data_3ZU8 # _entry.id 3ZU8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3ZU8 PDBE EBI-49034 WWPDB D_1290049034 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 3ZQW unspecified 'STRUCTURE OF CBM3B OF MAJOR SCAFFOLDIN SUBUNIT SCAA FROM ACETIVIBRIO CELLULOLYTICUS' PDB 3ZUC unspecified 'STRUCTURE OF CBM3B OF MAJOR SCAFFOLDIN SUBUNIT SCAA FROM ACETIVIBRIO CELLULOLYTICUS GROWN IN THE PRESENCE OF NICKEL' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3ZU8 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2011-07-17 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yaniv, O.' 1 'Halfon, Y.' 2 'Lamed, R.' 3 'Frolow, F.' 4 # _citation.id primary _citation.title 'Structure of Cbm3B of the Major Scaffoldin Subunit Scaa from Acetivibrio Cellulolyticus' _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_volume 68 _citation.page_first 8 _citation.page_last ? _citation.year 2012 _citation.journal_id_ASTM ? _citation.country DK _citation.journal_id_ISSN 1744-3091 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22232162 _citation.pdbx_database_id_DOI 10.1107/S174430911104807X # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yaniv, O.' 1 primary 'Halfon, Y.' 2 primary 'Shimon, L.J.W.' 3 primary 'Bayer, E.A.' 4 primary 'Lamed, R.' 5 primary 'Frolow, F.' 6 # _cell.entry_id 3ZU8 _cell.length_a 52.263 _cell.length_b 52.263 _cell.length_c 192.938 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3ZU8 _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CELLULOSOMAL SCAFFOLDIN' 16788.248 1 ? ? 'RESIDUES 973-1121' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 non-polymer syn 'NICKEL (II) ION' 58.693 1 ? ? ? ? 5 non-polymer syn 'PENTAETHYLENE GLYCOL' 238.278 1 ? ? ? ? 6 water nat water 18.015 174 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FAMILY 3B CARBOHYDRATE BINDING MODULE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMNLKVEFFNAGTQAQSNSIYPKFRLTNTGSNAINLADVKLHYYFTVDGDKAQTFWCDWSPVGSSNVTGTFVKMNPTT TGADQYLEIAFSSAAGTLAANTSIEVQGRFAKSDWTNYNQADDYSFNSSATTYTSWDKVTAYSAEGLIWGIEP ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMNLKVEFFNAGTQAQSNSIYPKFRLTNTGSNAINLADVKLHYYFTVDGDKAQTFWCDWSPVGSSNVTGTFVKMNPTT TGADQYLEIAFSSAAGTLAANTSIEVQGRFAKSDWTNYNQADDYSFNSSATTYTSWDKVTAYSAEGLIWGIEP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ASN n 1 6 LEU n 1 7 LYS n 1 8 VAL n 1 9 GLU n 1 10 PHE n 1 11 PHE n 1 12 ASN n 1 13 ALA n 1 14 GLY n 1 15 THR n 1 16 GLN n 1 17 ALA n 1 18 GLN n 1 19 SER n 1 20 ASN n 1 21 SER n 1 22 ILE n 1 23 TYR n 1 24 PRO n 1 25 LYS n 1 26 PHE n 1 27 ARG n 1 28 LEU n 1 29 THR n 1 30 ASN n 1 31 THR n 1 32 GLY n 1 33 SER n 1 34 ASN n 1 35 ALA n 1 36 ILE n 1 37 ASN n 1 38 LEU n 1 39 ALA n 1 40 ASP n 1 41 VAL n 1 42 LYS n 1 43 LEU n 1 44 HIS n 1 45 TYR n 1 46 TYR n 1 47 PHE n 1 48 THR n 1 49 VAL n 1 50 ASP n 1 51 GLY n 1 52 ASP n 1 53 LYS n 1 54 ALA n 1 55 GLN n 1 56 THR n 1 57 PHE n 1 58 TRP n 1 59 CYS n 1 60 ASP n 1 61 TRP n 1 62 SER n 1 63 PRO n 1 64 VAL n 1 65 GLY n 1 66 SER n 1 67 SER n 1 68 ASN n 1 69 VAL n 1 70 THR n 1 71 GLY n 1 72 THR n 1 73 PHE n 1 74 VAL n 1 75 LYS n 1 76 MET n 1 77 ASN n 1 78 PRO n 1 79 THR n 1 80 THR n 1 81 THR n 1 82 GLY n 1 83 ALA n 1 84 ASP n 1 85 GLN n 1 86 TYR n 1 87 LEU n 1 88 GLU n 1 89 ILE n 1 90 ALA n 1 91 PHE n 1 92 SER n 1 93 SER n 1 94 ALA n 1 95 ALA n 1 96 GLY n 1 97 THR n 1 98 LEU n 1 99 ALA n 1 100 ALA n 1 101 ASN n 1 102 THR n 1 103 SER n 1 104 ILE n 1 105 GLU n 1 106 VAL n 1 107 GLN n 1 108 GLY n 1 109 ARG n 1 110 PHE n 1 111 ALA n 1 112 LYS n 1 113 SER n 1 114 ASP n 1 115 TRP n 1 116 THR n 1 117 ASN n 1 118 TYR n 1 119 ASN n 1 120 GLN n 1 121 ALA n 1 122 ASP n 1 123 ASP n 1 124 TYR n 1 125 SER n 1 126 PHE n 1 127 ASN n 1 128 SER n 1 129 SER n 1 130 ALA n 1 131 THR n 1 132 THR n 1 133 TYR n 1 134 THR n 1 135 SER n 1 136 TRP n 1 137 ASP n 1 138 LYS n 1 139 VAL n 1 140 THR n 1 141 ALA n 1 142 TYR n 1 143 SER n 1 144 ALA n 1 145 GLU n 1 146 GLY n 1 147 LEU n 1 148 ILE n 1 149 TRP n 1 150 GLY n 1 151 ILE n 1 152 GLU n 1 153 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ACETIVIBRIO CELLULOLYTICUS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 35830 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 33288 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant RIL _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PET28A _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9RPL0_9FIRM _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q9RPL0 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3ZU8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9RPL0 _struct_ref_seq.db_align_beg 973 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 153 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3ZU8 GLY A 1 ? UNP Q9RPL0 ? ? 'expression tag' 1 1 1 3ZU8 SER A 2 ? UNP Q9RPL0 ? ? 'expression tag' 2 2 1 3ZU8 HIS A 3 ? UNP Q9RPL0 ? ? 'expression tag' 3 3 1 3ZU8 MET A 4 ? UNP Q9RPL0 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1PE non-polymer . 'PENTAETHYLENE GLYCOL' PEG400 'C10 H22 O6' 238.278 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3ZU8 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_percent_sol 45.2 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1.9 M AMMONIUM SULFATE, 0.1 M HEPES PH 7.5, 0.5% (W/V) POLYETHYLENE GLYCOL 400.' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2011-04-13 _diffrn_detector.details 'BENT COLLIMATING MIRROR AND TOROID' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111) MONOCHROMATOR.' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.48395 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_wavelength 1.48395 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 3ZU8 _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 1.80 _reflns.number_obs 15471 _reflns.number_all ? _reflns.percent_possible_obs 99.3 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 43.60 _reflns.B_iso_Wilson_estimate 20.3 _reflns.pdbx_redundancy 10.9 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.83 _reflns_shell.percent_possible_all 97.1 _reflns_shell.Rmerge_I_obs 0.36 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4.96 _reflns_shell.pdbx_redundancy 9.9 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3ZU8 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 27239 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 45.261 _refine.ls_d_res_high 1.801 _refine.ls_percent_reflns_obs 99.81 _refine.ls_R_factor_obs 0.1554 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1540 _refine.ls_R_factor_R_free 0.1819 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 1360 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 11.05 _refine.aniso_B[1][1] 2.2620 _refine.aniso_B[2][2] 2.2620 _refine.aniso_B[3][3] -4.5239 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.348 _refine.solvent_model_param_bsol 50.117 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details '27239 REFLECTIONS USED IN REFINEMENT USIN SEPARATED FRIEDEL PAIRS.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.38 _refine.pdbx_overall_phase_error 15.21 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1187 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 174 _refine_hist.number_atoms_total 1383 _refine_hist.d_res_high 1.801 _refine_hist.d_res_low 45.261 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.007 ? ? 1333 'X-RAY DIFFRACTION' ? f_angle_d 1.109 ? ? 1826 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.209 ? ? 462 'X-RAY DIFFRACTION' ? f_chiral_restr 0.091 ? ? 193 'X-RAY DIFFRACTION' ? f_plane_restr 0.004 ? ? 238 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.8005 1.8649 2578 0.2201 99.00 0.2200 . . 141 . . 'X-RAY DIFFRACTION' . 1.8649 1.9395 2585 0.1608 100.00 0.2014 . . 136 . . 'X-RAY DIFFRACTION' . 1.9395 2.0278 2579 0.1373 100.00 0.1699 . . 137 . . 'X-RAY DIFFRACTION' . 2.0278 2.1347 2565 0.1339 100.00 0.1570 . . 140 . . 'X-RAY DIFFRACTION' . 2.1347 2.2685 2639 0.1469 100.00 0.2025 . . 134 . . 'X-RAY DIFFRACTION' . 2.2685 2.4436 2575 0.1513 100.00 0.1895 . . 133 . . 'X-RAY DIFFRACTION' . 2.4436 2.6895 2588 0.1582 100.00 0.2085 . . 136 . . 'X-RAY DIFFRACTION' . 2.6895 3.0786 2606 0.1646 100.00 0.1779 . . 136 . . 'X-RAY DIFFRACTION' . 3.0786 3.8784 2575 0.1443 100.00 0.1507 . . 134 . . 'X-RAY DIFFRACTION' . 3.8784 45.2754 2589 0.1554 99.00 0.1926 . . 133 . . # _struct.entry_id 3ZU8 _struct.title 'STRUCTURE OF CBM3B OF MAJOR SCAFFOLDIN SUBUNIT SCAA FROM ACETIVIBRIO CELLULOLYTICUS DETERMINED ON THE NIKEL ABSORPTION EDGE' _struct.pdbx_descriptor 'CELLULOSOMAL SCAFFOLDIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3ZU8 _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' _struct_keywords.text 'SUGAR BINDING PROTEIN, CELLULOSOME' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 65 ? SER A 67 ? GLY A 65 SER A 67 5 ? 3 HELX_P HELX_P2 2 SER A 93 ? ALA A 95 ? SER A 93 ALA A 95 5 ? 3 HELX_P HELX_P3 3 ALA A 121 ? ASP A 123 ? ALA A 121 ASP A 123 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B CA . CA ? ? ? 1_555 A THR 48 OG1 ? ? A CA 1154 A THR 48 1_555 ? ? ? ? ? ? ? 2.449 ? metalc2 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 122 OD1 ? ? A CA 1154 A ASP 122 1_555 ? ? ? ? ? ? ? 2.465 ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 A ASN 119 O ? ? A CA 1154 A ASN 119 1_555 ? ? ? ? ? ? ? 2.387 ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 A THR 48 O ? ? A CA 1154 A THR 48 1_555 ? ? ? ? ? ? ? 2.533 ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 123 OD1 ? ? A CA 1154 A ASP 123 1_555 ? ? ? ? ? ? ? 2.391 ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 1154 A HOH 2066 1_555 ? ? ? ? ? ? ? 2.554 ? metalc7 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 50 OD2 ? ? A CA 1154 A ASP 50 1_555 ? ? ? ? ? ? ? 2.339 ? metalc8 metalc ? ? D NI . NI ? ? ? 1_555 A GLU 145 OE2 ? ? A NI 1156 A GLU 145 10_664 ? ? ? ? ? ? ? 2.768 ? metalc9 metalc ? ? D NI . NI ? ? ? 1_555 A HIS 3 ND1 ? ? A NI 1156 A HIS 3 1_555 ? ? ? ? ? ? ? 2.458 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 77 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 77 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 78 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 78 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.05 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 2 ? AC ? 2 ? AD ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AB 1 2 ? anti-parallel AC 1 2 ? anti-parallel AD 1 2 ? anti-parallel AD 2 3 ? anti-parallel AD 3 4 ? anti-parallel AD 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLN A 55 ? TRP A 61 ? GLN A 55 TRP A 61 AA 2 SER A 103 ? LYS A 112 ? SER A 103 LYS A 112 AA 3 PRO A 24 ? ASN A 30 ? PRO A 24 ASN A 30 AA 4 LEU A 6 ? ASN A 12 ? LEU A 6 ASN A 12 AA 5 THR A 134 ? SER A 135 ? THR A 134 SER A 135 AB 1 GLN A 18 ? SER A 19 ? GLN A 18 SER A 19 AB 2 TYR A 118 ? ASN A 119 ? TYR A 118 ASN A 119 AC 1 ILE A 36 ? ASN A 37 ? ILE A 36 ASN A 37 AC 2 THR A 97 ? LEU A 98 ? THR A 97 LEU A 98 AD 1 VAL A 69 ? THR A 80 ? VAL A 69 THR A 80 AD 2 ALA A 83 ? PHE A 91 ? ALA A 83 PHE A 91 AD 3 LYS A 42 ? PHE A 47 ? LYS A 42 PHE A 47 AD 4 THR A 140 ? SER A 143 ? THR A 140 SER A 143 AD 5 GLY A 146 ? TRP A 149 ? GLY A 146 TRP A 149 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ASP A 60 ? N ASP A 60 O GLN A 107 ? O GLN A 107 AA 2 3 N GLY A 108 ? N GLY A 108 O PRO A 24 ? O PRO A 24 AA 3 4 N THR A 29 ? N THR A 29 O LYS A 7 ? O LYS A 7 AA 4 5 N PHE A 10 ? N PHE A 10 O THR A 134 ? O THR A 134 AB 1 2 N SER A 19 ? N SER A 19 O TYR A 118 ? O TYR A 118 AC 1 2 N ILE A 36 ? N ILE A 36 O LEU A 98 ? O LEU A 98 AD 1 2 N THR A 80 ? N THR A 80 O ALA A 83 ? O ALA A 83 AD 2 3 N ILE A 89 ? N ILE A 89 O LEU A 43 ? O LEU A 43 AD 3 4 N HIS A 44 ? N HIS A 44 O THR A 140 ? O THR A 140 AD 4 5 N SER A 143 ? N SER A 143 O GLY A 146 ? O GLY A 146 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 1154' AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE EDO A 1155' AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI A 1156' AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE 1PE A 1157' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 THR A 48 ? THR A 48 . ? 1_555 ? 2 AC1 6 ASP A 50 ? ASP A 50 . ? 1_555 ? 3 AC1 6 ASN A 119 ? ASN A 119 . ? 1_555 ? 4 AC1 6 ASP A 122 ? ASP A 122 . ? 1_555 ? 5 AC1 6 ASP A 123 ? ASP A 123 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 2066 . ? 1_555 ? 7 AC2 8 HIS A 44 ? HIS A 44 . ? 1_555 ? 8 AC2 8 TYR A 46 ? TYR A 46 . ? 1_555 ? 9 AC2 8 TYR A 86 ? TYR A 86 . ? 1_555 ? 10 AC2 8 TYR A 142 ? TYR A 142 . ? 1_555 ? 11 AC2 8 GLU A 152 ? GLU A 152 . ? 1_555 ? 12 AC2 8 1PE E . ? 1PE A 1157 . ? 8_675 ? 13 AC2 8 1PE E . ? 1PE A 1157 . ? 1_555 ? 14 AC2 8 HOH F . ? HOH A 2173 . ? 1_555 ? 15 AC3 4 GLY A 1 ? GLY A 1 . ? 1_555 ? 16 AC3 4 SER A 2 ? SER A 2 . ? 1_555 ? 17 AC3 4 HIS A 3 ? HIS A 3 . ? 1_555 ? 18 AC3 4 GLU A 145 ? GLU A 145 . ? 10_664 ? 19 AC4 7 LYS A 42 ? LYS A 42 . ? 1_555 ? 20 AC4 7 LYS A 42 ? LYS A 42 . ? 8_675 ? 21 AC4 7 GLU A 88 ? GLU A 88 . ? 1_555 ? 22 AC4 7 GLU A 88 ? GLU A 88 . ? 8_675 ? 23 AC4 7 SER A 143 ? SER A 143 . ? 8_675 ? 24 AC4 7 EDO C . ? EDO A 1155 . ? 8_675 ? 25 AC4 7 EDO C . ? EDO A 1155 . ? 1_555 ? # _database_PDB_matrix.entry_id 3ZU8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3ZU8 _atom_sites.fract_transf_matrix[1][1] 0.019134 _atom_sites.fract_transf_matrix[1][2] 0.011047 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022094 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005183 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N NI O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 TRP 136 136 136 TRP TRP A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 TRP 149 149 149 TRP TRP A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 PRO 153 153 153 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 1154 1154 CA CA A . C 3 EDO 1 1155 1155 EDO EDO A . D 4 NI 1 1156 1156 NI NI A . E 5 1PE 1 1157 1157 1PE 1PE A . F 6 HOH 1 2001 2001 HOH HOH A . F 6 HOH 2 2002 2002 HOH HOH A . F 6 HOH 3 2003 2003 HOH HOH A . F 6 HOH 4 2004 2004 HOH HOH A . F 6 HOH 5 2005 2005 HOH HOH A . F 6 HOH 6 2006 2006 HOH HOH A . F 6 HOH 7 2007 2007 HOH HOH A . F 6 HOH 8 2008 2008 HOH HOH A . F 6 HOH 9 2009 2009 HOH HOH A . F 6 HOH 10 2010 2010 HOH HOH A . F 6 HOH 11 2011 2011 HOH HOH A . F 6 HOH 12 2012 2012 HOH HOH A . F 6 HOH 13 2013 2013 HOH HOH A . F 6 HOH 14 2014 2014 HOH HOH A . F 6 HOH 15 2015 2015 HOH HOH A . F 6 HOH 16 2016 2016 HOH HOH A . F 6 HOH 17 2017 2017 HOH HOH A . F 6 HOH 18 2018 2018 HOH HOH A . F 6 HOH 19 2019 2019 HOH HOH A . F 6 HOH 20 2020 2020 HOH HOH A . F 6 HOH 21 2021 2021 HOH HOH A . F 6 HOH 22 2022 2022 HOH HOH A . F 6 HOH 23 2023 2023 HOH HOH A . F 6 HOH 24 2024 2024 HOH HOH A . F 6 HOH 25 2025 2025 HOH HOH A . F 6 HOH 26 2026 2026 HOH HOH A . F 6 HOH 27 2027 2027 HOH HOH A . F 6 HOH 28 2028 2028 HOH HOH A . F 6 HOH 29 2029 2029 HOH HOH A . F 6 HOH 30 2030 2030 HOH HOH A . F 6 HOH 31 2031 2031 HOH HOH A . F 6 HOH 32 2032 2032 HOH HOH A . F 6 HOH 33 2033 2033 HOH HOH A . F 6 HOH 34 2034 2034 HOH HOH A . F 6 HOH 35 2035 2035 HOH HOH A . F 6 HOH 36 2036 2036 HOH HOH A . F 6 HOH 37 2037 2037 HOH HOH A . F 6 HOH 38 2038 2038 HOH HOH A . F 6 HOH 39 2039 2039 HOH HOH A . F 6 HOH 40 2040 2040 HOH HOH A . F 6 HOH 41 2041 2041 HOH HOH A . F 6 HOH 42 2042 2042 HOH HOH A . F 6 HOH 43 2043 2043 HOH HOH A . F 6 HOH 44 2044 2044 HOH HOH A . F 6 HOH 45 2045 2045 HOH HOH A . F 6 HOH 46 2046 2046 HOH HOH A . F 6 HOH 47 2047 2047 HOH HOH A . F 6 HOH 48 2048 2048 HOH HOH A . F 6 HOH 49 2049 2049 HOH HOH A . F 6 HOH 50 2050 2050 HOH HOH A . F 6 HOH 51 2051 2051 HOH HOH A . F 6 HOH 52 2052 2052 HOH HOH A . F 6 HOH 53 2053 2053 HOH HOH A . F 6 HOH 54 2054 2054 HOH HOH A . F 6 HOH 55 2055 2055 HOH HOH A . F 6 HOH 56 2056 2056 HOH HOH A . F 6 HOH 57 2057 2057 HOH HOH A . F 6 HOH 58 2058 2058 HOH HOH A . F 6 HOH 59 2059 2059 HOH HOH A . F 6 HOH 60 2060 2060 HOH HOH A . F 6 HOH 61 2061 2061 HOH HOH A . F 6 HOH 62 2062 2062 HOH HOH A . F 6 HOH 63 2063 2063 HOH HOH A . F 6 HOH 64 2064 2064 HOH HOH A . F 6 HOH 65 2065 2065 HOH HOH A . F 6 HOH 66 2066 2066 HOH HOH A . F 6 HOH 67 2067 2067 HOH HOH A . F 6 HOH 68 2068 2068 HOH HOH A . F 6 HOH 69 2069 2069 HOH HOH A . F 6 HOH 70 2070 2070 HOH HOH A . F 6 HOH 71 2071 2071 HOH HOH A . F 6 HOH 72 2072 2072 HOH HOH A . F 6 HOH 73 2073 2073 HOH HOH A . F 6 HOH 74 2074 2074 HOH HOH A . F 6 HOH 75 2075 2075 HOH HOH A . F 6 HOH 76 2076 2076 HOH HOH A . F 6 HOH 77 2077 2077 HOH HOH A . F 6 HOH 78 2078 2078 HOH HOH A . F 6 HOH 79 2079 2079 HOH HOH A . F 6 HOH 80 2080 2080 HOH HOH A . F 6 HOH 81 2081 2081 HOH HOH A . F 6 HOH 82 2082 2082 HOH HOH A . F 6 HOH 83 2083 2083 HOH HOH A . F 6 HOH 84 2084 2084 HOH HOH A . F 6 HOH 85 2085 2085 HOH HOH A . F 6 HOH 86 2086 2086 HOH HOH A . F 6 HOH 87 2087 2087 HOH HOH A . F 6 HOH 88 2088 2088 HOH HOH A . F 6 HOH 89 2089 2089 HOH HOH A . F 6 HOH 90 2090 2090 HOH HOH A . F 6 HOH 91 2091 2091 HOH HOH A . F 6 HOH 92 2092 2092 HOH HOH A . F 6 HOH 93 2093 2093 HOH HOH A . F 6 HOH 94 2094 2094 HOH HOH A . F 6 HOH 95 2095 2095 HOH HOH A . F 6 HOH 96 2096 2096 HOH HOH A . F 6 HOH 97 2097 2097 HOH HOH A . F 6 HOH 98 2098 2098 HOH HOH A . F 6 HOH 99 2099 2099 HOH HOH A . F 6 HOH 100 2100 2100 HOH HOH A . F 6 HOH 101 2101 2101 HOH HOH A . F 6 HOH 102 2102 2102 HOH HOH A . F 6 HOH 103 2103 2103 HOH HOH A . F 6 HOH 104 2104 2104 HOH HOH A . F 6 HOH 105 2105 2105 HOH HOH A . F 6 HOH 106 2106 2106 HOH HOH A . F 6 HOH 107 2107 2107 HOH HOH A . F 6 HOH 108 2108 2108 HOH HOH A . F 6 HOH 109 2109 2109 HOH HOH A . F 6 HOH 110 2110 2110 HOH HOH A . F 6 HOH 111 2111 2111 HOH HOH A . F 6 HOH 112 2112 2112 HOH HOH A . F 6 HOH 113 2113 2113 HOH HOH A . F 6 HOH 114 2114 2114 HOH HOH A . F 6 HOH 115 2115 2115 HOH HOH A . F 6 HOH 116 2116 2116 HOH HOH A . F 6 HOH 117 2117 2117 HOH HOH A . F 6 HOH 118 2118 2118 HOH HOH A . F 6 HOH 119 2119 2119 HOH HOH A . F 6 HOH 120 2120 2120 HOH HOH A . F 6 HOH 121 2121 2121 HOH HOH A . F 6 HOH 122 2122 2122 HOH HOH A . F 6 HOH 123 2123 2123 HOH HOH A . F 6 HOH 124 2124 2124 HOH HOH A . F 6 HOH 125 2125 2125 HOH HOH A . F 6 HOH 126 2126 2126 HOH HOH A . F 6 HOH 127 2127 2127 HOH HOH A . F 6 HOH 128 2128 2128 HOH HOH A . F 6 HOH 129 2129 2129 HOH HOH A . F 6 HOH 130 2130 2130 HOH HOH A . F 6 HOH 131 2131 2131 HOH HOH A . F 6 HOH 132 2132 2132 HOH HOH A . F 6 HOH 133 2133 2133 HOH HOH A . F 6 HOH 134 2134 2134 HOH HOH A . F 6 HOH 135 2135 2135 HOH HOH A . F 6 HOH 136 2136 2136 HOH HOH A . F 6 HOH 137 2137 2137 HOH HOH A . F 6 HOH 138 2138 2138 HOH HOH A . F 6 HOH 139 2139 2139 HOH HOH A . F 6 HOH 140 2140 2140 HOH HOH A . F 6 HOH 141 2141 2141 HOH HOH A . F 6 HOH 142 2142 2142 HOH HOH A . F 6 HOH 143 2143 2143 HOH HOH A . F 6 HOH 144 2144 2144 HOH HOH A . F 6 HOH 145 2145 2145 HOH HOH A . F 6 HOH 146 2146 2146 HOH HOH A . F 6 HOH 147 2147 2147 HOH HOH A . F 6 HOH 148 2148 2148 HOH HOH A . F 6 HOH 149 2149 2149 HOH HOH A . F 6 HOH 150 2150 2150 HOH HOH A . F 6 HOH 151 2151 2151 HOH HOH A . F 6 HOH 152 2152 2152 HOH HOH A . F 6 HOH 153 2153 2153 HOH HOH A . F 6 HOH 154 2154 2154 HOH HOH A . F 6 HOH 155 2155 2155 HOH HOH A . F 6 HOH 156 2156 2156 HOH HOH A . F 6 HOH 157 2157 2157 HOH HOH A . F 6 HOH 158 2158 2158 HOH HOH A . F 6 HOH 159 2159 2159 HOH HOH A . F 6 HOH 160 2160 2160 HOH HOH A . F 6 HOH 161 2161 2161 HOH HOH A . F 6 HOH 162 2162 2162 HOH HOH A . F 6 HOH 163 2163 2163 HOH HOH A . F 6 HOH 164 2164 2164 HOH HOH A . F 6 HOH 165 2165 2165 HOH HOH A . F 6 HOH 166 2166 2166 HOH HOH A . F 6 HOH 167 2167 2167 HOH HOH A . F 6 HOH 168 2168 2168 HOH HOH A . F 6 HOH 169 2169 2169 HOH HOH A . F 6 HOH 170 2170 2170 HOH HOH A . F 6 HOH 171 2171 2171 HOH HOH A . F 6 HOH 172 2172 2172 HOH HOH A . F 6 HOH 173 2173 2173 HOH HOH A . F 6 HOH 174 2174 2174 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2021 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG1 ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 122 ? A ASP 122 ? 1_555 72.6 ? 2 OG1 ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? A ASN 119 ? A ASN 119 ? 1_555 145.0 ? 3 OD1 ? A ASP 122 ? A ASP 122 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? A ASN 119 ? A ASN 119 ? 1_555 73.4 ? 4 OG1 ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? A THR 48 ? A THR 48 ? 1_555 73.1 ? 5 OD1 ? A ASP 122 ? A ASP 122 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? A THR 48 ? A THR 48 ? 1_555 144.9 ? 6 O ? A ASN 119 ? A ASN 119 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? A THR 48 ? A THR 48 ? 1_555 141.5 ? 7 OG1 ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 89.2 ? 8 OD1 ? A ASP 122 ? A ASP 122 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 86.4 ? 9 O ? A ASN 119 ? A ASN 119 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 96.6 ? 10 O ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 85.8 ? 11 OG1 ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? F HOH . ? A HOH 2066 ? 1_555 137.9 ? 12 OD1 ? A ASP 122 ? A ASP 122 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? F HOH . ? A HOH 2066 ? 1_555 142.6 ? 13 O ? A ASN 119 ? A ASN 119 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? F HOH . ? A HOH 2066 ? 1_555 76.5 ? 14 O ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? F HOH . ? A HOH 2066 ? 1_555 66.9 ? 15 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? F HOH . ? A HOH 2066 ? 1_555 75.4 ? 16 OG1 ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 99.6 ? 17 OD1 ? A ASP 122 ? A ASP 122 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 108.9 ? 18 O ? A ASN 119 ? A ASN 119 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 83.9 ? 19 O ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 84.0 ? 20 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 164.0 ? 21 O ? F HOH . ? A HOH 2066 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 89.2 ? 22 OE2 ? A GLU 145 ? A GLU 145 ? 10_664 NI ? D NI . ? A NI 1156 ? 1_555 ND1 ? A HIS 3 ? A HIS 3 ? 1_555 96.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-01-11 2 'Structure model' 1 1 2012-04-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group Other # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -16.9373 27.7094 -5.0219 0.2871 0.1647 0.1602 0.0150 -0.0491 -0.0119 1.8122 0.1382 0.1189 -0.0618 -0.2748 -0.0879 0.1165 0.5236 0.1201 -0.2694 0.0727 0.1776 -0.0271 -0.0598 0.0538 'X-RAY DIFFRACTION' 2 ? refined -14.6590 26.9117 5.5785 0.1935 0.1203 0.1211 -0.0004 -0.0006 -0.0172 0.5578 0.4881 0.1738 -0.3483 0.2226 -0.2180 0.0130 0.0635 -0.0202 -0.0958 0.0873 0.0728 0.1675 0.0761 0.0803 'X-RAY DIFFRACTION' 3 ? refined -14.4059 32.7778 7.7297 0.1210 0.1038 0.1111 0.0175 -0.0017 -0.0090 0.6531 0.9306 0.7712 -0.2463 0.0381 -0.0276 -0.0093 0.0038 -0.0238 -0.0765 0.0227 -0.0467 0.0756 0.1095 0.0005 'X-RAY DIFFRACTION' 4 ? refined -20.2071 36.3885 -3.0785 0.1396 0.1036 0.1298 0.0161 -0.0060 -0.0088 0.2411 0.1289 0.0918 0.0231 0.1233 0.0799 0.1108 -0.0472 0.0824 -0.1030 -0.0742 0.0795 0.0477 0.0381 0.0105 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 1:12)' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 13:37)' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 38:137)' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 138:153)' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(PHENIX.REFINE)' ? 1 MOSFLM 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SHELX phasing 'C D E' ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 2108 ? ? O A HOH 2110 ? ? 1.98 2 1 O A HOH 2061 ? ? O A HOH 2145 ? ? 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -160.28 56.22 2 1 SER A 143 ? ? -111.13 -167.27 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A SER 21 ? N B A SER 21 N 2 1 Y 0 A SER 21 ? CA B A SER 21 CA 3 1 Y 0 A SER 21 ? C B A SER 21 C 4 1 Y 0 A SER 21 ? O B A SER 21 O 5 1 Y 0 A SER 21 ? CB B A SER 21 CB 6 1 Y 0 A SER 21 ? OG B A SER 21 OG # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 1,2-ETHANEDIOL EDO 4 'NICKEL (II) ION' NI 5 'PENTAETHYLENE GLYCOL' 1PE 6 water HOH #