data_4APD # _entry.id 4APD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4APD pdb_00004apd 10.2210/pdb4apd/pdb PDBE EBI-51960 ? ? WWPDB D_1290051960 ? ? BMRB 18378 ? ? # _pdbx_database_related.db_id 18378 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4APD _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2012-04-02 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ludvigsen, S.' 1 'Steensgaard, D.B.' 2 'Thomsen, J.K.' 3 'Strauss, H.' 4 'Normann, M.' 5 # _citation.id primary _citation.title Liraglutide _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Steensgaard, D.B.' 1 ? primary 'Thomsen, J.K.' 2 ? primary 'Strauss, H.' 3 ? primary 'Normann, M.' 4 ? primary 'Ludvigsen, S.' 5 ? # _cell.entry_id 4APD _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4APD _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man LIRAGLUTIDE 3387.713 1 ? ? ? 'LIRAGLUTIDE IS A HUMAN GLP-1 ANALOG' 2 non-polymer syn 'N-hexadecanoyl-L-glutamic acid' 385.538 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GLUCAGON-LIKE PEPTIDE 1(7-37)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG _entity_poly.pdbx_seq_one_letter_code_can HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 ALA n 1 3 GLU n 1 4 GLY n 1 5 THR n 1 6 PHE n 1 7 THR n 1 8 SER n 1 9 ASP n 1 10 VAL n 1 11 SER n 1 12 SER n 1 13 TYR n 1 14 LEU n 1 15 GLU n 1 16 GLY n 1 17 GLN n 1 18 ALA n 1 19 ALA n 1 20 LYS n 1 21 GLU n 1 22 PHE n 1 23 ILE n 1 24 ALA n 1 25 TRP n 1 26 LEU n 1 27 VAL n 1 28 ARG n 1 29 GLY n 1 30 ARG n 1 31 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ;BAKER'S YEAST ; _entity_src_gen.pdbx_host_org_scientific_name 'SACCHAROMYCES CEREVISIAE' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4932 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLUC_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P01275 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4APD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01275 _struct_ref_seq.db_align_beg 98 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 128 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 7 _struct_ref_seq.pdbx_auth_seq_align_end 37 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4APD _struct_ref_seq_dif.mon_id ARG _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 28 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01275 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 125 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 34 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 D6M non-polymer . 'N-hexadecanoyl-L-glutamic acid' ? 'C21 H39 N O5' 385.538 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 7.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '10% D2O / 90% H2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_details.entry_id 4APD _pdbx_nmr_details.text ;TOCSY AND NOESY DATA FOR ASSIGMENT AND MODEL BUILDING. STRUCTURE IS COMPOSED OF 2 HELICES WHICH ARE POORLY ORIENTED RELATIVE TO EACH OTHER ; # _pdbx_nmr_ensemble.entry_id 4APD _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # _pdbx_nmr_representative.entry_id 4APD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement 'XPLOR 3.1, CNX' CNX 'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' Pronto ? ? 2 'structure solution' X-PLOR ? ? 3 'structure solution' CNX ? ? 4 # _exptl.entry_id 4APD _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 4APD _struct.title Liraglutide _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4APD _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'HORMONE, GLUCAGON, GLUCAGON LIKE PEPTIDE-1 ANALOG' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 7 ? TYR A 13 ? THR A 13 TYR A 19 1 ? 7 HELX_P HELX_P2 2 ALA A 18 ? ARG A 28 ? ALA A 24 ARG A 34 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 20 _struct_conn.ptnr1_label_atom_id NZ _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id D6M _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C07 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 26 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id D6M _struct_conn.ptnr2_auth_seq_id 1038 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.328 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id D6M _struct_site.pdbx_auth_seq_id 1038 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'BINDING SITE FOR RESIDUE D6M A 1038' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ALA A 19 ? ALA A 25 . ? 1_555 ? 2 AC1 7 LYS A 20 ? LYS A 26 . ? 1_555 ? 3 AC1 7 PHE A 22 ? PHE A 28 . ? 1_555 ? 4 AC1 7 ILE A 23 ? ILE A 29 . ? 1_555 ? 5 AC1 7 TRP A 25 ? TRP A 31 . ? 1_555 ? 6 AC1 7 LEU A 26 ? LEU A 32 . ? 1_555 ? 7 AC1 7 VAL A 27 ? VAL A 33 . ? 1_555 ? # _database_PDB_matrix.entry_id 4APD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4APD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 7 7 HIS HIS A . n A 1 2 ALA 2 8 8 ALA ALA A . n A 1 3 GLU 3 9 9 GLU GLU A . n A 1 4 GLY 4 10 10 GLY GLY A . n A 1 5 THR 5 11 11 THR THR A . n A 1 6 PHE 6 12 12 PHE PHE A . n A 1 7 THR 7 13 13 THR THR A . n A 1 8 SER 8 14 14 SER SER A . n A 1 9 ASP 9 15 15 ASP ASP A . n A 1 10 VAL 10 16 16 VAL VAL A . n A 1 11 SER 11 17 17 SER SER A . n A 1 12 SER 12 18 18 SER SER A . n A 1 13 TYR 13 19 19 TYR TYR A . n A 1 14 LEU 14 20 20 LEU LEU A . n A 1 15 GLU 15 21 21 GLU GLU A . n A 1 16 GLY 16 22 22 GLY GLY A . n A 1 17 GLN 17 23 23 GLN GLN A . n A 1 18 ALA 18 24 24 ALA ALA A . n A 1 19 ALA 19 25 25 ALA ALA A . n A 1 20 LYS 20 26 26 LYS LYS A . n A 1 21 GLU 21 27 27 GLU GLU A . n A 1 22 PHE 22 28 28 PHE PHE A . n A 1 23 ILE 23 29 29 ILE ILE A . n A 1 24 ALA 24 30 30 ALA ALA A . n A 1 25 TRP 25 31 31 TRP TRP A . n A 1 26 LEU 26 32 32 LEU LEU A . n A 1 27 VAL 27 33 33 VAL VAL A . n A 1 28 ARG 28 34 34 ARG ARG A . n A 1 29 GLY 29 35 35 GLY GLY A . n A 1 30 ARG 30 36 36 ARG ARG A . n A 1 31 GLY 31 37 37 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id D6M _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1038 _pdbx_nonpoly_scheme.auth_seq_num 1038 _pdbx_nonpoly_scheme.pdb_mon_id D6M _pdbx_nonpoly_scheme.auth_mon_id D6M _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-07-10 2 'Structure model' 1 1 2014-01-29 3 'Structure model' 2 0 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Source and taxonomy' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Atomic model' 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Database references' 7 3 'Structure model' 'Derived calculations' 8 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' atom_site 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_atom_site.Cartn_x' 2 3 'Structure model' '_atom_site.Cartn_y' 3 3 'Structure model' '_atom_site.Cartn_z' 4 3 'Structure model' '_atom_site.auth_atom_id' 5 3 'Structure model' '_atom_site.label_atom_id' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' 8 3 'Structure model' '_pdbx_database_status.status_code_cs' 9 3 'Structure model' '_pdbx_database_status.status_code_mr' 10 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 11 3 'Structure model' '_pdbx_nmr_software.name' 12 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 13 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 14 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 15 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 16 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 17 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 18 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 19 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 20 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 21 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 22 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 23 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 24 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 25 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ; HELIX DETERMINATION METHOD: AUTHOR PROVIDED. ; # _pdbx_entry_details.entry_id 4APD _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;LYS(GAMMA-GLU-PALMITOYL) (D6M): POSITION 26 IS LYSINE-GAMMA-GLU-PALMITOYL ; _pdbx_entry_details.sequence_details ;IN POSITION 26 LYSINE IS MODIFIED WITH LYS(GAMMA-GLU- PALMITOYL) ; _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 11 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 PHE _pdbx_validate_close_contact.auth_seq_id_1 28 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 TRP _pdbx_validate_close_contact.auth_seq_id_2 31 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 12 ? ? -169.95 -47.63 2 1 GLN A 23 ? ? -90.33 -78.89 3 1 ALA A 25 ? ? -54.29 -73.55 4 1 ARG A 34 ? ? -106.19 55.27 5 1 ARG A 36 ? ? -161.01 38.38 6 2 PHE A 12 ? ? -138.71 -42.20 7 2 LEU A 20 ? ? -72.01 -76.82 8 2 GLU A 21 ? ? -147.72 -73.40 9 2 ARG A 34 ? ? -112.39 78.19 10 3 GLU A 21 ? ? -174.63 121.04 11 4 PHE A 12 ? ? -135.30 -43.12 12 5 PHE A 12 ? ? -163.71 -84.21 13 5 THR A 13 ? ? -94.70 -71.08 14 5 LEU A 20 ? ? -68.79 69.98 15 5 GLU A 21 ? ? -123.23 -74.73 16 5 ARG A 34 ? ? -110.30 -75.25 17 6 PHE A 12 ? ? -158.91 -59.26 18 6 SER A 18 ? ? -90.42 -60.54 19 6 GLU A 21 ? ? 60.26 160.85 20 7 PHE A 12 ? ? -170.19 -41.75 21 7 GLU A 21 ? ? 69.06 -67.85 22 7 LYS A 26 ? ? -38.74 -32.15 23 7 ARG A 34 ? ? -109.04 70.86 24 8 PHE A 12 ? ? -169.96 -42.31 25 8 ARG A 36 ? ? -98.66 34.20 26 9 THR A 11 ? ? -69.81 91.19 27 9 PHE A 12 ? ? -155.66 -35.01 28 9 ARG A 36 ? ? -172.15 149.41 29 10 PHE A 12 ? ? -170.02 -42.10 30 10 LEU A 20 ? ? -76.00 -84.43 31 10 GLU A 21 ? ? 169.60 -63.65 32 10 ARG A 36 ? ? 47.94 28.40 33 11 ALA A 8 ? ? -166.79 109.70 34 11 PHE A 12 ? ? -165.42 -50.89 35 11 GLU A 21 ? ? -60.61 -78.99 36 11 PHE A 28 ? ? -53.80 -71.50 37 11 ILE A 29 ? ? -45.90 -19.26 38 11 ARG A 36 ? ? 66.31 -73.52 39 12 THR A 11 ? ? -69.83 -175.46 40 12 PHE A 12 ? ? -170.12 -39.59 41 12 LEU A 20 ? ? -55.07 -177.99 42 12 GLU A 21 ? ? -135.44 -72.14 43 12 ARG A 34 ? ? -98.52 31.42 44 12 ARG A 36 ? ? -130.84 -70.58 45 13 PHE A 12 ? ? -137.12 -45.57 46 13 GLU A 21 ? ? -96.27 45.76 47 13 ARG A 36 ? ? 61.05 112.90 48 14 GLU A 9 ? ? -69.97 -177.89 49 14 PHE A 12 ? ? -132.52 -42.36 50 14 GLU A 21 ? ? 44.04 83.18 51 14 ALA A 25 ? ? -86.50 -73.38 52 14 ARG A 36 ? ? -138.62 -62.42 53 15 ALA A 25 ? ? -70.44 -76.94 54 16 THR A 13 ? ? -53.18 -80.19 55 16 GLU A 21 ? ? -162.25 55.13 56 16 ARG A 36 ? ? -56.59 107.02 57 17 PHE A 12 ? ? -149.21 -59.83 58 17 GLU A 21 ? ? -141.13 36.87 59 18 PHE A 12 ? ? -133.27 -46.01 60 18 LEU A 20 ? ? -69.01 -74.04 61 18 GLU A 21 ? ? -172.27 -49.79 62 19 PHE A 12 ? ? -149.31 -49.88 63 19 LEU A 20 ? ? -58.89 -162.42 64 19 GLU A 21 ? ? 72.80 79.44 65 19 ARG A 36 ? ? 60.76 156.38 66 20 PHE A 12 ? ? -170.15 -36.49 67 20 THR A 13 ? ? -35.73 -36.06 68 20 LEU A 20 ? ? -49.81 161.74 69 20 ARG A 34 ? ? -100.37 -77.03 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'N-hexadecanoyl-L-glutamic acid' _pdbx_entity_nonpoly.comp_id D6M #