 10 Y 1 A LYS 34 ? A LYS 6 169 10 Y 1 A GLU 35 ? A GLU 7 170 10 Y 1 A SER 36 ? A SER 8 171 10 Y 1 A ASN 37 ? A ASN 9 172 10 Y 1 A ARG 38 ? A ARG 10 173 10 Y 1 A VAL 39 ? A VAL 11 174 10 Y 1 A ARG 160 ? A ARG 132 175 10 Y 1 A SER 161 ? A SER 133 176 10 Y 1 A HIS 162 ? A HIS 134 177 10 Y 1 A ASN 163 ? A ASN 135 178 10 Y 1 A HIS 164 ? A HIS 136 179 10 Y 1 A ASN 165 ? A ASN 137 180 10 Y 1 A SER 166 ? A SER 138 181 11 Y 1 A GLY 29 ? A GLY 1 182 11 Y 1 A GLY 30 ? A GLY 2 183 11 Y 1 A GLN 31 ? A GLN 3 184 11 Y 1 A VAL 32 ? A VAL 4 185 11 Y 1 A LYS 33 ? A LYS 5 186 11 Y 1 A LYS 34 ? A LYS 6 187 11 Y 1 A GLU 35 ? A GLU 7 188 11 Y 1 A SER 36 ? A SER 8 189 11 Y 1 A ASN 37 ? A ASN 9 190 11 Y 1 A ARG 38 ? A ARG 10 191 11 Y 1 A VAL 39 ? A VAL 11 192 11 Y 1 A ARG 160 ? A ARG 132 193 11 Y 1 A SER 161 ? A SER 133 194 11 Y 1 A HIS 162 ? A HIS 134 195 11 Y 1 A ASN 163 ? A ASN 135 196 11 Y 1 A HIS 164 ? A HIS 136 197 11 Y 1 A ASN 165 ? A ASN 137 198 11 Y 1 A SER 166 ? A SER 138 199 12 Y 1 A GLY 29 ? A GLY 1 200 12 Y 1 A GLY 30 ? A GLY 2 201 12 Y 1 A GLN 31 ? A GLN 3 202 12 Y 1 A VAL 32 ? A VAL 4 203 12 Y 1 A LYS 33 ? A LYS 5 204 12 Y 1 A LYS 34 ? A LYS 6 205 12 Y 1 A GLU 35 ? A GLU 7 206 12 Y 1 A SER 36 ? A SER 8 207 12 Y 1 A ASN 37 ? A ASN 9 208 12 Y 1 A ARG 38 ? A ARG 10 209 12 Y 1 A VAL 39 ? A VAL 11 210 12 Y 1 A ARG 160 ? A ARG 132 211 12 Y 1 A SER 161 ? A SER 133 212 12 Y 1 A HIS 162 ? A HIS 134 213 12 Y 1 A ASN 163 ? A ASN 135 214 12 Y 1 A HIS 164 ? A HIS 136 215 12 Y 1 A ASN 165 ? A ASN 137 216 12 Y 1 A SER 166 ? A SER 138 217 13 Y 1 A GLY 29 ? A GLY 1 218 13 Y 1 A GLY 30 ? A GLY 2 219 13 Y 1 A GLN 31 ? A GLN 3 220 13 Y 1 A VAL 32 ? A VAL 4 221 13 Y 1 A LYS 33 ? A LYS 5 222 13 Y 1 A LYS 34 ? A LYS 6 223 13 Y 1 A GLU 35 ? A GLU 7 224 13 Y 1 A SER 36 ? A SER 8 225 13 Y 1 A ASN 37 ? A ASN 9 226 13 Y 1 A ARG 38 ? A ARG 10 227 13 Y 1 A VAL 39 ? A VAL 11 228 13 Y 1 A ARG 160 ? A ARG 132 229 13 Y 1 A SER 161 ? A SER 133 230 13 Y 1 A HIS 162 ? A HIS 134 231 13 Y 1 A ASN 163 ? A ASN 135 232 13 Y 1 A HIS 164 ? A HIS 136 233 13 Y 1 A ASN 165 ? A ASN 137 234 13 Y 1 A SER 166 ? A SER 138 235 14 Y 1 A GLY 29 ? A GLY 1 236 14 Y 1 A GLY 30 ? A GLY 2 237 14 Y 1 A GLN 31 ? A GLN 3 238 14 Y 1 A VAL 32 ? A VAL 4 239 14 Y 1 A LYS 33 ? A LYS 5 240 14 Y 1 A LYS 34 ? A LYS 6 241 14 Y 1 A GLU 35 ? A GLU 7 242 14 Y 1 A SER 36 ? A SER 8 243 14 Y 1 A ASN 37 ? A ASN 9 244 14 Y 1 A ARG 38 ? A ARG 10 245 14 Y 1 A VAL 39 ? A VAL 11 246 14 Y 1 A ARG 160 ? A ARG 132 247 14 Y 1 A SER 161 ? A SER 133 248 14 Y 1 A HIS 162 ? A HIS 134 249 14 Y 1 A ASN 163 ? A ASN 135 250 14 Y 1 A HIS 164 ? A HIS 136 251 14 Y 1 A ASN 165 ? A ASN 137 252 14 Y 1 A SER 166 ? A SER 138 253 15 Y 1 A GLY 29 ? A GLY 1 254 15 Y 1 A GLY 30 ? A GLY 2 255 15 Y 1 A GLN 31 ? A GLN 3 256 15 Y 1 A VAL 32 ? A VAL 4 257 15 Y 1 A LYS 33 ? A LYS 5 258 15 Y 1 A LYS 34 ? A LYS 6 259 15 Y 1 A GLU 35 ? A GLU 7 260 15 Y 1 A SER 36 ? A SER 8 261 15 Y 1 A ASN 37 ? A ASN 9 262 15 Y 1 A ARG 38 ? A ARG 10 263 15 Y 1 A VAL 39 ? A VAL 11 264 15 Y 1 A ARG 160 ? A ARG 132 265 15 Y 1 A SER 161 ? A SER 133 266 15 Y 1 A HIS 162 ? A HIS 134 267 15 Y 1 A ASN 163 ? A ASN 135 268 15 Y 1 A HIS 164 ? A HIS 136 269 15 Y 1 A ASN 165 ? A ASN 137 270 15 Y 1 A SER 166 ? A SER 138 271 16 Y 1 A GLY 29 ? A GLY 1 272 16 Y 1 A GLY 30 ? A GLY 2 273 16 Y 1 A GLN 31 ? A GLN 3 274 16 Y 1 A VAL 32 ? A VAL 4 275 16 Y 1 A LYS 33 ? A LYS 5 276 16 Y 1 A LYS 34 ? A LYS 6 277 16 Y 1 A GLU 35 ? A GLU 7 278 16 Y 1 A SER 36 ? A SER 8 279 16 Y 1 A ASN 37 ? A ASN 9 280 16 Y 1 A ARG 38 ? A ARG 10 281 16 Y 1 A VAL 39 ? A VAL 11 282 16 Y 1 A ARG 160 ? A ARG 132 283 16 Y 1 A SER 161 ? A SER 133 284 16 Y 1 A HIS 162 ? A HIS 134 285 16 Y 1 A ASN 163 ? A ASN 135 286 16 Y 1 A HIS 164 ? A HIS 136 287 16 Y 1 A ASN 165 ? A ASN 137 288 16 Y 1 A SER 166 ? A SER 138 289 17 Y 1 A GLY 29 ? A GLY 1 290 17 Y 1 A GLY 30 ? A GLY 2 291 17 Y 1 A GLN 31 ? A GLN 3 292 17 Y 1 A VAL 32 ? A VAL 4 293 17 Y 1 A LYS 33 ? A LYS 5 294 17 Y 1 A LYS 34 ? A LYS 6 295 17 Y 1 A GLU 35 ? A GLU 7 296 17 Y 1 A SER 36 ? A SER 8 297 17 Y 1 A ASN 37 ? A ASN 9 298 17 Y 1 A ARG 38 ? A ARG 10 299 17 Y 1 A VAL 39 ? A VAL 11 300 17 Y 1 A ARG 160 ? A ARG 132 301 17 Y 1 A SER 161 ? A SER 133 302 17 Y 1 A HIS 162 ? A HIS 134 303 17 Y 1 A ASN 163 ? A ASN 135 304 17 Y 1 A HIS 164 ? A HIS 136 305 17 Y 1 A ASN 165 ? A ASN 137 306 17 Y 1 A SER 166 ? A SER 138 307 18 Y 1 A GLY 29 ? A GLY 1 308 18 Y 1 A GLY 30 ? A GLY 2 309 18 Y 1 A GLN 31 ? A GLN 3 310 18 Y 1 A VAL 32 ? A VAL 4 311 18 Y 1 A LYS 33 ? A LYS 5 312 18 Y 1 A LYS 34 ? A LYS 6 313 18 Y 1 A GLU 35 ? A GLU 7 314 18 Y 1 A SER 36 ? A SER 8 315 18 Y 1 A ASN 37 ? A ASN 9 316 18 Y 1 A ARG 38 ? A ARG 10 317 18 Y 1 A VAL 39 ? A VAL 11 318 18 Y 1 A ARG 160 ? A ARG 132 319 18 Y 1 A SER 161 ? A SER 133 320 18 Y 1 A HIS 162 ? A HIS 134 321 18 Y 1 A ASN 163 ? A ASN 135 322 18 Y 1 A HIS 164 ? A HIS 136 323 18 Y 1 A ASN 165 ? A ASN 137 324 18 Y 1 A SER 166 ? A SER 138 325 19 Y 1 A GLY 29 ? A GLY 1 326 19 Y 1 A GLY 30 ? A GLY 2 327 19 Y 1 A GLN 31 ? A GLN 3 328 19 Y 1 A VAL 32 ? A VAL 4 329 19 Y 1 A LYS 33 ? A LYS 5 330 19 Y 1 A LYS 34 ? A LYS 6 331 19 Y 1 A GLU 35 ? A GLU 7 332 19 Y 1 A SER 36 ? A SER 8 333 19 Y 1 A ASN 37 ? A ASN 9 334 19 Y 1 A ARG 38 ? A ARG 10 335 19 Y 1 A VAL 39 ? A VAL 11 336 19 Y 1 A ARG 160 ? A ARG 132 337 19 Y 1 A SER 161 ? A SER 133 338 19 Y 1 A HIS 162 ? A HIS 134 339 19 Y 1 A ASN 163 ? A ASN 135 340 19 Y 1 A HIS 164 ? A HIS 136 341 19 Y 1 A ASN 165 ? A ASN 137 342 19 Y 1 A SER 166 ? A SER 138 343 20 Y 1 A GLY 29 ? A GLY 1 344 20 Y 1 A GLY 30 ? A GLY 2 345 20 Y 1 A GLN 31 ? A GLN 3 346 20 Y 1 A VAL 32 ? A VAL 4 347 20 Y 1 A LYS 33 ? A LYS 5 348 20 Y 1 A LYS 34 ? A LYS 6 349 20 Y 1 A GLU 35 ? A GLU 7 350 20 Y 1 A SER 36 ? A SER 8 351 20 Y 1 A ASN 37 ? A ASN 9 352 20 Y 1 A ARG 38 ? A ARG 10 353 20 Y 1 A VAL 39 ? A VAL 11 354 20 Y 1 A ARG 160 ? A ARG 132 355 20 Y 1 A SER 161 ? A SER 133 356 20 Y 1 A HIS 162 ? A HIS 134 357 20 Y 1 A ASN 163 ? A ASN 135 358 20 Y 1 A HIS 164 ? A HIS 136 359 20 Y 1 A ASN 165 ? A ASN 137 360 20 Y 1 A SER 166 ? A SER 138 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 ZN ZN ZN N N 324 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PRO N CA sing N N 222 PRO N CD sing N N 223 PRO N H sing N N 224 PRO CA C sing N N 225 PRO CA CB sing N N 226 PRO CA HA sing N N 227 PRO C O doub N N 228 PRO C OXT sing N N 229 PRO CB CG sing N N 230 PRO CB HB2 sing N N 231 PRO CB HB3 sing N N 232 PRO CG CD sing N N 233 PRO CG HG2 sing N N 234 PRO CG HG3 sing N N 235 PRO CD HD2 sing N N 236 PRO CD HD3 sing N N 237 PRO OXT HXT sing N N 238 SER N CA sing N N 239 SER N H sing N N 240 SER N H2 sing N N 241 SER CA C sing N N 242 SER CA CB sing N N 243 SER CA HA sing N N 244 SER C O doub N N 245 SER C OXT sing N N 246 SER CB OG sing N N 247 SER CB HB2 sing N N 248 SER CB HB3 sing N N 249 SER OG HG sing N N 250 SER OXT HXT sing N N 251 THR N CA sing N N 252 THR N H sing N N 253 THR N H2 sing N N 254 THR CA C sing N N 255 THR CA CB sing N N 256 THR CA HA sing N N 257 THR C O doub N N 258 THR C OXT sing N N 259 THR CB OG1 sing N N 260 THR CB CG2 sing N N 261 THR CB HB sing N N 262 THR OG1 HG1 sing N N 263 THR CG2 HG21 sing N N 264 THR CG2 HG22 sing N N 265 THR CG2 HG23 sing N N 266 THR OXT HXT sing N N 267 TYR N CA sing N N 268 TYR N H sing N N 269 TYR N H2 sing N N 270 TYR CA C sing N N 271 TYR CA CB sing N N 272 TYR CA HA sing N N 273 TYR C O doub N N 274 TYR C OXT sing N N 275 TYR CB CG sing N N 276 TYR CB HB2 sing N N 277 TYR CB HB3 sing N N 278 TYR CG CD1 doub Y N 279 TYR CG CD2 sing Y N 280 TYR CD1 CE1 sing Y N 281 TYR CD1 HD1 sing N N 282 TYR CD2 CE2 doub Y N 283 TYR CD2 HD2 sing N N 284 TYR CE1 CZ doub Y N 285 TYR CE1 HE1 sing N N 286 TYR CE2 CZ sing Y N 287 TYR CE2 HE2 sing N N 288 TYR CZ OH sing N N 289 TYR OH HH sing N N 290 TYR OXT HXT sing N N 291 VAL N CA sing N N 292 VAL N H sing N N 293 VAL N H2 sing N N 294 VAL CA C sing N N 295 VAL CA CB sing N N 296 VAL CA HA sing N N 297 VAL C O doub N N 298 VAL C OXT sing N N 299 VAL CB CG1 sing N N 300 VAL CB CG2 sing N N 301 VAL CB HB sing N N 302 VAL CG1 HG11 sing N N 303 VAL CG1 HG12 sing N N 304 VAL CG1 HG13 sing N N 305 VAL CG2 HG21 sing N N 306 VAL CG2 HG22 sing N N 307 VAL CG2 HG23 sing N N 308 VAL OXT HXT sing N N 309 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model VNMRS800 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 3ZFJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_