data_4A24
# 
_entry.id   4A24 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.394 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   4A24         pdb_00004a24 10.2210/pdb4a24/pdb 
PDBE  EBI-49655    ?            ?                   
WWPDB D_1290049655 ?            ?                   
BMRB  18004        ?            10.13018/BMR18004   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-11-07 
2 'Structure model' 1 1 2013-02-13 
3 'Structure model' 1 2 2018-01-24 
4 'Structure model' 2 0 2023-06-14 
5 'Structure model' 2 1 2024-06-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Data collection'      
3 4 'Structure model' 'Atomic model'         
4 4 'Structure model' 'Data collection'      
5 4 'Structure model' 'Database references'  
6 4 'Structure model' 'Derived calculations' 
7 4 'Structure model' Other                  
8 5 'Structure model' 'Data collection'      
9 5 'Structure model' 'Database references'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' pdbx_nmr_spectrometer  
2  4 'Structure model' atom_site              
3  4 'Structure model' database_2             
4  4 'Structure model' pdbx_database_status   
5  4 'Structure model' pdbx_nmr_software      
6  4 'Structure model' pdbx_nmr_spectrometer  
7  4 'Structure model' pdbx_struct_conn_angle 
8  4 'Structure model' struct_conn            
9  4 'Structure model' struct_site            
10 5 'Structure model' chem_comp_atom         
11 5 'Structure model' chem_comp_bond         
12 5 'Structure model' database_2             
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_pdbx_nmr_spectrometer.manufacturer'         
2  3 'Structure model' '_pdbx_nmr_spectrometer.model'                
3  4 'Structure model' '_atom_site.Cartn_x'                          
4  4 'Structure model' '_atom_site.Cartn_y'                          
5  4 'Structure model' '_atom_site.Cartn_z'                          
6  4 'Structure model' '_database_2.pdbx_DOI'                        
7  4 'Structure model' '_database_2.pdbx_database_accession'         
8  4 'Structure model' '_pdbx_database_status.status_code_cs'        
9  4 'Structure model' '_pdbx_database_status.status_code_mr'        
10 4 'Structure model' '_pdbx_database_status.status_code_nmr_data'  
11 4 'Structure model' '_pdbx_nmr_software.name'                     
12 4 'Structure model' '_pdbx_nmr_spectrometer.model'                
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
23 4 'Structure model' '_pdbx_struct_conn_angle.value'               
24 4 'Structure model' '_struct_conn.pdbx_dist_value'                
25 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
26 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
27 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
28 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
29 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
30 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
31 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
32 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
33 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
34 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
35 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
36 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
37 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
38 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
39 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
40 5 'Structure model' '_database_2.pdbx_DOI'                        
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4A24 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-09-22 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            REL 
# 
_pdbx_database_related.db_id          18004 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Kateb, F.'      1 ? 
'Perrin, H.'     2 ? 
'Tripsianes, K.' 3 ? 
'Zou, P.'        4 ? 
'Spadaccini, R.' 5 ? 
'Bottomley, M.'  6 ? 
'Bepperling, A.' 7 ? 
'Ansieau, S.'    8 ? 
'Sattler, M.'    9 ? 
# 
_citation.id                        primary 
_citation.title                     'Structural and Functional Analysis of the Deaf-1 and Bs69 Mynd Domains.' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            8 
_citation.page_first                54715 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23372760 
_citation.pdbx_database_id_DOI      10.1371/JOURNAL.PONE.0054715 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kateb, F.'       1  ? 
primary 'Perrin, H.'      2  ? 
primary 'Tripsianes, K.'  3  ? 
primary 'Zou, P.'         4  ? 
primary 'Spadaccini, R.'  5  ? 
primary 'Bottomley, M.'   6  ? 
primary 'Franzmann, T.M.' 7  ? 
primary 'Buchner, J.'     8  ? 
primary 'Ansieau, S.'     9  ? 
primary 'Sattler, M.'     10 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DEFORMED EPIDERMAL AUTOREGULATORY FACTOR 1 HOMOLOG' 5276.947 1 ? ? 'RESIDUES 501-544' ? 
2 non-polymer syn 'ZINC ION'                                           65.409   2 ? ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'DEAF-1 MYND, NUCLEAR DEAF-1-RELATED TRANSCRIPTIONAL REGULATOR SUPPRESSIN, ZINC FINGER MYND DOMAIN-CONTAINING PROTEIN 5' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GAMEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSA 
_entity_poly.pdbx_seq_one_letter_code_can   GAMEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ALA n 
1 3  MET n 
1 4  GLU n 
1 5  GLN n 
1 6  SER n 
1 7  CYS n 
1 8  VAL n 
1 9  ASN n 
1 10 CYS n 
1 11 GLY n 
1 12 ARG n 
1 13 GLU n 
1 14 ALA n 
1 15 MET n 
1 16 SER n 
1 17 GLU n 
1 18 CYS n 
1 19 THR n 
1 20 GLY n 
1 21 CYS n 
1 22 HIS n 
1 23 LYS n 
1 24 VAL n 
1 25 ASN n 
1 26 TYR n 
1 27 CYS n 
1 28 SER n 
1 29 THR n 
1 30 PHE n 
1 31 CYS n 
1 32 GLN n 
1 33 ARG n 
1 34 LYS n 
1 35 ASP n 
1 36 TRP n 
1 37 LYS n 
1 38 ASP n 
1 39 HIS n 
1 40 GLN n 
1 41 HIS n 
1 42 ILE n 
1 43 CYS n 
1 44 GLY n 
1 45 GLN n 
1 46 SER n 
1 47 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               'PETMTHX(MODIFIED FROM PET24D)' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PETMTHX-MYND 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  498 498 GLY GLY A . n 
A 1 2  ALA 2  499 499 ALA ALA A . n 
A 1 3  MET 3  500 500 MET MET A . n 
A 1 4  GLU 4  501 501 GLU GLU A . n 
A 1 5  GLN 5  502 502 GLN GLN A . n 
A 1 6  SER 6  503 503 SER SER A . n 
A 1 7  CYS 7  504 504 CYS CYS A . n 
A 1 8  VAL 8  505 505 VAL VAL A . n 
A 1 9  ASN 9  506 506 ASN ASN A . n 
A 1 10 CYS 10 507 507 CYS CYS A . n 
A 1 11 GLY 11 508 508 GLY GLY A . n 
A 1 12 ARG 12 509 509 ARG ARG A . n 
A 1 13 GLU 13 510 510 GLU GLU A . n 
A 1 14 ALA 14 511 511 ALA ALA A . n 
A 1 15 MET 15 512 512 MET MET A . n 
A 1 16 SER 16 513 513 SER SER A . n 
A 1 17 GLU 17 514 514 GLU GLU A . n 
A 1 18 CYS 18 515 515 CYS CYS A . n 
A 1 19 THR 19 516 516 THR THR A . n 
A 1 20 GLY 20 517 517 GLY GLY A . n 
A 1 21 CYS 21 518 518 CYS CYS A . n 
A 1 22 HIS 22 519 519 HIS HIS A . n 
A 1 23 LYS 23 520 520 LYS LYS A . n 
A 1 24 VAL 24 521 521 VAL VAL A . n 
A 1 25 ASN 25 522 522 ASN ASN A . n 
A 1 26 TYR 26 523 523 TYR TYR A . n 
A 1 27 CYS 27 524 524 CYS CYS A . n 
A 1 28 SER 28 525 525 SER SER A . n 
A 1 29 THR 29 526 526 THR THR A . n 
A 1 30 PHE 30 527 527 PHE PHE A . n 
A 1 31 CYS 31 528 528 CYS CYS A . n 
A 1 32 GLN 32 529 529 GLN GLN A . n 
A 1 33 ARG 33 530 530 ARG ARG A . n 
A 1 34 LYS 34 531 531 LYS LYS A . n 
A 1 35 ASP 35 532 532 ASP ASP A . n 
A 1 36 TRP 36 533 533 TRP TRP A . n 
A 1 37 LYS 37 534 534 LYS LYS A . n 
A 1 38 ASP 38 535 535 ASP ASP A . n 
A 1 39 HIS 39 536 536 HIS HIS A . n 
A 1 40 GLN 40 537 537 GLN GLN A . n 
A 1 41 HIS 41 538 538 HIS HIS A . n 
A 1 42 ILE 42 539 539 ILE ILE A . n 
A 1 43 CYS 43 540 540 CYS CYS A . n 
A 1 44 GLY 44 541 541 GLY GLY A . n 
A 1 45 GLN 45 542 542 GLN GLN A . n 
A 1 46 SER 46 543 543 SER SER A . n 
A 1 47 ALA 47 544 544 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN 1 601 601 ZN ZN A . 
C 2 ZN 1 602 602 ZN ZN A . 
# 
_cell.entry_id           4A24 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4A24 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          4A24 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          4A24 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  4A24 
_struct.title                     'Structural and functional analysis of the DEAF-1 and BS69 MYND domains' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4A24 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'TRANSCRIPTION, ZINC-BINDING, TRANSCRIPTIONAL REGULATION, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DEAF1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          O75398 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4A24 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 47 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O75398 
_struct_ref_seq.db_align_beg                  501 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  544 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       501 
_struct_ref_seq.pdbx_auth_seq_align_end       544 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4A24 GLY A 1 ? UNP O75398 ? ? 'expression tag' 498 1 
1 4A24 ALA A 2 ? UNP O75398 ? ? 'expression tag' 499 2 
1 4A24 MET A 3 ? UNP O75398 ? ? 'expression tag' 500 3 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 28 ? ASP A 35 ? SER A 525 ASP A 532 1 ? 8 
HELX_P HELX_P2 2 ASP A 35 ? CYS A 43 ? ASP A 532 CYS A 540 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 7  SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 504 A ZN 601 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc2 metalc ? ? A CYS 10 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 507 A ZN 601 1_555 ? ? ? ? ? ? ? 2.278 ? ? 
metalc3 metalc ? ? A CYS 18 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 515 A ZN 602 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc4 metalc ? ? A CYS 21 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 518 A ZN 602 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc5 metalc ? ? A CYS 27 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 524 A ZN 601 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc6 metalc ? ? A CYS 31 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 528 A ZN 601 1_555 ? ? ? ? ? ? ? 2.270 ? ? 
metalc7 metalc ? ? A HIS 39 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 536 A ZN 602 1_555 ? ? ? ? ? ? ? 1.973 ? ? 
metalc8 metalc ? ? A CYS 43 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 540 A ZN 602 1_555 ? ? ? ? ? ? ? 2.307 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 7  ? A CYS 504 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG  ? A CYS 10 ? A CYS 507 ? 1_555 111.2 ? 
2  SG  ? A CYS 7  ? A CYS 504 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG  ? A CYS 27 ? A CYS 524 ? 1_555 112.0 ? 
3  SG  ? A CYS 10 ? A CYS 507 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG  ? A CYS 27 ? A CYS 524 ? 1_555 109.9 ? 
4  SG  ? A CYS 7  ? A CYS 504 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG  ? A CYS 31 ? A CYS 528 ? 1_555 109.7 ? 
5  SG  ? A CYS 10 ? A CYS 507 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG  ? A CYS 31 ? A CYS 528 ? 1_555 107.3 ? 
6  SG  ? A CYS 27 ? A CYS 524 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG  ? A CYS 31 ? A CYS 528 ? 1_555 106.6 ? 
7  SG  ? A CYS 18 ? A CYS 515 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 SG  ? A CYS 21 ? A CYS 518 ? 1_555 111.7 ? 
8  SG  ? A CYS 18 ? A CYS 515 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 NE2 ? A HIS 39 ? A HIS 536 ? 1_555 108.2 ? 
9  SG  ? A CYS 21 ? A CYS 518 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 NE2 ? A HIS 39 ? A HIS 536 ? 1_555 107.8 ? 
10 SG  ? A CYS 18 ? A CYS 515 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 SG  ? A CYS 43 ? A CYS 540 ? 1_555 108.1 ? 
11 SG  ? A CYS 21 ? A CYS 518 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 SG  ? A CYS 43 ? A CYS 540 ? 1_555 110.0 ? 
12 NE2 ? A HIS 39 ? A HIS 536 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 SG  ? A CYS 43 ? A CYS 540 ? 1_555 111.1 ? 
# 
_struct_sheet.id               AA 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     AA 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 SER A 16 ? GLU A 17 ? SER A 513 GLU A 514 
AA 2 ASN A 25 ? TYR A 26 ? ASN A 522 TYR A 523 
# 
_pdbx_struct_sheet_hbond.sheet_id                AA 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   SER 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    16 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    SER 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     513 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    26 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     523 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 601 ? 4 'BINDING SITE FOR RESIDUE ZN A 601' 
AC2 Software A ZN 602 ? 4 'BINDING SITE FOR RESIDUE ZN A 602' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 7  ? CYS A 504 . ? 1_555 ? 
2 AC1 4 CYS A 10 ? CYS A 507 . ? 1_555 ? 
3 AC1 4 CYS A 27 ? CYS A 524 . ? 1_555 ? 
4 AC1 4 CYS A 31 ? CYS A 528 . ? 1_555 ? 
5 AC2 4 CYS A 18 ? CYS A 515 . ? 1_555 ? 
6 AC2 4 CYS A 21 ? CYS A 518 . ? 1_555 ? 
7 AC2 4 HIS A 39 ? HIS A 536 . ? 1_555 ? 
8 AC2 4 CYS A 43 ? CYS A 540 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  O   A HIS 536 ? ? H   A CYS 540 ? ? 1.59 
2  3  O   A HIS 536 ? ? H   A CYS 540 ? ? 1.58 
3  4  O   A HIS 536 ? ? H   A CYS 540 ? ? 1.56 
4  5  O   A HIS 536 ? ? H   A CYS 540 ? ? 1.57 
5  5  OE1 A GLU 514 ? ? HD1 A HIS 519 ? ? 1.59 
6  6  O   A HIS 536 ? ? H   A CYS 540 ? ? 1.58 
7  6  H2  A GLY 498 ? ? OE1 A GLU 501 ? ? 1.58 
8  7  O   A HIS 536 ? ? H   A CYS 540 ? ? 1.57 
9  8  O   A HIS 536 ? ? H   A CYS 540 ? ? 1.57 
10 9  O   A HIS 536 ? ? H   A CYS 540 ? ? 1.58 
11 10 O   A HIS 536 ? ? H   A CYS 540 ? ? 1.56 
12 11 O   A HIS 536 ? ? H   A CYS 540 ? ? 1.58 
13 12 O   A HIS 536 ? ? H   A CYS 540 ? ? 1.58 
14 13 O   A HIS 536 ? ? H   A CYS 540 ? ? 1.55 
15 14 O   A HIS 536 ? ? H   A CYS 540 ? ? 1.55 
16 15 O   A HIS 536 ? ? H   A CYS 540 ? ? 1.59 
17 16 O   A HIS 536 ? ? H   A CYS 540 ? ? 1.58 
18 17 H3  A GLY 498 ? ? OE1 A GLU 501 ? ? 1.59 
19 17 O   A HIS 536 ? ? H   A CYS 540 ? ? 1.59 
20 18 O   A HIS 536 ? ? H   A CYS 540 ? ? 1.57 
21 19 O   A HIS 536 ? ? H   A CYS 540 ? ? 1.58 
22 20 O   A HIS 536 ? ? H   A CYS 540 ? ? 1.58 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  MET A 500 ? ? -140.15 -38.80  
2  1  CYS A 507 ? ? -122.47 -87.32  
3  1  ARG A 509 ? ? -53.46  -9.86   
4  1  MET A 512 ? ? -148.26 -24.40  
5  1  GLN A 542 ? ? -73.88  -79.73  
6  1  SER A 543 ? ? 89.78   60.81   
7  2  ALA A 499 ? ? -141.76 28.13   
8  2  CYS A 507 ? ? -121.29 -73.60  
9  2  ARG A 509 ? ? -52.57  -9.24   
10 2  ALA A 511 ? ? -46.05  153.19  
11 2  MET A 512 ? ? -168.11 -29.09  
12 3  ALA A 499 ? ? 66.70   138.63  
13 3  CYS A 507 ? ? -123.53 -75.10  
14 3  ARG A 509 ? ? -54.59  -7.69   
15 3  GLU A 510 ? ? -58.65  -0.93   
16 3  ALA A 511 ? ? -46.54  152.56  
17 3  MET A 512 ? ? -160.03 -28.23  
18 4  CYS A 507 ? ? -122.44 -83.31  
19 4  ARG A 509 ? ? -52.23  -8.14   
20 4  MET A 512 ? ? -163.29 -24.49  
21 5  CYS A 507 ? ? -122.23 -82.49  
22 5  ARG A 509 ? ? -55.22  -8.44   
23 6  ALA A 499 ? ? -108.63 -64.25  
24 6  MET A 500 ? ? -148.69 33.55   
25 6  CYS A 507 ? ? -121.56 -83.85  
26 7  ALA A 499 ? ? -164.67 -78.87  
27 7  CYS A 507 ? ? -120.70 -70.84  
28 7  ARG A 509 ? ? -50.20  -7.87   
29 7  MET A 512 ? ? -166.90 -27.49  
30 8  CYS A 507 ? ? -127.12 -75.08  
31 8  ARG A 509 ? ? -53.80  -9.97   
32 8  GLU A 510 ? ? -61.87  0.62    
33 8  ALA A 511 ? ? -46.49  163.79  
34 8  MET A 512 ? ? -178.44 -28.21  
35 8  TYR A 523 ? ? -126.20 -169.14 
36 9  ALA A 499 ? ? -157.84 -9.04   
37 9  MET A 500 ? ? -157.38 -25.07  
38 9  CYS A 507 ? ? -128.99 -86.06  
39 10 ALA A 499 ? ? 65.76   -174.26 
40 10 CYS A 507 ? ? -120.53 -82.29  
41 10 GLU A 510 ? ? -66.36  3.94    
42 10 MET A 512 ? ? -173.45 -29.67  
43 10 SER A 543 ? ? -60.59  98.37   
44 11 MET A 500 ? ? -150.97 -11.98  
45 11 MET A 512 ? ? -153.92 -27.86  
46 11 GLN A 542 ? ? 66.58   -79.97  
47 12 MET A 500 ? ? -151.45 18.75   
48 12 CYS A 507 ? ? -122.69 -86.35  
49 13 CYS A 507 ? ? -122.03 -83.92  
50 13 ARG A 509 ? ? -53.48  -7.81   
51 13 MET A 512 ? ? -165.65 -20.88  
52 13 GLN A 542 ? ? -81.15  -82.29  
53 14 MET A 500 ? ? 68.15   -14.22  
54 14 CYS A 507 ? ? -122.44 -82.94  
55 14 ARG A 509 ? ? -54.69  -8.24   
56 14 MET A 512 ? ? -143.49 -28.42  
57 15 CYS A 507 ? ? -122.78 -82.92  
58 15 ARG A 509 ? ? -53.05  -8.70   
59 15 MET A 512 ? ? -162.18 -28.55  
60 15 GLN A 542 ? ? 63.89   -149.79 
61 16 MET A 500 ? ? -148.38 11.07   
62 16 CYS A 507 ? ? -122.94 -80.89  
63 16 MET A 512 ? ? -149.38 -27.66  
64 17 ALA A 499 ? ? -149.83 -73.12  
65 17 CYS A 507 ? ? -121.96 -81.92  
66 17 ARG A 509 ? ? -56.00  -8.15   
67 17 GLU A 510 ? ? -68.26  0.58    
68 17 ALA A 511 ? ? -46.87  155.19  
69 17 MET A 512 ? ? -159.05 -24.54  
70 18 MET A 500 ? ? -174.60 -38.45  
71 18 CYS A 507 ? ? -121.82 -84.99  
72 18 ARG A 509 ? ? -52.51  -9.48   
73 18 MET A 512 ? ? -145.52 -28.60  
74 19 CYS A 507 ? ? -122.58 -76.25  
75 19 MET A 512 ? ? -147.11 -23.52  
76 20 MET A 500 ? ? -158.19 20.76   
77 20 CYS A 507 ? ? -121.79 -80.97  
# 
_pdbx_entry_details.entry_id                 4A24 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         
;THE FIRST THREE RESIDUES, GAM, RESULT FROM THE TEV
CLEAVAGE SITE TO REMOVE THE N-TERMINAL TAG
;
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_nmr_ensemble.entry_id                             4A24 
_pdbx_nmr_ensemble.conformers_calculated_total_number   100 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         'LOWEST ENERGY' 
# 
_pdbx_nmr_representative.entry_id             4A24 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '90% WATER/10% D2O' 
_pdbx_nmr_sample_details.solvent_system   ? 
_pdbx_nmr_sample_details.label            ? 
_pdbx_nmr_sample_details.type             ? 
_pdbx_nmr_sample_details.details          ? 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units 
_pdbx_nmr_exptl_sample_conditions.pH_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
_pdbx_nmr_exptl_sample_conditions.label 
1 295.0 atm 1.0 6.5 100 mM pH K ? 
2 295.0 atm 1.0 6.5 100 mM pH K ? 
3 295.0 atm 1.0 6.5 100 mM pH K ? 
4 295.0 atm 1.0 6.5 100 mM pH K ? 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 '2D 1H-1H NOESY'                      1 
2 2 '3D 1H-15N NOESY'                     1 
3 3 '3D 1H-13C NOESY (ALIPHATIC CARBONS)' 1 
4 4 '3D 1H- 13C NOESY (AROMATIC CARBONS)' 1 
# 
_pdbx_nmr_details.entry_id   4A24 
_pdbx_nmr_details.text       
;THE CHEMICAL SHIFTS OF THE DEAF-1 MYND DOMAIN WERE ASSIGNED USING STANDARD HETERONUCLEAR EXPERIMENTS ACQUIRED AT 295 K ON A 1 MM UNIFORMLY 15N,13C LABELED SAMPLE. EXPERIMENTS WERE CARRIED OUT ON BRUKER SPECTROMETERS OPERATING AT A PROTON FREQUENCY BETWEEN 500 AND 900 MHZ. ALL SPECTRA WERE PROCESSED USING THE PACKAGE NMRPIPE- NMRDRAW
;
# 
_pdbx_nmr_refine.entry_id           4A24 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;DISTANCE RESTRAINTS DERIVED FROM THE CYANA CALCULATIONS, TORSION ANGLE RESTRAINTS DERIVED FROM TALOS BASED ON SECONDARY CHEMICAL SHIFTS, AND RDC RESTRAINTS WERE APPLIED FOR A WATER REFINEMENT CALCULATION USING A SIMULATED ANNEALING PROTOCOL IN CNS. THE ZINC COORDINATION GEOMETRY WAS DEFINED AND MAINTAINED BY DISTANCE AND ANGLE CONSTRAINTS. .
;
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CNS-ARIA ? NILGES 1 
'structure solution' NMRPipe  ? ?      2 
'structure solution' TALOS    ? ?      3 
'structure solution' Sparky   ? ?      4 
'structure solution' CYANA    ? ?      5 
'structure solution' ARIA-CNS ? ?      6 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
HIS N    N  N N 137 
HIS CA   C  N S 138 
HIS C    C  N N 139 
HIS O    O  N N 140 
HIS CB   C  N N 141 
HIS CG   C  Y N 142 
HIS ND1  N  Y N 143 
HIS CD2  C  Y N 144 
HIS CE1  C  Y N 145 
HIS NE2  N  Y N 146 
HIS OXT  O  N N 147 
HIS H    H  N N 148 
HIS H2   H  N N 149 
HIS HA   H  N N 150 
HIS HB2  H  N N 151 
HIS HB3  H  N N 152 
HIS HD1  H  N N 153 
HIS HD2  H  N N 154 
HIS HE1  H  N N 155 
HIS HE2  H  N N 156 
HIS HXT  H  N N 157 
ILE N    N  N N 158 
ILE CA   C  N S 159 
ILE C    C  N N 160 
ILE O    O  N N 161 
ILE CB   C  N S 162 
ILE CG1  C  N N 163 
ILE CG2  C  N N 164 
ILE CD1  C  N N 165 
ILE OXT  O  N N 166 
ILE H    H  N N 167 
ILE H2   H  N N 168 
ILE HA   H  N N 169 
ILE HB   H  N N 170 
ILE HG12 H  N N 171 
ILE HG13 H  N N 172 
ILE HG21 H  N N 173 
ILE HG22 H  N N 174 
ILE HG23 H  N N 175 
ILE HD11 H  N N 176 
ILE HD12 H  N N 177 
ILE HD13 H  N N 178 
ILE HXT  H  N N 179 
LYS N    N  N N 180 
LYS CA   C  N S 181 
LYS C    C  N N 182 
LYS O    O  N N 183 
LYS CB   C  N N 184 
LYS CG   C  N N 185 
LYS CD   C  N N 186 
LYS CE   C  N N 187 
LYS NZ   N  N N 188 
LYS OXT  O  N N 189 
LYS H    H  N N 190 
LYS H2   H  N N 191 
LYS HA   H  N N 192 
LYS HB2  H  N N 193 
LYS HB3  H  N N 194 
LYS HG2  H  N N 195 
LYS HG3  H  N N 196 
LYS HD2  H  N N 197 
LYS HD3  H  N N 198 
LYS HE2  H  N N 199 
LYS HE3  H  N N 200 
LYS HZ1  H  N N 201 
LYS HZ2  H  N N 202 
LYS HZ3  H  N N 203 
LYS HXT  H  N N 204 
MET N    N  N N 205 
MET CA   C  N S 206 
MET C    C  N N 207 
MET O    O  N N 208 
MET CB   C  N N 209 
MET CG   C  N N 210 
MET SD   S  N N 211 
MET CE   C  N N 212 
MET OXT  O  N N 213 
MET H    H  N N 214 
MET H2   H  N N 215 
MET HA   H  N N 216 
MET HB2  H  N N 217 
MET HB3  H  N N 218 
MET HG2  H  N N 219 
MET HG3  H  N N 220 
MET HE1  H  N N 221 
MET HE2  H  N N 222 
MET HE3  H  N N 223 
MET HXT  H  N N 224 
PHE N    N  N N 225 
PHE CA   C  N S 226 
PHE C    C  N N 227 
PHE O    O  N N 228 
PHE CB   C  N N 229 
PHE CG   C  Y N 230 
PHE CD1  C  Y N 231 
PHE CD2  C  Y N 232 
PHE CE1  C  Y N 233 
PHE CE2  C  Y N 234 
PHE CZ   C  Y N 235 
PHE OXT  O  N N 236 
PHE H    H  N N 237 
PHE H2   H  N N 238 
PHE HA   H  N N 239 
PHE HB2  H  N N 240 
PHE HB3  H  N N 241 
PHE HD1  H  N N 242 
PHE HD2  H  N N 243 
PHE HE1  H  N N 244 
PHE HE2  H  N N 245 
PHE HZ   H  N N 246 
PHE HXT  H  N N 247 
SER N    N  N N 248 
SER CA   C  N S 249 
SER C    C  N N 250 
SER O    O  N N 251 
SER CB   C  N N 252 
SER OG   O  N N 253 
SER OXT  O  N N 254 
SER H    H  N N 255 
SER H2   H  N N 256 
SER HA   H  N N 257 
SER HB2  H  N N 258 
SER HB3  H  N N 259 
SER HG   H  N N 260 
SER HXT  H  N N 261 
THR N    N  N N 262 
THR CA   C  N S 263 
THR C    C  N N 264 
THR O    O  N N 265 
THR CB   C  N R 266 
THR OG1  O  N N 267 
THR CG2  C  N N 268 
THR OXT  O  N N 269 
THR H    H  N N 270 
THR H2   H  N N 271 
THR HA   H  N N 272 
THR HB   H  N N 273 
THR HG1  H  N N 274 
THR HG21 H  N N 275 
THR HG22 H  N N 276 
THR HG23 H  N N 277 
THR HXT  H  N N 278 
TRP N    N  N N 279 
TRP CA   C  N S 280 
TRP C    C  N N 281 
TRP O    O  N N 282 
TRP CB   C  N N 283 
TRP CG   C  Y N 284 
TRP CD1  C  Y N 285 
TRP CD2  C  Y N 286 
TRP NE1  N  Y N 287 
TRP CE2  C  Y N 288 
TRP CE3  C  Y N 289 
TRP CZ2  C  Y N 290 
TRP CZ3  C  Y N 291 
TRP CH2  C  Y N 292 
TRP OXT  O  N N 293 
TRP H    H  N N 294 
TRP H2   H  N N 295 
TRP HA   H  N N 296 
TRP HB2  H  N N 297 
TRP HB3  H  N N 298 
TRP HD1  H  N N 299 
TRP HE1  H  N N 300 
TRP HE3  H  N N 301 
TRP HZ2  H  N N 302 
TRP HZ3  H  N N 303 
TRP HH2  H  N N 304 
TRP HXT  H  N N 305 
TYR N    N  N N 306 
TYR CA   C  N S 307 
TYR C    C  N N 308 
TYR O    O  N N 309 
TYR CB   C  N N 310 
TYR CG   C  Y N 311 
TYR CD1  C  Y N 312 
TYR CD2  C  Y N 313 
TYR CE1  C  Y N 314 
TYR CE2  C  Y N 315 
TYR CZ   C  Y N 316 
TYR OH   O  N N 317 
TYR OXT  O  N N 318 
TYR H    H  N N 319 
TYR H2   H  N N 320 
TYR HA   H  N N 321 
TYR HB2  H  N N 322 
TYR HB3  H  N N 323 
TYR HD1  H  N N 324 
TYR HD2  H  N N 325 
TYR HE1  H  N N 326 
TYR HE2  H  N N 327 
TYR HH   H  N N 328 
TYR HXT  H  N N 329 
VAL N    N  N N 330 
VAL CA   C  N S 331 
VAL C    C  N N 332 
VAL O    O  N N 333 
VAL CB   C  N N 334 
VAL CG1  C  N N 335 
VAL CG2  C  N N 336 
VAL OXT  O  N N 337 
VAL H    H  N N 338 
VAL H2   H  N N 339 
VAL HA   H  N N 340 
VAL HB   H  N N 341 
VAL HG11 H  N N 342 
VAL HG12 H  N N 343 
VAL HG13 H  N N 344 
VAL HG21 H  N N 345 
VAL HG22 H  N N 346 
VAL HG23 H  N N 347 
VAL HXT  H  N N 348 
ZN  ZN   ZN N N 349 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LYS N   CA   sing N N 171 
LYS N   H    sing N N 172 
LYS N   H2   sing N N 173 
LYS CA  C    sing N N 174 
LYS CA  CB   sing N N 175 
LYS CA  HA   sing N N 176 
LYS C   O    doub N N 177 
LYS C   OXT  sing N N 178 
LYS CB  CG   sing N N 179 
LYS CB  HB2  sing N N 180 
LYS CB  HB3  sing N N 181 
LYS CG  CD   sing N N 182 
LYS CG  HG2  sing N N 183 
LYS CG  HG3  sing N N 184 
LYS CD  CE   sing N N 185 
LYS CD  HD2  sing N N 186 
LYS CD  HD3  sing N N 187 
LYS CE  NZ   sing N N 188 
LYS CE  HE2  sing N N 189 
LYS CE  HE3  sing N N 190 
LYS NZ  HZ1  sing N N 191 
LYS NZ  HZ2  sing N N 192 
LYS NZ  HZ3  sing N N 193 
LYS OXT HXT  sing N N 194 
MET N   CA   sing N N 195 
MET N   H    sing N N 196 
MET N   H2   sing N N 197 
MET CA  C    sing N N 198 
MET CA  CB   sing N N 199 
MET CA  HA   sing N N 200 
MET C   O    doub N N 201 
MET C   OXT  sing N N 202 
MET CB  CG   sing N N 203 
MET CB  HB2  sing N N 204 
MET CB  HB3  sing N N 205 
MET CG  SD   sing N N 206 
MET CG  HG2  sing N N 207 
MET CG  HG3  sing N N 208 
MET SD  CE   sing N N 209 
MET CE  HE1  sing N N 210 
MET CE  HE2  sing N N 211 
MET CE  HE3  sing N N 212 
MET OXT HXT  sing N N 213 
PHE N   CA   sing N N 214 
PHE N   H    sing N N 215 
PHE N   H2   sing N N 216 
PHE CA  C    sing N N 217 
PHE CA  CB   sing N N 218 
PHE CA  HA   sing N N 219 
PHE C   O    doub N N 220 
PHE C   OXT  sing N N 221 
PHE CB  CG   sing N N 222 
PHE CB  HB2  sing N N 223 
PHE CB  HB3  sing N N 224 
PHE CG  CD1  doub Y N 225 
PHE CG  CD2  sing Y N 226 
PHE CD1 CE1  sing Y N 227 
PHE CD1 HD1  sing N N 228 
PHE CD2 CE2  doub Y N 229 
PHE CD2 HD2  sing N N 230 
PHE CE1 CZ   doub Y N 231 
PHE CE1 HE1  sing N N 232 
PHE CE2 CZ   sing Y N 233 
PHE CE2 HE2  sing N N 234 
PHE CZ  HZ   sing N N 235 
PHE OXT HXT  sing N N 236 
SER N   CA   sing N N 237 
SER N   H    sing N N 238 
SER N   H2   sing N N 239 
SER CA  C    sing N N 240 
SER CA  CB   sing N N 241 
SER CA  HA   sing N N 242 
SER C   O    doub N N 243 
SER C   OXT  sing N N 244 
SER CB  OG   sing N N 245 
SER CB  HB2  sing N N 246 
SER CB  HB3  sing N N 247 
SER OG  HG   sing N N 248 
SER OXT HXT  sing N N 249 
THR N   CA   sing N N 250 
THR N   H    sing N N 251 
THR N   H2   sing N N 252 
THR CA  C    sing N N 253 
THR CA  CB   sing N N 254 
THR CA  HA   sing N N 255 
THR C   O    doub N N 256 
THR C   OXT  sing N N 257 
THR CB  OG1  sing N N 258 
THR CB  CG2  sing N N 259 
THR CB  HB   sing N N 260 
THR OG1 HG1  sing N N 261 
THR CG2 HG21 sing N N 262 
THR CG2 HG22 sing N N 263 
THR CG2 HG23 sing N N 264 
THR OXT HXT  sing N N 265 
TRP N   CA   sing N N 266 
TRP N   H    sing N N 267 
TRP N   H2   sing N N 268 
TRP CA  C    sing N N 269 
TRP CA  CB   sing N N 270 
TRP CA  HA   sing N N 271 
TRP C   O    doub N N 272 
TRP C   OXT  sing N N 273 
TRP CB  CG   sing N N 274 
TRP CB  HB2  sing N N 275 
TRP CB  HB3  sing N N 276 
TRP CG  CD1  doub Y N 277 
TRP CG  CD2  sing Y N 278 
TRP CD1 NE1  sing Y N 279 
TRP CD1 HD1  sing N N 280 
TRP CD2 CE2  doub Y N 281 
TRP CD2 CE3  sing Y N 282 
TRP NE1 CE2  sing Y N 283 
TRP NE1 HE1  sing N N 284 
TRP CE2 CZ2  sing Y N 285 
TRP CE3 CZ3  doub Y N 286 
TRP CE3 HE3  sing N N 287 
TRP CZ2 CH2  doub Y N 288 
TRP CZ2 HZ2  sing N N 289 
TRP CZ3 CH2  sing Y N 290 
TRP CZ3 HZ3  sing N N 291 
TRP CH2 HH2  sing N N 292 
TRP OXT HXT  sing N N 293 
TYR N   CA   sing N N 294 
TYR N   H    sing N N 295 
TYR N   H2   sing N N 296 
TYR CA  C    sing N N 297 
TYR CA  CB   sing N N 298 
TYR CA  HA   sing N N 299 
TYR C   O    doub N N 300 
TYR C   OXT  sing N N 301 
TYR CB  CG   sing N N 302 
TYR CB  HB2  sing N N 303 
TYR CB  HB3  sing N N 304 
TYR CG  CD1  doub Y N 305 
TYR CG  CD2  sing Y N 306 
TYR CD1 CE1  sing Y N 307 
TYR CD1 HD1  sing N N 308 
TYR CD2 CE2  doub Y N 309 
TYR CD2 HD2  sing N N 310 
TYR CE1 CZ   doub Y N 311 
TYR CE1 HE1  sing N N 312 
TYR CE2 CZ   sing Y N 313 
TYR CE2 HE2  sing N N 314 
TYR CZ  OH   sing N N 315 
TYR OH  HH   sing N N 316 
TYR OXT HXT  sing N N 317 
VAL N   CA   sing N N 318 
VAL N   H    sing N N 319 
VAL N   H2   sing N N 320 
VAL CA  C    sing N N 321 
VAL CA  CB   sing N N 322 
VAL CA  HA   sing N N 323 
VAL C   O    doub N N 324 
VAL C   OXT  sing N N 325 
VAL CB  CG1  sing N N 326 
VAL CB  CG2  sing N N 327 
VAL CB  HB   sing N N 328 
VAL CG1 HG11 sing N N 329 
VAL CG1 HG12 sing N N 330 
VAL CG1 HG13 sing N N 331 
VAL CG2 HG21 sing N N 332 
VAL CG2 HG22 sing N N 333 
VAL CG2 HG23 sing N N 334 
VAL OXT HXT  sing N N 335 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 AVANCE Bruker 600 ? 
2 AVANCE Bruker 900 ? 
3 AVANCE Bruker 900 ? 
4 AVANCE Bruker 900 ? 
# 
_atom_sites.entry_id                    4A24 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_