data_4B4A # _entry.id 4B4A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4B4A PDBE EBI-53555 WWPDB D_1290053555 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4B4A _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2012-07-30 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rollauer, S.E.' 1 'Tarry, M.J.' 2 'Jaaskelainen, M.' 3 'Graham, J.E.' 4 'Jaeger, F.' 5 'Krehenbrink, M.' 6 'Roversi, P.' 7 'McDowell, M.A.' 8 'Stansfeld, P.J.' 9 'Johnson, S.' 10 'Liu, S.M.' 11 'Lukey, M.J.' 12 'Marcoux, J.' 13 'Robinson, C.V.' 14 'Sansom, M.S.' 15 'Palmer, T.' 16 'Hogbom, M.' 17 'Berks, B.C.' 18 'Lea, S.M.' 19 # _citation.id primary _citation.title 'Structure of the Tatc Core of the Twin-Arginine Protein Transport System.' _citation.journal_abbrev Nature _citation.journal_volume 49 _citation.page_first 210 _citation.page_last ? _citation.year 2012 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23201679 _citation.pdbx_database_id_DOI 10.1038/NATURE11683 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Rollauer, S.E.' 1 primary 'Tarry, M.J.' 2 primary 'Graham, J.E.' 3 primary 'Jaaskelainen, M.' 4 primary 'Jager, F.' 5 primary 'Johnson, S.' 6 primary 'Krehenbrink, M.' 7 primary 'Liu, S.' 8 primary 'Lukey, M.J.' 9 primary 'Marcoux, J.' 10 primary 'Mcdowell, M.A.' 11 primary 'Rodriguez, F.' 12 primary 'Roversi, P.' 13 primary 'Stansfeld, P.J.' 14 primary 'Robinson, C.V.' 15 primary 'Sansom, M.S.P.' 16 primary 'Palmer, T.' 17 primary 'Hogbom, M.' 18 primary 'Berks, B.C.' 19 primary 'Lea, S.M.' 20 # _cell.entry_id 4B4A _cell.length_a 123.520 _cell.length_b 123.520 _cell.length_c 216.410 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4B4A _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SEC-INDEPENDENT PROTEIN TRANSLOCASE PROTEIN TATC' 28422.586 1 ? ? ? 'ONE MOLECULE OF DETERGENT LMNG BOUND AT CRYSTALLOGRAPHIC 2-FOLD' 2 non-polymer syn 'Lauryl Maltose Neopentyl Glycol' 1005.188 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name TATC # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)PLTEHLRELRYRLIISIIAFLIGSGIAFYFAKYVFEILKEPILKSYPEVELITLSPTEPLFILIKISLAVGFIIA SPVILYQFWRFIEPALYSHEKRAFIPLLLGSILLF(MSE)LGALFAYFIVLPLALKFLLGLGFTQLLATPYLSVD(MSE) YISFVLKLVVAFGIAFE(MSE)PIVLYVLQKAGVITPEQLASFRKYFIVIAFVIGAIIAPDVSTQVL(MSE)AIPLLLLY EISIFLGKLATRKKKEIQKAPGSENLYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MPLTEHLRELRYRLIISIIAFLIGSGIAFYFAKYVFEILKEPILKSYPEVELITLSPTEPLFILIKISLAVGFIIASPVI LYQFWRFIEPALYSHEKRAFIPLLLGSILLFMLGALFAYFIVLPLALKFLLGLGFTQLLATPYLSVDMYISFVLKLVVAF GIAFEMPIVLYVLQKAGVITPEQLASFRKYFIVIAFVIGAIIAPDVSTQVLMAIPLLLLYEISIFLGKLATRKKKEIQKA PGSENLYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 PRO n 1 3 LEU n 1 4 THR n 1 5 GLU n 1 6 HIS n 1 7 LEU n 1 8 ARG n 1 9 GLU n 1 10 LEU n 1 11 ARG n 1 12 TYR n 1 13 ARG n 1 14 LEU n 1 15 ILE n 1 16 ILE n 1 17 SER n 1 18 ILE n 1 19 ILE n 1 20 ALA n 1 21 PHE n 1 22 LEU n 1 23 ILE n 1 24 GLY n 1 25 SER n 1 26 GLY n 1 27 ILE n 1 28 ALA n 1 29 PHE n 1 30 TYR n 1 31 PHE n 1 32 ALA n 1 33 LYS n 1 34 TYR n 1 35 VAL n 1 36 PHE n 1 37 GLU n 1 38 ILE n 1 39 LEU n 1 40 LYS n 1 41 GLU n 1 42 PRO n 1 43 ILE n 1 44 LEU n 1 45 LYS n 1 46 SER n 1 47 TYR n 1 48 PRO n 1 49 GLU n 1 50 VAL n 1 51 GLU n 1 52 LEU n 1 53 ILE n 1 54 THR n 1 55 LEU n 1 56 SER n 1 57 PRO n 1 58 THR n 1 59 GLU n 1 60 PRO n 1 61 LEU n 1 62 PHE n 1 63 ILE n 1 64 LEU n 1 65 ILE n 1 66 LYS n 1 67 ILE n 1 68 SER n 1 69 LEU n 1 70 ALA n 1 71 VAL n 1 72 GLY n 1 73 PHE n 1 74 ILE n 1 75 ILE n 1 76 ALA n 1 77 SER n 1 78 PRO n 1 79 VAL n 1 80 ILE n 1 81 LEU n 1 82 TYR n 1 83 GLN n 1 84 PHE n 1 85 TRP n 1 86 ARG n 1 87 PHE n 1 88 ILE n 1 89 GLU n 1 90 PRO n 1 91 ALA n 1 92 LEU n 1 93 TYR n 1 94 SER n 1 95 HIS n 1 96 GLU n 1 97 LYS n 1 98 ARG n 1 99 ALA n 1 100 PHE n 1 101 ILE n 1 102 PRO n 1 103 LEU n 1 104 LEU n 1 105 LEU n 1 106 GLY n 1 107 SER n 1 108 ILE n 1 109 LEU n 1 110 LEU n 1 111 PHE n 1 112 MSE n 1 113 LEU n 1 114 GLY n 1 115 ALA n 1 116 LEU n 1 117 PHE n 1 118 ALA n 1 119 TYR n 1 120 PHE n 1 121 ILE n 1 122 VAL n 1 123 LEU n 1 124 PRO n 1 125 LEU n 1 126 ALA n 1 127 LEU n 1 128 LYS n 1 129 PHE n 1 130 LEU n 1 131 LEU n 1 132 GLY n 1 133 LEU n 1 134 GLY n 1 135 PHE n 1 136 THR n 1 137 GLN n 1 138 LEU n 1 139 LEU n 1 140 ALA n 1 141 THR n 1 142 PRO n 1 143 TYR n 1 144 LEU n 1 145 SER n 1 146 VAL n 1 147 ASP n 1 148 MSE n 1 149 TYR n 1 150 ILE n 1 151 SER n 1 152 PHE n 1 153 VAL n 1 154 LEU n 1 155 LYS n 1 156 LEU n 1 157 VAL n 1 158 VAL n 1 159 ALA n 1 160 PHE n 1 161 GLY n 1 162 ILE n 1 163 ALA n 1 164 PHE n 1 165 GLU n 1 166 MSE n 1 167 PRO n 1 168 ILE n 1 169 VAL n 1 170 LEU n 1 171 TYR n 1 172 VAL n 1 173 LEU n 1 174 GLN n 1 175 LYS n 1 176 ALA n 1 177 GLY n 1 178 VAL n 1 179 ILE n 1 180 THR n 1 181 PRO n 1 182 GLU n 1 183 GLN n 1 184 LEU n 1 185 ALA n 1 186 SER n 1 187 PHE n 1 188 ARG n 1 189 LYS n 1 190 TYR n 1 191 PHE n 1 192 ILE n 1 193 VAL n 1 194 ILE n 1 195 ALA n 1 196 PHE n 1 197 VAL n 1 198 ILE n 1 199 GLY n 1 200 ALA n 1 201 ILE n 1 202 ILE n 1 203 ALA n 1 204 PRO n 1 205 ASP n 1 206 VAL n 1 207 SER n 1 208 THR n 1 209 GLN n 1 210 VAL n 1 211 LEU n 1 212 MSE n 1 213 ALA n 1 214 ILE n 1 215 PRO n 1 216 LEU n 1 217 LEU n 1 218 LEU n 1 219 LEU n 1 220 TYR n 1 221 GLU n 1 222 ILE n 1 223 SER n 1 224 ILE n 1 225 PHE n 1 226 LEU n 1 227 GLY n 1 228 LYS n 1 229 LEU n 1 230 ALA n 1 231 THR n 1 232 ARG n 1 233 LYS n 1 234 LYS n 1 235 LYS n 1 236 GLU n 1 237 ILE n 1 238 GLN n 1 239 LYS n 1 240 ALA n 1 241 PRO n 1 242 GLY n 1 243 SER n 1 244 GLU n 1 245 ASN n 1 246 LEU n 1 247 TYR n 1 248 PHE n 1 249 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'AQUIFEX AEOLICUS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 63363 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain LEMO56DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PWALDO _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TATC_AQUAE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession O67305 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4B4A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O67305 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 240 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 240 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4B4A PRO A 241 ? UNP O67305 ? ? 'expression tag' 241 1 1 4B4A GLY A 242 ? UNP O67305 ? ? 'expression tag' 242 2 1 4B4A SER A 243 ? UNP O67305 ? ? 'expression tag' 243 3 1 4B4A GLU A 244 ? UNP O67305 ? ? 'expression tag' 244 4 1 4B4A ASN A 245 ? UNP O67305 ? ? 'expression tag' 245 5 1 4B4A LEU A 246 ? UNP O67305 ? ? 'expression tag' 246 6 1 4B4A TYR A 247 ? UNP O67305 ? ? 'expression tag' 247 7 1 4B4A PHE A 248 ? UNP O67305 ? ? 'expression tag' 248 8 1 4B4A GLN A 249 ? UNP O67305 ? ? 'expression tag' 249 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LMN non-polymer . 'Lauryl Maltose Neopentyl Glycol' 2,2-didecylpropane-1,3-bis-b-D-maltopyranoside 'C47 H88 O22' 1005.188 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4B4A _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 5.59 _exptl_crystal.density_percent_sol 0.78 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.2M AMMONIUM SULPHATE, 0.02M NACL, 0.02M SODIUM ACETATE PH4.0, 33% V/V PEG 200' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2012-05-30 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_wavelength 0.92 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4B4A _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 15.00 _reflns.d_resolution_high 3.50 _reflns.number_obs 7820 _reflns.number_all ? _reflns.percent_possible_obs 96.8 _reflns.pdbx_Rmerge_I_obs 0.03 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.90 _reflns.B_iso_Wilson_estimate 132.26 _reflns.pdbx_redundancy 3.3 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 3.50 _reflns_shell.d_res_low 3.60 _reflns_shell.percent_possible_all 96.6 _reflns_shell.Rmerge_I_obs 0.95 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 1.40 _reflns_shell.pdbx_redundancy 3.4 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4B4A _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 7900 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 22.00 _refine.ls_d_res_high 3.50 _refine.ls_percent_reflns_obs 96.29 _refine.ls_R_factor_obs 0.2535 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2518 _refine.ls_R_factor_R_free 0.2882 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.89 _refine.ls_number_reflns_R_free 386 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.8869 _refine.correlation_coeff_Fo_to_Fc_free 0.8553 _refine.B_iso_mean 159.38 _refine.aniso_B[1][1] -18.3276 _refine.aniso_B[2][2] -18.3276 _refine.aniso_B[3][3] 36.6553 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'IDEAL-DIST CONTACT TERM CONTACT SETUP. ALL ATOMS HAVE CCP4 ATOM TYPE FROM LIBRARY' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI 4.314 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.497 _refine.pdbx_overall_SU_R_Blow_DPI 1.440 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.479 # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 4B4A _refine_analyze.Luzzati_coordinate_error_obs 0.920 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1804 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 69 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1873 _refine_hist.d_res_high 3.50 _refine_hist.d_res_low 22.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.010 ? 2.00 2007 'X-RAY DIFFRACTION' HARMONIC t_angle_deg 1.27 ? 2.00 2808 'X-RAY DIFFRACTION' HARMONIC t_dihedral_angle_d ? ? 2.00 670 'X-RAY DIFFRACTION' SINUSOIDAL t_incorr_chiral_ct ? ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes ? ? 2.00 19 'X-RAY DIFFRACTION' HARMONIC t_gen_planes ? ? 5.00 266 'X-RAY DIFFRACTION' HARMONIC t_it ? ? 20.00 2007 'X-RAY DIFFRACTION' HARMONIC t_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? t_omega_torsion 2.60 ? ? ? 'X-RAY DIFFRACTION' ? t_other_torsion 24.18 ? ? ? 'X-RAY DIFFRACTION' ? t_improper_torsion ? ? ? ? 'X-RAY DIFFRACTION' ? t_chiral_improper_torsion ? ? 5.00 267 'X-RAY DIFFRACTION' SEMIHARMONIC t_sum_occupancies ? ? ? ? 'X-RAY DIFFRACTION' ? t_utility_distance ? ? ? ? 'X-RAY DIFFRACTION' ? t_utility_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_utility_torsion ? ? ? ? 'X-RAY DIFFRACTION' ? t_ideal_dist_contact ? ? 4.00 2308 'X-RAY DIFFRACTION' SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.d_res_high 3.50 _refine_ls_shell.d_res_low 3.91 _refine_ls_shell.number_reflns_R_work 2053 _refine_ls_shell.R_factor_R_work 0.2399 _refine_ls_shell.percent_reflns_obs 96.29 _refine_ls_shell.R_factor_R_free 0.2484 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 5.78 _refine_ls_shell.number_reflns_R_free 126 _refine_ls_shell.number_reflns_all 2179 _refine_ls_shell.R_factor_all 0.2404 # _struct.entry_id 4B4A _struct.title 'Structure of the TatC core of the twin arginine protein translocation system' _struct.pdbx_descriptor 'SEC-INDEPENDENT PROTEIN TRANSLOCASE PROTEIN TATC' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4B4A _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'TRANSPORT PROTEIN, TAT SECRETION SYSTEM, PROTEIN TRANSLOCATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 5 ? PHE A 31 ? GLU A 5 PHE A 31 1 ? 27 HELX_P HELX_P2 2 PHE A 31 ? TYR A 47 ? PHE A 31 TYR A 47 1 ? 17 HELX_P HELX_P3 3 GLU A 59 ? GLU A 89 ? GLU A 59 GLU A 89 1 ? 31 HELX_P HELX_P4 4 PHE A 100 ? ILE A 121 ? PHE A 100 ILE A 121 1 ? 22 HELX_P HELX_P5 5 ILE A 121 ? PHE A 129 ? ILE A 121 PHE A 129 1 ? 9 HELX_P HELX_P6 6 VAL A 146 ? PHE A 164 ? VAL A 146 PHE A 164 1 ? 19 HELX_P HELX_P7 7 GLU A 165 ? ALA A 176 ? GLU A 165 ALA A 176 1 ? 12 HELX_P HELX_P8 8 THR A 180 ? ALA A 203 ? THR A 180 ALA A 203 1 ? 24 HELX_P HELX_P9 9 ASP A 205 ? LEU A 226 ? ASP A 205 LEU A 226 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 112 N ? ? ? 1_555 A PHE 111 C ? ? A MSE 112 A PHE 111 1_555 ? ? ? ? ? ? ? 1.352 ? covale2 covale ? ? A MSE 112 C ? ? ? 1_555 A LEU 113 N ? ? A MSE 112 A LEU 113 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A MSE 148 N ? ? ? 1_555 A ASP 147 C ? ? A MSE 148 A ASP 147 1_555 ? ? ? ? ? ? ? 1.340 ? covale4 covale ? ? A MSE 148 C ? ? ? 1_555 A TYR 149 N ? ? A MSE 148 A TYR 149 1_555 ? ? ? ? ? ? ? 1.345 ? covale5 covale ? ? A MSE 166 C ? ? ? 1_555 A PRO 167 N ? ? A MSE 166 A PRO 167 1_555 ? ? ? ? ? ? ? 1.351 ? covale6 covale ? ? A MSE 166 N ? ? ? 1_555 A GLU 165 C ? ? A MSE 166 A GLU 165 1_555 ? ? ? ? ? ? ? 1.351 ? covale7 covale ? ? A MSE 212 C ? ? ? 1_555 A ALA 213 N ? ? A MSE 212 A ALA 213 1_555 ? ? ? ? ? ? ? 1.338 ? covale8 covale ? ? A MSE 212 N ? ? ? 1_555 A LEU 211 C ? ? A MSE 212 A LEU 211 1_555 ? ? ? ? ? ? ? 1.328 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 89 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 89 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 90 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 90 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.00 # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 LEU A 52 ? ILE A 53 ? LEU A 52 ILE A 53 AA 2 LEU A 144 ? SER A 145 ? LEU A 144 SER A 145 # _pdbx_struct_sheet_hbond.sheet_id AA _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 53 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 53 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 144 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 144 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE LMN A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ILE A 27 ? ILE A 27 . ? 1_555 ? 2 AC1 5 TYR A 30 ? TYR A 30 . ? 12_555 ? 3 AC1 5 PHE A 31 ? PHE A 31 . ? 12_555 ? 4 AC1 5 TYR A 34 ? TYR A 34 . ? 12_555 ? 5 AC1 5 TYR A 34 ? TYR A 34 . ? 1_555 ? # _database_PDB_matrix.entry_id 4B4A _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4B4A _atom_sites.fract_transf_matrix[1][1] 0.008096 _atom_sites.fract_transf_matrix[1][2] 0.004674 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009348 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004621 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 TRP 85 85 85 TRP TRP A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 MSE 112 112 112 MSE MSE A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 TYR 143 143 143 TYR TYR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 MSE 148 148 148 MSE MSE A . n A 1 149 TYR 149 149 149 TYR TYR A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 MSE 166 166 166 MSE MSE A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 TYR 171 171 171 TYR TYR A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 PRO 181 181 181 PRO PRO A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 GLN 183 183 183 GLN GLN A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 TYR 190 190 190 TYR TYR A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 GLN 209 209 209 GLN GLN A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 MSE 212 212 212 MSE MSE A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 ILE 214 214 214 ILE ILE A . n A 1 215 PRO 215 215 215 PRO PRO A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 TYR 220 220 220 TYR TYR A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 SER 223 223 223 SER SER A . n A 1 224 ILE 224 224 224 ILE ILE A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 GLY 227 227 227 GLY GLY A . n A 1 228 LYS 228 228 228 LYS LYS A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 ALA 230 230 ? ? ? A . n A 1 231 THR 231 231 ? ? ? A . n A 1 232 ARG 232 232 ? ? ? A . n A 1 233 LYS 233 233 ? ? ? A . n A 1 234 LYS 234 234 ? ? ? A . n A 1 235 LYS 235 235 ? ? ? A . n A 1 236 GLU 236 236 ? ? ? A . n A 1 237 ILE 237 237 ? ? ? A . n A 1 238 GLN 238 238 ? ? ? A . n A 1 239 LYS 239 239 ? ? ? A . n A 1 240 ALA 240 240 ? ? ? A . n A 1 241 PRO 241 241 ? ? ? A . n A 1 242 GLY 242 242 ? ? ? A . n A 1 243 SER 243 243 ? ? ? A . n A 1 244 GLU 244 244 ? ? ? A . n A 1 245 ASN 245 245 ? ? ? A . n A 1 246 LEU 246 246 ? ? ? A . n A 1 247 TYR 247 247 ? ? ? A . n A 1 248 PHE 248 248 ? ? ? A . n A 1 249 GLN 249 249 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id LMN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 300 _pdbx_nonpoly_scheme.auth_seq_num 300 _pdbx_nonpoly_scheme.pdb_mon_id LMN _pdbx_nonpoly_scheme.auth_mon_id LMN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 112 A MSE 112 ? MET SELENOMETHIONINE 2 A MSE 148 A MSE 148 ? MET SELENOMETHIONINE 3 A MSE 166 A MSE 166 ? MET SELENOMETHIONINE 4 A MSE 212 A MSE 212 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-12-05 2 'Structure model' 1 1 2012-12-12 3 'Structure model' 1 2 2012-12-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal XDS 'data reduction' 'THROUGH XIA2' ? 1 Aimless 'data scaling' 'THROUGH XIA2' ? 2 PHENIX.HYSS phasing . ? 3 autoSHARP phasing . ? 4 BUSTER refinement 2.11.2 ? 5 # _pdbx_entry_details.entry_id 4B4A _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;C-TERMINAL ADDITIONAL TAG FROM VECTOR OF PGSENLYFQ FOLLOWING FULL TATC SEQUENCE ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 11 ? ? -68.10 16.95 2 1 TYR A 12 ? ? -135.45 -42.56 3 1 PHE A 31 ? ? -92.69 38.18 4 1 LEU A 52 ? ? -100.02 78.84 5 1 PRO A 57 ? ? -65.91 -98.12 6 1 THR A 58 ? ? -115.62 63.37 7 1 GLU A 59 ? ? -119.24 57.94 8 1 ALA A 91 ? ? -37.51 -39.73 9 1 LEU A 92 ? ? -139.35 -45.24 10 1 TYR A 93 ? ? -97.17 -82.49 11 1 SER A 94 ? ? -69.53 -178.09 12 1 ILE A 121 ? ? -129.37 -55.92 13 1 LEU A 130 ? ? -96.43 -68.15 14 1 PHE A 135 ? ? -97.06 52.24 15 1 ALA A 140 ? ? -152.39 86.86 16 1 THR A 141 ? ? -136.47 -97.67 17 1 LEU A 226 ? ? -90.12 33.85 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A ALA 230 ? A ALA 230 6 1 Y 1 A THR 231 ? A THR 231 7 1 Y 1 A ARG 232 ? A ARG 232 8 1 Y 1 A LYS 233 ? A LYS 233 9 1 Y 1 A LYS 234 ? A LYS 234 10 1 Y 1 A LYS 235 ? A LYS 235 11 1 Y 1 A GLU 236 ? A GLU 236 12 1 Y 1 A ILE 237 ? A ILE 237 13 1 Y 1 A GLN 238 ? A GLN 238 14 1 Y 1 A LYS 239 ? A LYS 239 15 1 Y 1 A ALA 240 ? A ALA 240 16 1 Y 1 A PRO 241 ? A PRO 241 17 1 Y 1 A GLY 242 ? A GLY 242 18 1 Y 1 A SER 243 ? A SER 243 19 1 Y 1 A GLU 244 ? A GLU 244 20 1 Y 1 A ASN 245 ? A ASN 245 21 1 Y 1 A LEU 246 ? A LEU 246 22 1 Y 1 A TYR 247 ? A TYR 247 23 1 Y 1 A PHE 248 ? A PHE 248 24 1 Y 1 A GLN 249 ? A GLN 249 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'Lauryl Maltose Neopentyl Glycol' _pdbx_entity_nonpoly.comp_id LMN #