data_4B96 # _entry.id 4B96 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4B96 PDBE EBI-53939 WWPDB D_1290053939 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 4B97 _pdbx_database_related.content_type unspecified _pdbx_database_related.details ;BIOMASS SENSING MODULES FROM PUTATIVE RSGI-LIKE PROTEINS OF CLOSTRIDIUM THERMOCELLUM RESEMBLE FAMILY 3 CARBOHYDRATE- BINDING MODULE OF CELLULOSOME ; # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4B96 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2012-09-02 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yaniv, O.' 1 'Reddy, Y.H.K.' 2 'Yoffe, H.' 3 'Shimon, L.J.W.' 4 'Bayer, E.A.' 5 'Lamed, R.' 6 'Frolow, F.' 7 # _citation.id primary _citation.title 'Structure of Cbm3B from the Biomass Sensoring System of Clostridium Clarifalvum' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yaniv, O.' 1 primary 'Reddy, Y.H.K.' 2 primary 'Bayer, E.A.' 3 primary 'Lamed, R.' 4 primary 'Frolow, F.' 5 # _cell.entry_id 4B96 _cell.length_a 135.212 _cell.length_b 135.212 _cell.length_c 54.323 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4B96 _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CELLULOSE BINDING DOMAIN-CONTAINING PROTEIN' 18018.988 1 ? ? 'RESIDUES 333-480' ? 2 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 water nat water 18.015 170 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SHMILKLKHYNEQQSLYSKAIRWDFVIENTGNSYIDLRNVKVRYYFKDDYKNINFAVYFYSLGDEKNDVKGKVYNIRQSD SSHKYLEVTFEKGSIPPGDAAWVFGAITRDDWTEFNQEDDWSFLQGNSTFSYWDKMTVYISDKLVWGIEPY ; _entity_poly.pdbx_seq_one_letter_code_can ;SHMILKLKHYNEQQSLYSKAIRWDFVIENTGNSYIDLRNVKVRYYFKDDYKNINFAVYFYSLGDEKNDVKGKVYNIRQSD SSHKYLEVTFEKGSIPPGDAAWVFGAITRDDWTEFNQEDDWSFLQGNSTFSYWDKMTVYISDKLVWGIEPY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 HIS n 1 3 MET n 1 4 ILE n 1 5 LEU n 1 6 LYS n 1 7 LEU n 1 8 LYS n 1 9 HIS n 1 10 TYR n 1 11 ASN n 1 12 GLU n 1 13 GLN n 1 14 GLN n 1 15 SER n 1 16 LEU n 1 17 TYR n 1 18 SER n 1 19 LYS n 1 20 ALA n 1 21 ILE n 1 22 ARG n 1 23 TRP n 1 24 ASP n 1 25 PHE n 1 26 VAL n 1 27 ILE n 1 28 GLU n 1 29 ASN n 1 30 THR n 1 31 GLY n 1 32 ASN n 1 33 SER n 1 34 TYR n 1 35 ILE n 1 36 ASP n 1 37 LEU n 1 38 ARG n 1 39 ASN n 1 40 VAL n 1 41 LYS n 1 42 VAL n 1 43 ARG n 1 44 TYR n 1 45 TYR n 1 46 PHE n 1 47 LYS n 1 48 ASP n 1 49 ASP n 1 50 TYR n 1 51 LYS n 1 52 ASN n 1 53 ILE n 1 54 ASN n 1 55 PHE n 1 56 ALA n 1 57 VAL n 1 58 TYR n 1 59 PHE n 1 60 TYR n 1 61 SER n 1 62 LEU n 1 63 GLY n 1 64 ASP n 1 65 GLU n 1 66 LYS n 1 67 ASN n 1 68 ASP n 1 69 VAL n 1 70 LYS n 1 71 GLY n 1 72 LYS n 1 73 VAL n 1 74 TYR n 1 75 ASN n 1 76 ILE n 1 77 ARG n 1 78 GLN n 1 79 SER n 1 80 ASP n 1 81 SER n 1 82 SER n 1 83 HIS n 1 84 LYS n 1 85 TYR n 1 86 LEU n 1 87 GLU n 1 88 VAL n 1 89 THR n 1 90 PHE n 1 91 GLU n 1 92 LYS n 1 93 GLY n 1 94 SER n 1 95 ILE n 1 96 PRO n 1 97 PRO n 1 98 GLY n 1 99 ASP n 1 100 ALA n 1 101 ALA n 1 102 TRP n 1 103 VAL n 1 104 PHE n 1 105 GLY n 1 106 ALA n 1 107 ILE n 1 108 THR n 1 109 ARG n 1 110 ASP n 1 111 ASP n 1 112 TRP n 1 113 THR n 1 114 GLU n 1 115 PHE n 1 116 ASN n 1 117 GLN n 1 118 GLU n 1 119 ASP n 1 120 ASP n 1 121 TRP n 1 122 SER n 1 123 PHE n 1 124 LEU n 1 125 GLN n 1 126 GLY n 1 127 ASN n 1 128 SER n 1 129 THR n 1 130 PHE n 1 131 SER n 1 132 TYR n 1 133 TRP n 1 134 ASP n 1 135 LYS n 1 136 MET n 1 137 THR n 1 138 VAL n 1 139 TYR n 1 140 ILE n 1 141 SER n 1 142 ASP n 1 143 LYS n 1 144 LEU n 1 145 VAL n 1 146 TRP n 1 147 GLY n 1 148 ILE n 1 149 GLU n 1 150 PRO n 1 151 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'CLOSTRIDIUM CLARIFLAVUM' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 288965 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant RIL _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET28A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'GERMAN COLLECTION OF MICROORGANISMS (DSM) 19732' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G8LST1_CLOCD _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession G8LST1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4B96 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G8LST1 _struct_ref_seq.db_align_beg 333 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 480 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 151 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4B96 SER A 1 ? UNP G8LST1 ? ? 'expression tag' 1 1 1 4B96 HIS A 2 ? UNP G8LST1 ? ? 'expression tag' 2 2 1 4B96 MET A 3 ? UNP G8LST1 ? ? 'expression tag' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4B96 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_percent_sol 41.7 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '2.0 M NACL, 0.1 M NA ACETATE PH 4.6' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2012-05-17 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'LIQUID NITROGEN COOLED CHANNEL-CUT SILICON MONOCHROMATOR' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97625 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_wavelength 0.97625 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4B96 _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 1.91 _reflns.number_obs 23184 _reflns.number_all ? _reflns.percent_possible_obs 98.8 _reflns.pdbx_Rmerge_I_obs 0.12 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.80 _reflns.B_iso_Wilson_estimate 22.39 _reflns.pdbx_redundancy 4.68 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.91 _reflns_shell.d_res_low 1.94 _reflns_shell.percent_possible_all 98.8 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 1.70 _reflns_shell.pdbx_redundancy 4.6 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4B96 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 20626 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 49.278 _refine.ls_d_res_high 1.911 _refine.ls_percent_reflns_obs 47.92 _refine.ls_R_factor_obs 0.1546 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1528 _refine.ls_R_factor_R_free 0.1889 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 1051 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 30.277 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.69 _refine.solvent_model_param_bsol 378 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'CLOSTRIDIUM THERMOCELLUM 0404 CBM3B' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.13 _refine.pdbx_overall_phase_error 17.61 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1279 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 170 _refine_hist.number_atoms_total 1453 _refine_hist.d_res_high 1.911 _refine_hist.d_res_low 49.278 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.019 ? ? 1361 'X-RAY DIFFRACTION' ? f_angle_d 1.667 ? ? 1851 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 13.853 ? ? 489 'X-RAY DIFFRACTION' ? f_chiral_restr 0.149 ? ? 183 'X-RAY DIFFRACTION' ? f_plane_restr 0.008 ? ? 239 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.9115 1.9985 1189 0.1990 23.00 0.2250 . . 70 . . 'X-RAY DIFFRACTION' . 1.9985 2.1038 2142 0.1831 42.00 0.2209 . . 106 . . 'X-RAY DIFFRACTION' . 2.1038 2.2356 2496 0.1698 49.00 0.2145 . . 139 . . 'X-RAY DIFFRACTION' . 2.2356 2.4083 2613 0.1738 51.00 0.1951 . . 162 . . 'X-RAY DIFFRACTION' . 2.4083 2.6506 2718 0.1644 53.00 0.2187 . . 124 . . 'X-RAY DIFFRACTION' . 2.6506 3.0341 2726 0.1585 54.00 0.2223 . . 166 . . 'X-RAY DIFFRACTION' . 3.0341 3.8224 2755 0.1328 54.00 0.1785 . . 155 . . 'X-RAY DIFFRACTION' . 3.8224 49.2948 2936 0.1422 57.00 0.1510 . . 129 . . # _struct.entry_id 4B96 _struct.title 'Family 3b carbohydrate-binding module from the biomass sensoring system of Clostridium clariflavum' _struct.pdbx_descriptor 'CELLULOSE BINDING DOMAIN-CONTAINING PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4B96 _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' _struct_keywords.text 'SUGAR BINDING PROTEIN, CARBOHYDRATE BINDING PROTEIN SYSTEM, CELLULOSE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 64 ? ASP A 68 ? ASP A 64 ASP A 68 1 ? 5 HELX_P HELX_P2 2 GLU A 118 ? ASP A 120 ? GLU A 118 ASP A 120 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? E CA . CA ? ? ? 1_555 A ASP 120 OD1 ? ? A CA 1155 A ASP 120 1_555 ? ? ? ? ? ? ? 2.461 ? metalc2 metalc ? ? E CA . CA ? ? ? 1_555 A ASN 116 O ? ? A CA 1155 A ASN 116 1_555 ? ? ? ? ? ? ? 2.239 ? metalc3 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 1155 A HOH 2076 1_555 ? ? ? ? ? ? ? 2.486 ? metalc4 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 1155 A HOH 2077 1_555 ? ? ? ? ? ? ? 2.600 ? metalc5 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 1155 A HOH 2078 1_555 ? ? ? ? ? ? ? 2.369 ? metalc6 metalc ? ? E CA . CA ? ? ? 1_555 A ASP 119 OD1 ? ? A CA 1155 A ASP 119 1_555 ? ? ? ? ? ? ? 2.450 ? metalc7 metalc ? ? E CA . CA ? ? ? 1_555 A LYS 47 O ? ? A CA 1155 A LYS 47 1_555 ? ? ? ? ? ? ? 2.247 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 79 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 79 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ASP _struct_mon_prot_cis.pdbx_label_seq_id_2 80 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ASP _struct_mon_prot_cis.pdbx_auth_seq_id_2 80 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.43 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 2 ? AB ? 2 ? AC ? 5 ? AD ? 5 ? AE ? 2 ? AF ? 2 ? AG ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AB 1 2 ? anti-parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel AC 3 4 ? anti-parallel AC 4 5 ? anti-parallel AD 1 2 ? anti-parallel AD 2 3 ? anti-parallel AD 3 4 ? anti-parallel AD 4 5 ? parallel AE 1 2 ? anti-parallel AF 1 2 ? anti-parallel AG 1 2 ? anti-parallel AG 2 3 ? anti-parallel AG 3 4 ? anti-parallel AG 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ALA A 20 ? ARG A 22 ? ALA A 20 ARG A 22 AA 2 ALA A 100 ? ARG A 109 ? ALA A 100 ARG A 109 AB 1 ILE A 53 ? TYR A 60 ? ILE A 53 TYR A 60 AB 2 ALA A 100 ? ARG A 109 ? ALA A 100 ARG A 109 AC 1 SER A 131 ? TYR A 132 ? SER A 131 TYR A 132 AC 2 LEU A 5 ? HIS A 9 ? LEU A 5 HIS A 9 AC 3 PHE A 25 ? ASN A 29 ? PHE A 25 ASN A 29 AC 4 ALA A 100 ? ARG A 109 ? ALA A 100 ARG A 109 AC 5 ILE A 53 ? TYR A 60 ? ILE A 53 TYR A 60 AD 1 SER A 131 ? TYR A 132 ? SER A 131 TYR A 132 AD 2 LEU A 5 ? HIS A 9 ? LEU A 5 HIS A 9 AD 3 PHE A 25 ? ASN A 29 ? PHE A 25 ASN A 29 AD 4 ALA A 100 ? ARG A 109 ? ALA A 100 ARG A 109 AD 5 ALA A 20 ? ARG A 22 ? ALA A 20 ARG A 22 AE 1 TYR A 17 ? SER A 18 ? TYR A 17 SER A 18 AE 2 PHE A 115 ? ASN A 116 ? PHE A 115 ASN A 116 AF 1 ILE A 35 ? ASP A 36 ? ILE A 35 ASP A 36 AF 2 SER A 94 ? ILE A 95 ? SER A 94 ILE A 95 AG 1 VAL A 69 ? ASN A 75 ? VAL A 69 ASN A 75 AG 2 HIS A 83 ? PHE A 90 ? HIS A 83 PHE A 90 AG 3 VAL A 40 ? LYS A 47 ? VAL A 40 LYS A 47 AG 4 MET A 136 ? ILE A 140 ? MET A 136 ILE A 140 AG 5 LYS A 143 ? TRP A 146 ? LYS A 143 TRP A 146 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 21 ? N ILE A 21 O ILE A 107 ? O ILE A 107 AB 1 2 N TYR A 58 ? N TYR A 58 O PHE A 104 ? O PHE A 104 AC 1 2 N SER A 131 ? N SER A 131 O HIS A 9 ? O HIS A 9 AC 2 3 N LYS A 8 ? N LYS A 8 O VAL A 26 ? O VAL A 26 AC 3 4 N ILE A 27 ? N ILE A 27 O ALA A 101 ? O ALA A 101 AC 4 5 N THR A 108 ? N THR A 108 O ASN A 54 ? O ASN A 54 AD 1 2 N SER A 131 ? N SER A 131 O HIS A 9 ? O HIS A 9 AD 2 3 N LYS A 8 ? N LYS A 8 O VAL A 26 ? O VAL A 26 AD 3 4 N ILE A 27 ? N ILE A 27 O ALA A 101 ? O ALA A 101 AD 4 5 N ILE A 107 ? N ILE A 107 O ILE A 21 ? O ILE A 21 AE 1 2 N SER A 18 ? N SER A 18 O PHE A 115 ? O PHE A 115 AF 1 2 N ILE A 35 ? N ILE A 35 O ILE A 95 ? O ILE A 95 AG 1 2 N TYR A 74 ? N TYR A 74 O TYR A 85 ? O TYR A 85 AG 2 3 N VAL A 88 ? N VAL A 88 O VAL A 42 ? O VAL A 42 AG 3 4 N ARG A 43 ? N ARG A 43 O THR A 137 ? O THR A 137 AG 4 5 N ILE A 140 ? N ILE A 140 O LYS A 143 ? O LYS A 143 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 1152' AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 1153' AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 1154' AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA A 1155' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HIS A 2 ? HIS A 2 . ? 11_655 ? 2 AC1 3 MET A 3 ? MET A 3 . ? 11_655 ? 3 AC1 3 LYS A 135 ? LYS A 135 . ? 1_555 ? 4 AC2 2 SER A 131 ? SER A 131 . ? 1_555 ? 5 AC2 2 TYR A 132 ? TYR A 132 . ? 1_555 ? 6 AC3 3 LEU A 144 ? LEU A 144 . ? 1_555 ? 7 AC3 3 GLU A 149 ? GLU A 149 . ? 11_655 ? 8 AC3 3 PRO A 150 ? PRO A 150 . ? 11_655 ? 9 AC4 7 LYS A 47 ? LYS A 47 . ? 1_555 ? 10 AC4 7 ASN A 116 ? ASN A 116 . ? 1_555 ? 11 AC4 7 ASP A 119 ? ASP A 119 . ? 1_555 ? 12 AC4 7 ASP A 120 ? ASP A 120 . ? 1_555 ? 13 AC4 7 HOH F . ? HOH A 2076 . ? 1_555 ? 14 AC4 7 HOH F . ? HOH A 2077 . ? 1_555 ? 15 AC4 7 HOH F . ? HOH A 2078 . ? 1_555 ? # _database_PDB_matrix.entry_id 4B96 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4B96 _atom_sites.fract_transf_matrix[1][1] 0.007396 _atom_sites.fract_transf_matrix[1][2] 0.004270 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008540 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018408 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 TRP 102 102 102 TRP TRP A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 TRP 112 112 112 TRP TRP A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 TRP 121 121 121 TRP TRP A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 TRP 133 133 133 TRP TRP A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 TRP 146 146 146 TRP TRP A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 TYR 151 151 151 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 1152 1152 CL CL A . C 2 CL 1 1153 1153 CL CL A . D 2 CL 1 1154 1154 CL CL A . E 3 CA 1 1155 1155 CA CA A . F 4 HOH 1 2001 2001 HOH HOH A . F 4 HOH 2 2002 2002 HOH HOH A . F 4 HOH 3 2003 2003 HOH HOH A . F 4 HOH 4 2004 2004 HOH HOH A . F 4 HOH 5 2005 2005 HOH HOH A . F 4 HOH 6 2006 2006 HOH HOH A . F 4 HOH 7 2007 2007 HOH HOH A . F 4 HOH 8 2008 2008 HOH HOH A . F 4 HOH 9 2009 2009 HOH HOH A . F 4 HOH 10 2010 2010 HOH HOH A . F 4 HOH 11 2011 2011 HOH HOH A . F 4 HOH 12 2012 2012 HOH HOH A . F 4 HOH 13 2013 2013 HOH HOH A . F 4 HOH 14 2014 2014 HOH HOH A . F 4 HOH 15 2015 2015 HOH HOH A . F 4 HOH 16 2016 2016 HOH HOH A . F 4 HOH 17 2017 2017 HOH HOH A . F 4 HOH 18 2018 2018 HOH HOH A . F 4 HOH 19 2019 2019 HOH HOH A . F 4 HOH 20 2020 2020 HOH HOH A . F 4 HOH 21 2021 2021 HOH HOH A . F 4 HOH 22 2022 2022 HOH HOH A . F 4 HOH 23 2023 2023 HOH HOH A . F 4 HOH 24 2024 2024 HOH HOH A . F 4 HOH 25 2025 2025 HOH HOH A . F 4 HOH 26 2026 2026 HOH HOH A . F 4 HOH 27 2027 2027 HOH HOH A . F 4 HOH 28 2028 2028 HOH HOH A . F 4 HOH 29 2029 2029 HOH HOH A . F 4 HOH 30 2030 2030 HOH HOH A . F 4 HOH 31 2031 2031 HOH HOH A . F 4 HOH 32 2032 2032 HOH HOH A . F 4 HOH 33 2033 2033 HOH HOH A . F 4 HOH 34 2034 2034 HOH HOH A . F 4 HOH 35 2035 2035 HOH HOH A . F 4 HOH 36 2036 2036 HOH HOH A . F 4 HOH 37 2037 2037 HOH HOH A . F 4 HOH 38 2038 2038 HOH HOH A . F 4 HOH 39 2039 2039 HOH HOH A . F 4 HOH 40 2040 2040 HOH HOH A . F 4 HOH 41 2041 2041 HOH HOH A . F 4 HOH 42 2042 2042 HOH HOH A . F 4 HOH 43 2043 2043 HOH HOH A . F 4 HOH 44 2044 2044 HOH HOH A . F 4 HOH 45 2045 2045 HOH HOH A . F 4 HOH 46 2046 2046 HOH HOH A . F 4 HOH 47 2047 2047 HOH HOH A . F 4 HOH 48 2048 2048 HOH HOH A . F 4 HOH 49 2049 2049 HOH HOH A . F 4 HOH 50 2050 2050 HOH HOH A . F 4 HOH 51 2051 2051 HOH HOH A . F 4 HOH 52 2052 2052 HOH HOH A . F 4 HOH 53 2053 2053 HOH HOH A . F 4 HOH 54 2054 2054 HOH HOH A . F 4 HOH 55 2055 2055 HOH HOH A . F 4 HOH 56 2056 2056 HOH HOH A . F 4 HOH 57 2057 2057 HOH HOH A . F 4 HOH 58 2058 2058 HOH HOH A . F 4 HOH 59 2059 2059 HOH HOH A . F 4 HOH 60 2060 2060 HOH HOH A . F 4 HOH 61 2061 2061 HOH HOH A . F 4 HOH 62 2062 2062 HOH HOH A . F 4 HOH 63 2063 2063 HOH HOH A . F 4 HOH 64 2064 2064 HOH HOH A . F 4 HOH 65 2065 2065 HOH HOH A . F 4 HOH 66 2066 2066 HOH HOH A . F 4 HOH 67 2067 2067 HOH HOH A . F 4 HOH 68 2068 2068 HOH HOH A . F 4 HOH 69 2069 2069 HOH HOH A . F 4 HOH 70 2070 2070 HOH HOH A . F 4 HOH 71 2071 2071 HOH HOH A . F 4 HOH 72 2072 2072 HOH HOH A . F 4 HOH 73 2073 2073 HOH HOH A . F 4 HOH 74 2074 2074 HOH HOH A . F 4 HOH 75 2075 2075 HOH HOH A . F 4 HOH 76 2076 2076 HOH HOH A . F 4 HOH 77 2077 2077 HOH HOH A . F 4 HOH 78 2078 2078 HOH HOH A . F 4 HOH 79 2079 2079 HOH HOH A . F 4 HOH 80 2080 2080 HOH HOH A . F 4 HOH 81 2081 2081 HOH HOH A . F 4 HOH 82 2082 2082 HOH HOH A . F 4 HOH 83 2083 2083 HOH HOH A . F 4 HOH 84 2084 2084 HOH HOH A . F 4 HOH 85 2085 2085 HOH HOH A . F 4 HOH 86 2086 2086 HOH HOH A . F 4 HOH 87 2087 2087 HOH HOH A . F 4 HOH 88 2088 2088 HOH HOH A . F 4 HOH 89 2089 2089 HOH HOH A . F 4 HOH 90 2090 2090 HOH HOH A . F 4 HOH 91 2091 2091 HOH HOH A . F 4 HOH 92 2092 2092 HOH HOH A . F 4 HOH 93 2093 2093 HOH HOH A . F 4 HOH 94 2094 2094 HOH HOH A . F 4 HOH 95 2095 2095 HOH HOH A . F 4 HOH 96 2096 2096 HOH HOH A . F 4 HOH 97 2097 2097 HOH HOH A . F 4 HOH 98 2098 2098 HOH HOH A . F 4 HOH 99 2099 2099 HOH HOH A . F 4 HOH 100 2100 2100 HOH HOH A . F 4 HOH 101 2101 2101 HOH HOH A . F 4 HOH 102 2102 2102 HOH HOH A . F 4 HOH 103 2103 2103 HOH HOH A . F 4 HOH 104 2104 2104 HOH HOH A . F 4 HOH 105 2105 2105 HOH HOH A . F 4 HOH 106 2106 2106 HOH HOH A . F 4 HOH 107 2107 2107 HOH HOH A . F 4 HOH 108 2108 2108 HOH HOH A . F 4 HOH 109 2109 2109 HOH HOH A . F 4 HOH 110 2110 2110 HOH HOH A . F 4 HOH 111 2111 2111 HOH HOH A . F 4 HOH 112 2112 2112 HOH HOH A . F 4 HOH 113 2113 2113 HOH HOH A . F 4 HOH 114 2114 2114 HOH HOH A . F 4 HOH 115 2115 2115 HOH HOH A . F 4 HOH 116 2116 2116 HOH HOH A . F 4 HOH 117 2117 2117 HOH HOH A . F 4 HOH 118 2118 2118 HOH HOH A . F 4 HOH 119 2119 2119 HOH HOH A . F 4 HOH 120 2120 2120 HOH HOH A . F 4 HOH 121 2121 2121 HOH HOH A . F 4 HOH 122 2122 2122 HOH HOH A . F 4 HOH 123 2123 2123 HOH HOH A . F 4 HOH 124 2124 2124 HOH HOH A . F 4 HOH 125 2125 2125 HOH HOH A . F 4 HOH 126 2126 2126 HOH HOH A . F 4 HOH 127 2127 2127 HOH HOH A . F 4 HOH 128 2128 2128 HOH HOH A . F 4 HOH 129 2129 2129 HOH HOH A . F 4 HOH 130 2130 2130 HOH HOH A . F 4 HOH 131 2131 2131 HOH HOH A . F 4 HOH 132 2132 2132 HOH HOH A . F 4 HOH 133 2133 2133 HOH HOH A . F 4 HOH 134 2134 2134 HOH HOH A . F 4 HOH 135 2135 2135 HOH HOH A . F 4 HOH 136 2136 2136 HOH HOH A . F 4 HOH 137 2137 2137 HOH HOH A . F 4 HOH 138 2138 2138 HOH HOH A . F 4 HOH 139 2139 2139 HOH HOH A . F 4 HOH 140 2140 2140 HOH HOH A . F 4 HOH 141 2141 2141 HOH HOH A . F 4 HOH 142 2142 2142 HOH HOH A . F 4 HOH 143 2143 2143 HOH HOH A . F 4 HOH 144 2144 2144 HOH HOH A . F 4 HOH 145 2145 2145 HOH HOH A . F 4 HOH 146 2146 2146 HOH HOH A . F 4 HOH 147 2147 2147 HOH HOH A . F 4 HOH 148 2148 2148 HOH HOH A . F 4 HOH 149 2149 2149 HOH HOH A . F 4 HOH 150 2150 2150 HOH HOH A . F 4 HOH 151 2151 2151 HOH HOH A . F 4 HOH 152 2152 2152 HOH HOH A . F 4 HOH 153 2153 2153 HOH HOH A . F 4 HOH 154 2154 2154 HOH HOH A . F 4 HOH 155 2155 2155 HOH HOH A . F 4 HOH 156 2156 2156 HOH HOH A . F 4 HOH 157 2157 2157 HOH HOH A . F 4 HOH 158 2158 2158 HOH HOH A . F 4 HOH 159 2159 2159 HOH HOH A . F 4 HOH 160 2160 2160 HOH HOH A . F 4 HOH 161 2161 2161 HOH HOH A . F 4 HOH 162 2162 2162 HOH HOH A . F 4 HOH 163 2163 2163 HOH HOH A . F 4 HOH 164 2164 2164 HOH HOH A . F 4 HOH 165 2165 2165 HOH HOH A . F 4 HOH 166 2166 2166 HOH HOH A . F 4 HOH 167 2167 2167 HOH HOH A . F 4 HOH 168 2168 2168 HOH HOH A . F 4 HOH 169 2169 2169 HOH HOH A . F 4 HOH 170 2170 2170 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2730 ? 1 MORE -100.3 ? 1 'SSA (A^2)' 14330 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_655 -x+y+1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 135.2120000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 27.1615000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2068 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 120 ? A ASP 120 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? A ASN 116 ? A ASN 116 ? 1_555 102.0 ? 2 OD1 ? A ASP 120 ? A ASP 120 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? F HOH . ? A HOH 2076 ? 1_555 144.5 ? 3 O ? A ASN 116 ? A ASN 116 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? F HOH . ? A HOH 2076 ? 1_555 82.2 ? 4 OD1 ? A ASP 120 ? A ASP 120 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? F HOH . ? A HOH 2077 ? 1_555 138.6 ? 5 O ? A ASN 116 ? A ASN 116 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? F HOH . ? A HOH 2077 ? 1_555 97.9 ? 6 O ? F HOH . ? A HOH 2076 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? F HOH . ? A HOH 2077 ? 1_555 73.9 ? 7 OD1 ? A ASP 120 ? A ASP 120 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? F HOH . ? A HOH 2078 ? 1_555 71.7 ? 8 O ? A ASN 116 ? A ASN 116 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? F HOH . ? A HOH 2078 ? 1_555 90.4 ? 9 O ? F HOH . ? A HOH 2076 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? F HOH . ? A HOH 2078 ? 1_555 73.0 ? 10 O ? F HOH . ? A HOH 2077 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? F HOH . ? A HOH 2078 ? 1_555 144.3 ? 11 OD1 ? A ASP 120 ? A ASP 120 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 OD1 ? A ASP 119 ? A ASP 119 ? 1_555 78.4 ? 12 O ? A ASN 116 ? A ASN 116 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 OD1 ? A ASP 119 ? A ASP 119 ? 1_555 80.6 ? 13 O ? F HOH . ? A HOH 2076 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 OD1 ? A ASP 119 ? A ASP 119 ? 1_555 136.6 ? 14 O ? F HOH . ? A HOH 2077 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 OD1 ? A ASP 119 ? A ASP 119 ? 1_555 69.5 ? 15 O ? F HOH . ? A HOH 2078 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 OD1 ? A ASP 119 ? A ASP 119 ? 1_555 146.2 ? 16 OD1 ? A ASP 120 ? A ASP 120 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? A LYS 47 ? A LYS 47 ? 1_555 87.3 ? 17 O ? A ASN 116 ? A ASN 116 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? A LYS 47 ? A LYS 47 ? 1_555 169.4 ? 18 O ? F HOH . ? A HOH 2076 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? A LYS 47 ? A LYS 47 ? 1_555 87.3 ? 19 O ? F HOH . ? A HOH 2077 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? A LYS 47 ? A LYS 47 ? 1_555 77.9 ? 20 O ? F HOH . ? A HOH 2078 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? A LYS 47 ? A LYS 47 ? 1_555 87.7 ? 21 OD1 ? A ASP 119 ? A ASP 119 ? 1_555 CA ? E CA . ? A CA 1155 ? 1_555 O ? A LYS 47 ? A LYS 47 ? 1_555 106.6 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-09-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 65.0019 53.9790 5.2808 0.1625 0.2430 0.1974 -0.0238 -0.0041 -0.0241 3.5243 4.7663 2.2954 -3.4652 0.3881 -0.1877 -0.2103 -0.2462 -0.7549 0.0650 0.1168 0.4694 -0.0293 -0.5353 0.0445 'X-RAY DIFFRACTION' 2 ? refined 88.8460 49.6955 8.3476 0.1824 0.2351 0.2653 0.0291 -0.0160 -0.0350 9.4573 6.1856 7.2309 1.6649 2.2944 -1.1058 -0.0027 -0.1824 -0.9089 0.0212 0.1313 -0.5347 0.2172 0.0040 -0.0762 'X-RAY DIFFRACTION' 3 ? refined 77.5756 58.5048 -0.0595 0.1424 0.1225 0.1175 -0.0010 -0.0059 0.0054 2.7124 1.7430 1.8137 0.1584 0.1293 0.1654 -0.0268 0.2320 0.0580 -0.2120 0.0478 0.0576 -0.0746 -0.0324 0.0118 'X-RAY DIFFRACTION' 4 ? refined 81.9304 64.3831 -4.0539 0.2629 0.2300 0.1747 0.0345 0.0374 0.0330 2.9176 0.9428 4.7743 0.1378 -0.4361 -2.0356 -0.0490 0.4889 0.1783 -0.8130 0.2442 -0.2350 -0.7952 0.4590 -0.2576 'X-RAY DIFFRACTION' 5 ? refined 78.9790 61.6249 2.3274 0.1529 0.1452 0.1405 -0.0206 0.0111 -0.0045 3.0829 2.4548 1.9728 0.5009 0.5718 -0.1442 0.0071 0.0773 0.2563 -0.1189 0.0075 0.0358 -0.1682 -0.0775 0.0878 'X-RAY DIFFRACTION' 6 ? refined 96.6654 58.8393 5.8370 0.1934 0.2761 0.2750 -0.0616 -0.0075 -0.0227 3.4761 9.2247 5.4396 4.6617 -4.0592 -6.7913 -0.1918 0.1842 -0.0812 -0.5359 0.3475 -0.2628 0.5376 -0.1568 0.0617 'X-RAY DIFFRACTION' 7 ? refined 75.5631 56.4408 10.7585 0.0952 0.1129 0.0958 -0.0354 0.0107 0.0154 3.5808 1.7383 3.3263 -0.3345 0.3845 0.2987 0.0345 -0.1620 0.0091 0.0485 -0.0314 -0.0740 0.1525 0.0421 0.0035 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 1 THROUGH 9 )' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 10 THROUGH 19 )' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 20 THROUGH 64 )' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 65 THROUGH 75 )' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 76 THROUGH 109 )' 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 110 THROUGH 116 )' 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 117 THROUGH 151 )' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(PHENIX.REFINE)' ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 PHASER phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 2089 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 2090 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 2156 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 2158 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 11_655 _pdbx_validate_symm_contact.dist 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 78 ? ? -68.98 94.77 2 1 SER A 79 ? ? 92.94 122.48 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 'CALCIUM ION' CA 4 water HOH #