data_4A53 # _entry.id 4A53 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4A53 pdb_00004a53 10.2210/pdb4a53/pdb PDBE EBI-50001 ? ? WWPDB D_1290050001 ? ? BMRB 18041 ? 10.13018/BMR18041 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-02-01 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_cs' 4 2 'Structure model' '_pdbx_database_status.status_code_mr' 5 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 6 2 'Structure model' '_pdbx_nmr_software.name' 7 2 'Structure model' '_pdbx_nmr_spectrometer.model' 8 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4A53 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2011-10-24 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 4A54 unspecified 'STRUCTURAL BASIS OF THE DCP1:DCP2 MRNA DECAPPING COMPLEX ACTIVATION BY EDC3 AND SCD6' BMRB 18041 unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fromm, S.A.' 1 'Truffault, V.' 2 'Kamenz, J.' 3 'Braun, J.E.' 4 'Hoffmann, N.A.' 5 'Izaurralde, E.' 6 'Sprangers, R.' 7 # _citation.id primary _citation.title 'The Structural Basis of Edc3- and Scd6-Mediated Activation of the Dcp1:Dcp2 Mrna Decapping Complex.' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 31 _citation.page_first 279 _citation.page_last ? _citation.year 2011 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22085934 _citation.pdbx_database_id_DOI 10.1038/EMBOJ.2011.408 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fromm, S.A.' 1 ? primary 'Truffault, V.' 2 ? primary 'Kamenz, J.' 3 ? primary 'Braun, J.E.' 4 ? primary 'Hoffmann, N.A.' 5 ? primary 'Izaurralde, E.' 6 ? primary 'Sprangers, R.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description EDC3 _entity.formula_weight 14016.722 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'LSM, RESIDUES 1-121' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'UNCHARACTERIZED PROTEIN C18E5.11C' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMGMSVADFYGSNVEVLLNNDSKARGVITNFDSSNSILQLRLANDSTKSIVTKDIKDLRILPKNEIMPKNGTKSPSTNS TKLKSAETYSSKNKWSMDCDEEFDFAANLEKFDKKQVFAEFREKD ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGMSVADFYGSNVEVLLNNDSKARGVITNFDSSNSILQLRLANDSTKSIVTKDIKDLRILPKNEIMPKNGTKSPSTNS TKLKSAETYSSKNKWSMDCDEEFDFAANLEKFDKKQVFAEFREKD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 MET n 1 6 SER n 1 7 VAL n 1 8 ALA n 1 9 ASP n 1 10 PHE n 1 11 TYR n 1 12 GLY n 1 13 SER n 1 14 ASN n 1 15 VAL n 1 16 GLU n 1 17 VAL n 1 18 LEU n 1 19 LEU n 1 20 ASN n 1 21 ASN n 1 22 ASP n 1 23 SER n 1 24 LYS n 1 25 ALA n 1 26 ARG n 1 27 GLY n 1 28 VAL n 1 29 ILE n 1 30 THR n 1 31 ASN n 1 32 PHE n 1 33 ASP n 1 34 SER n 1 35 SER n 1 36 ASN n 1 37 SER n 1 38 ILE n 1 39 LEU n 1 40 GLN n 1 41 LEU n 1 42 ARG n 1 43 LEU n 1 44 ALA n 1 45 ASN n 1 46 ASP n 1 47 SER n 1 48 THR n 1 49 LYS n 1 50 SER n 1 51 ILE n 1 52 VAL n 1 53 THR n 1 54 LYS n 1 55 ASP n 1 56 ILE n 1 57 LYS n 1 58 ASP n 1 59 LEU n 1 60 ARG n 1 61 ILE n 1 62 LEU n 1 63 PRO n 1 64 LYS n 1 65 ASN n 1 66 GLU n 1 67 ILE n 1 68 MET n 1 69 PRO n 1 70 LYS n 1 71 ASN n 1 72 GLY n 1 73 THR n 1 74 LYS n 1 75 SER n 1 76 PRO n 1 77 SER n 1 78 THR n 1 79 ASN n 1 80 SER n 1 81 THR n 1 82 LYS n 1 83 LEU n 1 84 LYS n 1 85 SER n 1 86 ALA n 1 87 GLU n 1 88 THR n 1 89 TYR n 1 90 SER n 1 91 SER n 1 92 LYS n 1 93 ASN n 1 94 LYS n 1 95 TRP n 1 96 SER n 1 97 MET n 1 98 ASP n 1 99 CYS n 1 100 ASP n 1 101 GLU n 1 102 GLU n 1 103 PHE n 1 104 ASP n 1 105 PHE n 1 106 ALA n 1 107 ALA n 1 108 ASN n 1 109 LEU n 1 110 GLU n 1 111 LYS n 1 112 PHE n 1 113 ASP n 1 114 LYS n 1 115 LYS n 1 116 GLN n 1 117 VAL n 1 118 PHE n 1 119 ALA n 1 120 GLU n 1 121 PHE n 1 122 ARG n 1 123 GLU n 1 124 LYS n 1 125 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'FISSION YEAST' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'SCHIZOSACCHAROMYCES POMBE' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4896 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PET _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 -3 GLY GLY A . n A 1 2 ALA 2 -2 -2 ALA ALA A . n A 1 3 MET 3 -1 -1 MET MET A . n A 1 4 GLY 4 0 0 GLY GLY A . n A 1 5 MET 5 1 1 MET MET A . n A 1 6 SER 6 2 2 SER SER A . n A 1 7 VAL 7 3 3 VAL VAL A . n A 1 8 ALA 8 4 4 ALA ALA A . n A 1 9 ASP 9 5 5 ASP ASP A . n A 1 10 PHE 10 6 6 PHE PHE A . n A 1 11 TYR 11 7 7 TYR TYR A . n A 1 12 GLY 12 8 8 GLY GLY A . n A 1 13 SER 13 9 9 SER SER A . n A 1 14 ASN 14 10 10 ASN ASN A . n A 1 15 VAL 15 11 11 VAL VAL A . n A 1 16 GLU 16 12 12 GLU GLU A . n A 1 17 VAL 17 13 13 VAL VAL A . n A 1 18 LEU 18 14 14 LEU LEU A . n A 1 19 LEU 19 15 15 LEU LEU A . n A 1 20 ASN 20 16 16 ASN ASN A . n A 1 21 ASN 21 17 17 ASN ASN A . n A 1 22 ASP 22 18 18 ASP ASP A . n A 1 23 SER 23 19 19 SER SER A . n A 1 24 LYS 24 20 20 LYS LYS A . n A 1 25 ALA 25 21 21 ALA ALA A . n A 1 26 ARG 26 22 22 ARG ARG A . n A 1 27 GLY 27 23 23 GLY GLY A . n A 1 28 VAL 28 24 24 VAL VAL A . n A 1 29 ILE 29 25 25 ILE ILE A . n A 1 30 THR 30 26 26 THR THR A . n A 1 31 ASN 31 27 27 ASN ASN A . n A 1 32 PHE 32 28 28 PHE PHE A . n A 1 33 ASP 33 29 29 ASP ASP A . n A 1 34 SER 34 30 30 SER SER A . n A 1 35 SER 35 31 31 SER SER A . n A 1 36 ASN 36 32 32 ASN ASN A . n A 1 37 SER 37 33 33 SER SER A . n A 1 38 ILE 38 34 34 ILE ILE A . n A 1 39 LEU 39 35 35 LEU LEU A . n A 1 40 GLN 40 36 36 GLN GLN A . n A 1 41 LEU 41 37 37 LEU LEU A . n A 1 42 ARG 42 38 38 ARG ARG A . n A 1 43 LEU 43 39 39 LEU LEU A . n A 1 44 ALA 44 40 40 ALA ALA A . n A 1 45 ASN 45 41 41 ASN ASN A . n A 1 46 ASP 46 42 42 ASP ASP A . n A 1 47 SER 47 43 43 SER SER A . n A 1 48 THR 48 44 44 THR THR A . n A 1 49 LYS 49 45 45 LYS LYS A . n A 1 50 SER 50 46 46 SER SER A . n A 1 51 ILE 51 47 47 ILE ILE A . n A 1 52 VAL 52 48 48 VAL VAL A . n A 1 53 THR 53 49 49 THR THR A . n A 1 54 LYS 54 50 50 LYS LYS A . n A 1 55 ASP 55 51 51 ASP ASP A . n A 1 56 ILE 56 52 52 ILE ILE A . n A 1 57 LYS 57 53 53 LYS LYS A . n A 1 58 ASP 58 54 54 ASP ASP A . n A 1 59 LEU 59 55 55 LEU LEU A . n A 1 60 ARG 60 56 56 ARG ARG A . n A 1 61 ILE 61 57 57 ILE ILE A . n A 1 62 LEU 62 58 58 LEU LEU A . n A 1 63 PRO 63 59 59 PRO PRO A . n A 1 64 LYS 64 60 60 LYS LYS A . n A 1 65 ASN 65 61 61 ASN ASN A . n A 1 66 GLU 66 62 62 GLU GLU A . n A 1 67 ILE 67 63 63 ILE ILE A . n A 1 68 MET 68 64 64 MET MET A . n A 1 69 PRO 69 65 65 PRO PRO A . n A 1 70 LYS 70 66 66 LYS LYS A . n A 1 71 ASN 71 67 67 ASN ASN A . n A 1 72 GLY 72 68 68 GLY GLY A . n A 1 73 THR 73 69 69 THR THR A . n A 1 74 LYS 74 70 70 LYS LYS A . n A 1 75 SER 75 71 71 SER SER A . n A 1 76 PRO 76 72 72 PRO PRO A . n A 1 77 SER 77 73 73 SER SER A . n A 1 78 THR 78 74 74 THR THR A . n A 1 79 ASN 79 75 75 ASN ASN A . n A 1 80 SER 80 76 76 SER SER A . n A 1 81 THR 81 77 77 THR THR A . n A 1 82 LYS 82 78 78 LYS LYS A . n A 1 83 LEU 83 79 79 LEU LEU A . n A 1 84 LYS 84 80 80 LYS LYS A . n A 1 85 SER 85 81 81 SER SER A . n A 1 86 ALA 86 82 82 ALA ALA A . n A 1 87 GLU 87 83 83 GLU GLU A . n A 1 88 THR 88 84 84 THR THR A . n A 1 89 TYR 89 85 85 TYR TYR A . n A 1 90 SER 90 86 86 SER SER A . n A 1 91 SER 91 87 87 SER SER A . n A 1 92 LYS 92 88 88 LYS LYS A . n A 1 93 ASN 93 89 89 ASN ASN A . n A 1 94 LYS 94 90 90 LYS LYS A . n A 1 95 TRP 95 91 91 TRP TRP A . n A 1 96 SER 96 92 92 SER SER A . n A 1 97 MET 97 93 93 MET MET A . n A 1 98 ASP 98 94 94 ASP ASP A . n A 1 99 CYS 99 95 95 CYS CYS A . n A 1 100 ASP 100 96 96 ASP ASP A . n A 1 101 GLU 101 97 97 GLU GLU A . n A 1 102 GLU 102 98 98 GLU GLU A . n A 1 103 PHE 103 99 99 PHE PHE A . n A 1 104 ASP 104 100 100 ASP ASP A . n A 1 105 PHE 105 101 101 PHE PHE A . n A 1 106 ALA 106 102 102 ALA ALA A . n A 1 107 ALA 107 103 103 ALA ALA A . n A 1 108 ASN 108 104 104 ASN ASN A . n A 1 109 LEU 109 105 105 LEU LEU A . n A 1 110 GLU 110 106 106 GLU GLU A . n A 1 111 LYS 111 107 107 LYS LYS A . n A 1 112 PHE 112 108 108 PHE PHE A . n A 1 113 ASP 113 109 109 ASP ASP A . n A 1 114 LYS 114 110 110 LYS LYS A . n A 1 115 LYS 115 111 111 LYS LYS A . n A 1 116 GLN 116 112 112 GLN GLN A . n A 1 117 VAL 117 113 113 VAL VAL A . n A 1 118 PHE 118 114 114 PHE PHE A . n A 1 119 ALA 119 115 115 ALA ALA A . n A 1 120 GLU 120 116 116 GLU GLU A . n A 1 121 PHE 121 117 117 PHE PHE A . n A 1 122 ARG 122 118 118 ARG ARG A . n A 1 123 GLU 123 119 119 GLU GLU A . n A 1 124 LYS 124 120 120 LYS LYS A . n A 1 125 ASP 125 121 121 ASP ASP A . n # _cell.entry_id 4A53 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4A53 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 4A53 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 4A53 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 4A53 _struct.title 'Structural basis of the Dcp1:Dcp2 mRNA decapping complex activation by Edc3 and Scd6' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4A53 _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YBSB_SCHPO _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession O94752 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4A53 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O94752 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 121 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4A53 GLY A 1 ? UNP O94752 ? ? 'expression tag' -3 1 1 4A53 ALA A 2 ? UNP O94752 ? ? 'expression tag' -2 2 1 4A53 MET A 3 ? UNP O94752 ? ? 'expression tag' -1 3 1 4A53 GLY A 4 ? UNP O94752 ? ? 'expression tag' 0 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 6 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 11 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 2 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 7 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 SER A 47 ? VAL A 52 ? SER A 43 VAL A 48 AA 2 ILE A 38 ? LEU A 43 ? ILE A 34 LEU A 39 AA 3 LYS A 24 ? ASP A 33 ? LYS A 20 ASP A 29 AA 4 ASN A 14 ? LEU A 19 ? ASN A 10 LEU A 15 AA 5 ILE A 56 ? ILE A 61 ? ILE A 52 ILE A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 51 ? N ILE A 47 O LEU A 39 ? O LEU A 35 AA 2 3 N ARG A 42 ? N ARG A 38 O VAL A 28 ? O VAL A 24 AA 3 4 N GLY A 27 ? N GLY A 23 O VAL A 15 ? O VAL A 11 AA 4 5 O LEU A 18 ? O LEU A 14 N LYS A 57 ? N LYS A 53 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 5 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 PHE _pdbx_validate_close_contact.auth_seq_id_1 6 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 9 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 84 ? ? -152.63 -46.65 2 1 SER A 87 ? ? 48.77 96.56 3 1 ASN A 89 ? ? -95.29 -69.80 4 1 LYS A 90 ? ? -145.17 -63.12 5 1 CYS A 95 ? ? 52.12 -176.66 6 1 ALA A 102 ? ? 52.44 -165.91 7 1 ASN A 104 ? ? 58.54 -79.37 8 1 ASP A 109 ? ? -159.82 59.40 9 1 PHE A 117 ? ? -160.68 -42.64 10 1 ARG A 118 ? ? 51.98 93.65 11 2 ASN A 75 ? ? -102.42 -167.57 12 2 LYS A 80 ? ? -99.59 30.24 13 2 PHE A 101 ? ? -163.01 119.88 14 2 GLU A 106 ? ? -140.05 -67.55 15 2 PHE A 117 ? ? 52.61 94.10 16 3 LYS A 60 ? ? 52.73 -178.24 17 3 SER A 73 ? ? -160.01 40.86 18 3 TYR A 85 ? ? -159.15 -64.41 19 3 LYS A 111 ? ? 65.39 -65.71 20 4 ASN A 41 ? ? -85.75 31.03 21 4 THR A 74 ? ? -98.98 30.98 22 4 LYS A 78 ? ? 52.77 93.85 23 4 ASP A 96 ? ? -128.63 -59.74 24 4 PHE A 99 ? ? -162.52 -46.36 25 4 ASP A 109 ? ? -150.04 29.22 26 4 LYS A 110 ? ? 52.05 89.90 27 5 ASN A 67 ? ? 51.87 -173.48 28 5 SER A 73 ? ? 52.38 94.10 29 5 ASN A 75 ? ? 58.01 167.70 30 5 GLU A 83 ? ? 52.63 -170.44 31 5 SER A 86 ? ? -135.13 -62.54 32 5 ASP A 109 ? ? 52.75 87.17 33 5 PHE A 117 ? ? 56.12 173.12 34 6 MET A -1 ? ? -157.26 -46.14 35 6 ASN A 41 ? ? -85.63 31.08 36 6 LYS A 60 ? ? 53.02 -170.50 37 6 SER A 71 ? ? 59.79 159.43 38 6 ASP A 96 ? ? -143.35 -63.06 39 6 GLU A 98 ? ? 55.41 99.95 40 6 LYS A 107 ? ? -160.07 -61.37 41 7 LYS A 60 ? ? -150.95 -60.02 42 7 LYS A 66 ? ? -99.60 -63.43 43 7 GLU A 83 ? ? 51.90 93.77 44 7 LYS A 88 ? ? 52.96 84.67 45 7 ASN A 89 ? ? -91.37 -65.24 46 7 GLU A 98 ? ? 59.05 155.86 47 7 GLU A 106 ? ? -156.60 -61.03 48 8 GLU A 62 ? ? -161.36 33.34 49 8 LYS A 66 ? ? 53.22 94.33 50 8 PRO A 72 ? ? -63.40 95.12 51 8 LYS A 88 ? ? -90.14 -70.11 52 8 CYS A 95 ? ? -159.66 -60.32 53 8 ASP A 96 ? ? -142.05 -54.22 54 8 GLU A 106 ? ? 51.99 -173.74 55 9 ALA A -2 ? ? 52.81 -175.85 56 9 ASN A 41 ? ? -86.21 30.68 57 9 GLU A 83 ? ? 56.80 -81.79 58 9 SER A 86 ? ? -146.18 -68.38 59 9 LYS A 88 ? ? 53.02 93.06 60 9 SER A 92 ? ? -161.39 -65.21 61 9 CYS A 95 ? ? -159.71 -46.60 62 9 PHE A 108 ? ? 51.95 90.08 63 10 ASN A 41 ? ? -85.59 31.00 64 10 GLU A 62 ? ? -99.99 30.57 65 10 ILE A 63 ? ? 53.60 89.14 66 10 THR A 69 ? ? -152.63 33.46 67 10 SER A 71 ? ? -161.31 89.40 68 10 SER A 73 ? ? -161.39 -63.87 69 10 TYR A 85 ? ? -160.43 33.01 70 10 SER A 86 ? ? -157.07 33.96 71 10 PHE A 101 ? ? -160.50 34.01 72 10 GLN A 112 ? ? 52.22 -172.78 73 11 ASN A 41 ? ? -86.40 30.66 74 11 THR A 84 ? ? -140.82 33.41 75 11 MET A 93 ? ? -97.82 -67.02 76 11 PHE A 101 ? ? -141.64 -61.80 77 11 GLU A 106 ? ? 52.57 92.27 78 11 PHE A 117 ? ? -163.45 32.30 79 12 ASN A 41 ? ? -85.79 30.94 80 12 ASN A 75 ? ? -99.70 30.14 81 12 SER A 76 ? ? -152.73 57.63 82 12 LYS A 80 ? ? 36.72 41.14 83 12 LYS A 88 ? ? -159.91 36.00 84 12 MET A 93 ? ? 53.07 -179.53 85 12 ASP A 100 ? ? 53.24 88.74 86 12 ALA A 115 ? ? -105.40 -65.60 87 13 ASN A 41 ? ? -86.76 30.94 88 13 GLU A 62 ? ? 53.18 -161.46 89 13 PRO A 65 ? ? -68.18 -167.75 90 13 THR A 84 ? ? 64.49 -67.95 91 13 CYS A 95 ? ? -160.60 33.60 92 13 GLU A 119 ? ? 55.69 -84.28 93 14 ASN A 41 ? ? -86.26 30.89 94 14 LYS A 60 ? ? -98.61 -65.77 95 14 THR A 74 ? ? -147.19 31.03 96 14 THR A 84 ? ? 44.40 82.65 97 14 MET A 93 ? ? -90.83 -66.05 98 14 ALA A 103 ? ? -139.64 -57.96 99 14 ASP A 109 ? ? -142.16 -47.01 100 14 GLN A 112 ? ? 58.12 166.92 101 15 ASN A 41 ? ? -86.10 30.58 102 15 LYS A 60 ? ? 53.01 90.45 103 15 THR A 84 ? ? -157.94 33.75 104 15 SER A 86 ? ? -162.74 110.58 105 15 LYS A 88 ? ? -100.07 -61.16 106 15 SER A 92 ? ? -154.63 33.93 107 15 CYS A 95 ? ? -98.92 36.24 108 15 ASP A 96 ? ? 52.40 -175.84 109 15 ALA A 102 ? ? -98.55 -64.00 110 15 LEU A 105 ? ? -166.48 32.74 111 15 PHE A 108 ? ? -154.12 35.40 112 16 LYS A 60 ? ? -146.62 -60.66 113 16 ASN A 61 ? ? -147.65 27.33 114 16 SER A 73 ? ? -130.01 -49.71 115 16 TRP A 91 ? ? -162.02 -60.80 116 16 CYS A 95 ? ? 52.78 94.43 117 16 GLU A 98 ? ? 52.02 -173.12 118 16 GLN A 112 ? ? 51.98 89.61 119 16 ALA A 115 ? ? -158.29 -45.30 120 16 ARG A 118 ? ? -95.88 -63.23 121 17 ASN A 41 ? ? -85.08 30.99 122 17 GLU A 83 ? ? 52.84 85.19 123 17 MET A 93 ? ? -146.49 -46.94 124 17 GLN A 112 ? ? 52.33 90.88 125 17 VAL A 113 ? ? 58.13 164.81 126 17 GLU A 116 ? ? 52.68 -175.24 127 18 MET A 1 ? ? 52.19 94.57 128 18 LYS A 70 ? ? -137.36 -63.15 129 18 ASN A 75 ? ? 53.96 -178.49 130 18 PHE A 99 ? ? -146.25 -62.77 131 18 LYS A 107 ? ? 57.22 -82.18 132 18 ASP A 109 ? ? 52.70 -177.52 133 18 GLN A 112 ? ? 52.42 72.83 134 19 MET A 1 ? ? 53.30 -179.15 135 19 ASN A 61 ? ? -95.58 48.03 136 19 SER A 92 ? ? -96.95 -65.27 137 19 MET A 93 ? ? -147.34 30.12 138 19 CYS A 95 ? ? 57.95 166.39 139 19 ASN A 104 ? ? -127.41 -66.76 140 19 LEU A 105 ? ? 51.74 84.11 141 19 GLU A 116 ? ? -158.47 34.58 142 20 ALA A -2 ? ? 57.52 -83.00 143 20 MET A -1 ? ? -142.98 33.69 144 20 ASN A 41 ? ? -86.28 30.15 145 20 LYS A 60 ? ? -94.16 -60.66 146 20 ASN A 61 ? ? -140.61 -59.96 147 20 ILE A 63 ? ? -146.15 53.39 148 20 TYR A 85 ? ? -91.42 -61.23 149 20 LYS A 88 ? ? -148.61 32.11 150 20 ASN A 89 ? ? -150.34 -47.35 151 20 LYS A 107 ? ? 52.03 -174.44 152 20 ALA A 115 ? ? 51.76 89.83 153 20 ARG A 118 ? ? 52.98 -179.61 # _pdbx_nmr_ensemble.entry_id 4A53 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY' # _pdbx_nmr_representative.entry_id 4A53 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% WATER/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 7.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength 125 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type NOESY _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_details.entry_id 4A53 _pdbx_nmr_details.text NONE # _pdbx_nmr_refine.entry_id 4A53 _pdbx_nmr_refine.method XPLOR _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 2.9.3 'SCHWIETERS CD' 1 'structure solution' Sparky ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 THR N N N N 280 THR CA C N S 281 THR C C N N 282 THR O O N N 283 THR CB C N R 284 THR OG1 O N N 285 THR CG2 C N N 286 THR OXT O N N 287 THR H H N N 288 THR H2 H N N 289 THR HA H N N 290 THR HB H N N 291 THR HG1 H N N 292 THR HG21 H N N 293 THR HG22 H N N 294 THR HG23 H N N 295 THR HXT H N N 296 TRP N N N N 297 TRP CA C N S 298 TRP C C N N 299 TRP O O N N 300 TRP CB C N N 301 TRP CG C Y N 302 TRP CD1 C Y N 303 TRP CD2 C Y N 304 TRP NE1 N Y N 305 TRP CE2 C Y N 306 TRP CE3 C Y N 307 TRP CZ2 C Y N 308 TRP CZ3 C Y N 309 TRP CH2 C Y N 310 TRP OXT O N N 311 TRP H H N N 312 TRP H2 H N N 313 TRP HA H N N 314 TRP HB2 H N N 315 TRP HB3 H N N 316 TRP HD1 H N N 317 TRP HE1 H N N 318 TRP HE3 H N N 319 TRP HZ2 H N N 320 TRP HZ3 H N N 321 TRP HH2 H N N 322 TRP HXT H N N 323 TYR N N N N 324 TYR CA C N S 325 TYR C C N N 326 TYR O O N N 327 TYR CB C N N 328 TYR CG C Y N 329 TYR CD1 C Y N 330 TYR CD2 C Y N 331 TYR CE1 C Y N 332 TYR CE2 C Y N 333 TYR CZ C Y N 334 TYR OH O N N 335 TYR OXT O N N 336 TYR H H N N 337 TYR H2 H N N 338 TYR HA H N N 339 TYR HB2 H N N 340 TYR HB3 H N N 341 TYR HD1 H N N 342 TYR HD2 H N N 343 TYR HE1 H N N 344 TYR HE2 H N N 345 TYR HH H N N 346 TYR HXT H N N 347 VAL N N N N 348 VAL CA C N S 349 VAL C C N N 350 VAL O O N N 351 VAL CB C N N 352 VAL CG1 C N N 353 VAL CG2 C N N 354 VAL OXT O N N 355 VAL H H N N 356 VAL H2 H N N 357 VAL HA H N N 358 VAL HB H N N 359 VAL HG11 H N N 360 VAL HG12 H N N 361 VAL HG13 H N N 362 VAL HG21 H N N 363 VAL HG22 H N N 364 VAL HG23 H N N 365 VAL HXT H N N 366 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 4A53 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_