data_4B8T # _entry.id 4B8T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4B8T PDBE EBI-53919 WWPDB D_1290053919 BMRB 18702 # _pdbx_database_related.db_id 18702 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4B8T _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2012-08-30 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nicastro, G.' 1 'Garcia-Mayoral, M.F.' 2 'Hollingworth, D.' 3 'Kelly, G.' 4 'Martin, S.R.' 5 'Briata, P.' 6 'Gherzi, R.' 7 'Ramos, A.' 8 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Noncanonical G Recognition Mediates Ksrp Regulation of Let-7 Biogenesis' Nat.Struct.Mol.Biol. 19 1282 ? 2012 ? US 1545-9993 ? ? 23142982 10.1038/NSMB.2427 1 'The Structure of the C-Terminal Kh Domains of Ksrp Reveals a Noncanonical Motif Important for Mrna Degradation.' Structure 15 485 ? 2007 STRUE6 UK 0969-2126 2005 ? 17437720 10.1016/J.STR.2007.03.006 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Nicastro, G.' 1 primary 'Garcia-Mayoral, M.F.' 2 primary 'Hollingworth, D.' 3 primary 'Kelly, G.' 4 primary 'Martin, S.R.' 5 primary 'Briata, P.' 6 primary 'Gherzi, R.' 7 primary 'Ramos, A.' 8 1 'Garcia-Mayoral, M.F.' 9 1 'Hollingworth, D.' 10 1 'Masino, L.' 11 1 'Diaz-Moreno, I.' 12 1 'Kelly, G.' 13 1 'Gherzi, R.' 14 1 'Chou, C.' 15 1 'Chen, C.' 16 1 'Ramos, A.' 17 # _cell.entry_id 4B8T _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4B8T _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'KH-TYPE SPLICING REGULATORY PROTEIN' 10912.468 1 ? ? 'THIRD KH DOMAIN, RESIDUES 317-418' ? 2 polymer syn "5'-R(*AP*GP*GP*GP*UP)-3'" 1626.032 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GAMAYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQS LRSGPPGPPGGPGMPPGGRGRGRGQG ; ;GAMAYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQS LRSGPPGPPGGPGMPPGGRGRGRGQG ; A ? 2 polyribonucleotide no no AGGGU AGGGU B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ALA n 1 5 TYR n 1 6 GLY n 1 7 SER n 1 8 ARG n 1 9 ILE n 1 10 GLY n 1 11 GLY n 1 12 GLY n 1 13 ILE n 1 14 ASP n 1 15 VAL n 1 16 PRO n 1 17 VAL n 1 18 PRO n 1 19 ARG n 1 20 HIS n 1 21 SER n 1 22 VAL n 1 23 GLY n 1 24 VAL n 1 25 VAL n 1 26 ILE n 1 27 GLY n 1 28 ARG n 1 29 SER n 1 30 GLY n 1 31 GLU n 1 32 MET n 1 33 ILE n 1 34 LYS n 1 35 LYS n 1 36 ILE n 1 37 GLN n 1 38 ASN n 1 39 ASP n 1 40 ALA n 1 41 GLY n 1 42 VAL n 1 43 ARG n 1 44 ILE n 1 45 GLN n 1 46 PHE n 1 47 LYS n 1 48 GLN n 1 49 ASP n 1 50 ASP n 1 51 GLY n 1 52 THR n 1 53 GLY n 1 54 PRO n 1 55 GLU n 1 56 LYS n 1 57 ILE n 1 58 ALA n 1 59 HIS n 1 60 ILE n 1 61 MET n 1 62 GLY n 1 63 PRO n 1 64 PRO n 1 65 ASP n 1 66 ARG n 1 67 CYS n 1 68 GLU n 1 69 HIS n 1 70 ALA n 1 71 ALA n 1 72 ARG n 1 73 ILE n 1 74 ILE n 1 75 ASN n 1 76 ASP n 1 77 LEU n 1 78 LEU n 1 79 GLN n 1 80 SER n 1 81 LEU n 1 82 ARG n 1 83 SER n 1 84 GLY n 1 85 PRO n 1 86 PRO n 1 87 GLY n 1 88 PRO n 1 89 PRO n 1 90 GLY n 1 91 GLY n 1 92 PRO n 1 93 GLY n 1 94 MET n 1 95 PRO n 1 96 PRO n 1 97 GLY n 1 98 GLY n 1 99 ARG n 1 100 GLY n 1 101 ARG n 1 102 GLY n 1 103 ARG n 1 104 GLY n 1 105 GLN n 1 106 GLY n 2 1 A n 2 2 G n 2 3 G n 2 4 G n 2 5 U n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'SYNTHETIC CONSTRUCT' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP FUBP2_HUMAN 1 ? ? Q92945 ? 2 PDB 4B8T 2 ? ? 4B8T ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4B8T A 5 ? 106 ? Q92945 317 ? 418 ? 5 106 2 2 4B8T B 1 ? 5 ? 4B8T 1 ? 5 ? 1 5 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4B8T GLY A 1 ? UNP Q92945 ? ? 'expression tag' 1 1 1 4B8T ALA A 2 ? UNP Q92945 ? ? 'expression tag' 2 2 1 4B8T MET A 3 ? UNP Q92945 ? ? 'expression tag' 3 3 1 4B8T ALA A 4 ? UNP Q92945 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 MM NACL' _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '10% WATER/90% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 # _pdbx_nmr_refine.entry_id 4B8T _pdbx_nmr_refine.method ARIA _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 4B8T _pdbx_nmr_details.text NONE # _pdbx_nmr_ensemble.entry_id 4B8T _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' # _pdbx_nmr_representative.entry_id 4B8T _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' UXNMR 3.5 ? 2 'structure solution' VNMR ? ? 3 'structure solution' NMRPIPE ? ? 4 'structure solution' SPARKY ? ? 5 'structure solution' ARIA 1.2 ? 6 # _exptl.entry_id 4B8T _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 4B8T _struct.title 'RNA BINDING PROTEIN Solution structure of the third KH domain of KSRP in complex with the G-rich target sequence.' _struct.pdbx_descriptor 'KH-TYPE SPLICING REGULATORY PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4B8T _struct_keywords.pdbx_keywords TRANSCRIPTION/RNA _struct_keywords.text 'TRANSCRIPTION-RNA COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 21 ? GLY A 27 ? SER A 21 GLY A 27 1 ? 7 HELX_P HELX_P2 2 GLY A 30 ? GLY A 41 ? GLY A 30 GLY A 41 1 ? 12 HELX_P HELX_P3 3 PRO A 63 ? SER A 80 ? PRO A 63 SER A 80 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ILE A 13 ? PRO A 18 ? ILE A 13 PRO A 18 AA 2 GLU A 55 ? MET A 61 ? GLU A 55 MET A 61 AA 3 ARG A 43 ? PHE A 46 ? ARG A 43 PHE A 46 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N VAL A 17 ? N VAL A 17 O LYS A 56 ? O LYS A 56 AA 2 3 N MET A 61 ? N MET A 61 O ARG A 43 ? O ARG A 43 # _database_PDB_matrix.entry_id 4B8T _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4B8T _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 GLY 106 106 106 GLY GLY A . n B 2 1 A 1 1 1 A A B . n B 2 2 G 2 2 2 G G B . n B 2 3 G 3 3 3 G G B . n B 2 4 G 4 4 4 G G B . n B 2 5 U 5 5 5 U U B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-11-07 2 'Structure model' 1 1 2012-11-21 3 'Structure model' 1 2 2012-11-28 4 'Structure model' 1 3 2012-12-05 5 'Structure model' 1 4 2013-01-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other 3 3 'Structure model' 'Structure summary' 4 4 'Structure model' 'Atomic model' 5 5 'Structure model' 'Database references' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 OE2 A GLU 31 ? ? HZ3 A LYS 34 ? ? 1.57 2 6 OD1 A ASP 49 ? ? HZ1 A LYS 56 ? ? 1.53 3 9 O A PRO 64 ? ? HG A CYS 67 ? ? 1.56 4 9 OD1 A ASP 49 ? ? HZ1 A LYS 56 ? ? 1.59 5 10 OD1 A ASP 49 ? ? HZ1 A LYS 56 ? ? 1.57 6 15 O A PRO 64 ? ? HG A CYS 67 ? ? 1.59 7 17 OD2 A ASP 50 ? ? HG1 A THR 52 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 49 ? ? 175.24 100.28 2 1 THR A 52 ? ? -91.04 59.81 3 2 ARG A 8 ? ? -172.78 113.48 4 2 PRO A 89 ? ? -62.69 99.35 5 2 PRO A 92 ? ? -67.59 99.72 6 2 PRO A 96 ? ? -78.08 45.13 7 3 ARG A 8 ? ? -83.64 -72.22 8 3 SER A 21 ? ? -143.55 14.86 9 3 GLN A 48 ? ? 60.33 -82.21 10 3 PRO A 92 ? ? -79.43 47.12 11 3 MET A 94 ? ? 70.83 129.31 12 3 PRO A 96 ? ? -95.15 32.49 13 4 ARG A 8 ? ? -100.50 72.45 14 4 SER A 29 ? ? -140.92 14.10 15 4 PRO A 92 ? ? -74.00 43.61 16 4 ARG A 103 ? ? 63.64 75.78 17 5 SER A 29 ? ? -142.08 11.98 18 5 ARG A 101 ? ? 70.75 174.49 19 6 ALA A 2 ? ? -102.60 -73.56 20 6 SER A 21 ? ? -142.47 16.25 21 6 GLN A 48 ? ? 53.10 125.00 22 6 SER A 83 ? ? -104.77 -77.03 23 6 PRO A 89 ? ? -84.20 43.87 24 6 GLN A 105 ? ? 74.51 132.24 25 7 ALA A 4 ? ? 67.12 96.21 26 7 ASP A 50 ? ? -49.33 -76.25 27 7 PRO A 96 ? ? -68.38 72.75 28 7 GLN A 105 ? ? 62.84 79.80 29 8 SER A 21 ? ? -145.32 16.42 30 8 GLN A 48 ? ? -110.10 76.61 31 8 ASP A 50 ? ? -165.75 -29.95 32 8 THR A 52 ? ? -153.01 32.38 33 8 ARG A 82 ? ? -86.61 44.40 34 9 ALA A 2 ? ? -84.24 44.58 35 9 MET A 3 ? ? -156.02 82.57 36 9 ALA A 4 ? ? 67.85 175.42 37 9 SER A 29 ? ? -156.80 20.05 38 9 GLN A 48 ? ? 66.24 179.63 39 9 ARG A 82 ? ? 61.07 75.07 40 9 PRO A 86 ? ? -68.41 85.34 41 10 ARG A 99 ? ? -93.27 51.08 42 11 ARG A 8 ? ? -152.49 82.37 43 11 SER A 29 ? ? -147.79 13.63 44 12 ALA A 2 ? ? -143.71 40.27 45 12 MET A 3 ? ? -85.29 47.65 46 12 GLN A 48 ? ? 43.95 -153.47 47 12 PRO A 86 ? ? -76.73 49.96 48 12 ARG A 103 ? ? 68.41 -71.55 49 13 ALA A 4 ? ? -163.24 77.07 50 13 TYR A 5 ? ? -109.01 57.02 51 13 ARG A 8 ? ? 71.64 -47.57 52 13 SER A 21 ? ? -141.19 11.85 53 13 MET A 94 ? ? 64.12 87.71 54 14 ALA A 2 ? ? 69.96 -63.06 55 14 ILE A 9 ? ? 68.43 105.46 56 14 SER A 21 ? ? -150.43 19.92 57 14 ASP A 49 ? ? -61.69 -78.01 58 15 MET A 3 ? ? -142.51 -82.40 59 15 SER A 21 ? ? -145.99 21.32 60 15 SER A 29 ? ? -149.49 12.25 61 15 ARG A 82 ? ? 69.66 113.29 62 15 GLN A 105 ? ? -165.15 95.48 63 16 SER A 21 ? ? -145.62 20.57 64 16 PRO A 89 ? ? -91.77 58.81 65 16 MET A 94 ? ? -155.57 63.05 66 17 ALA A 4 ? ? -157.35 -59.87 67 17 ARG A 8 ? ? -149.40 49.11 68 17 SER A 29 ? ? -152.37 26.14 69 18 ILE A 9 ? ? -100.65 73.94 70 18 SER A 21 ? ? -142.02 16.68 71 18 ASP A 49 ? ? -170.80 114.89 72 18 ASP A 50 ? ? -164.22 -38.44 73 18 ARG A 82 ? ? 67.92 -81.10 74 19 ALA A 2 ? ? 65.80 179.10 75 19 ALA A 4 ? ? 65.16 94.67 76 19 SER A 29 ? ? -157.29 21.10 77 19 ARG A 101 ? ? 62.96 94.11 78 20 ILE A 9 ? ? 39.12 66.69 79 20 PRO A 18 ? ? -39.33 126.15 80 20 SER A 21 ? ? -141.33 17.16 81 20 ASP A 50 ? ? -96.22 30.84 #