data_4B9J # _entry.id 4B9J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4B9J PDBE EBI-53978 WWPDB D_1290053978 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 4B9G unspecified ;STRUCTURE OF CSSB SUBUNIT COMPLEMENTED WITH DONOR STRAND FROM CSSA SUBUNIT OF ENTEROTOXIGENIC ESCHERICHIA COLI COLONIZATION FACTOR CS6 ; PDB 4B9I unspecified ;STRUCTURE OF CSSA SUBUNIT COMPLEMENTED WITH DONOR STRAND FROM CSSB SUBUNIT OF ENTEROTOXIGENIC ESCHERICHIA COLI COLONIZATION FACTOR CS6 ; # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4B9J _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2012-09-04 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Roy, S.P.' 1 'Rahman, M.M.' 2 'Yu, X.D.' 3 'Tuittila, M.' 4 'Knight, S.D.' 5 'Zavialov, A.V.' 6 # _citation.id primary _citation.title 'Crystal Structure of Enterotoxigenic Escherichia Coli Colonization Factor Cs6 Reveals a Novel Type of Functional Assembly.' _citation.journal_abbrev Mol.Microbiol. _citation.journal_volume 86 _citation.page_first 1100 _citation.page_last ? _citation.year 2012 _citation.journal_id_ASTM MOMIEE _citation.country UK _citation.journal_id_ISSN 0950-382X _citation.journal_id_CSD 2007 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23046340 _citation.pdbx_database_id_DOI 10.1111/MMI.12044 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Roy, S.P.' 1 primary 'Rahman, M.M.' 2 primary 'Yu, X.D.' 3 primary 'Tuittila, M.' 4 primary 'Knight, S.D.' 5 primary 'Zavialov, A.V.' 6 # _cell.entry_id 4B9J _cell.length_a 42.998 _cell.length_b 48.954 _cell.length_c 56.955 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4B9J _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CS6 FIMBRIAL SUBUNIT A' 16643.484 1 ? ? ? 'LINKER SEQUENCE DNKQ' 2 water nat water 18.015 28 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CS6 PILIN, CSSADSA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;RTEPVSTTISKSFFAPEPQIQPSFGKNVGKEGGLLFSVSLTVPENVSQVTVYPVYDEDYGLGRLVNTADDSQSIIYQIVD DKGRKMLKDHGAEVTPNQQITFRALNYTSGDKEIPPGIYNDQVMVGYYVNDNKQRTEIATKNFPVSTTIS ; _entity_poly.pdbx_seq_one_letter_code_can ;RTEPVSTTISKSFFAPEPQIQPSFGKNVGKEGGLLFSVSLTVPENVSQVTVYPVYDEDYGLGRLVNTADDSQSIIYQIVD DKGRKMLKDHGAEVTPNQQITFRALNYTSGDKEIPPGIYNDQVMVGYYVNDNKQRTEIATKNFPVSTTIS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 THR n 1 3 GLU n 1 4 PRO n 1 5 VAL n 1 6 SER n 1 7 THR n 1 8 THR n 1 9 ILE n 1 10 SER n 1 11 LYS n 1 12 SER n 1 13 PHE n 1 14 PHE n 1 15 ALA n 1 16 PRO n 1 17 GLU n 1 18 PRO n 1 19 GLN n 1 20 ILE n 1 21 GLN n 1 22 PRO n 1 23 SER n 1 24 PHE n 1 25 GLY n 1 26 LYS n 1 27 ASN n 1 28 VAL n 1 29 GLY n 1 30 LYS n 1 31 GLU n 1 32 GLY n 1 33 GLY n 1 34 LEU n 1 35 LEU n 1 36 PHE n 1 37 SER n 1 38 VAL n 1 39 SER n 1 40 LEU n 1 41 THR n 1 42 VAL n 1 43 PRO n 1 44 GLU n 1 45 ASN n 1 46 VAL n 1 47 SER n 1 48 GLN n 1 49 VAL n 1 50 THR n 1 51 VAL n 1 52 TYR n 1 53 PRO n 1 54 VAL n 1 55 TYR n 1 56 ASP n 1 57 GLU n 1 58 ASP n 1 59 TYR n 1 60 GLY n 1 61 LEU n 1 62 GLY n 1 63 ARG n 1 64 LEU n 1 65 VAL n 1 66 ASN n 1 67 THR n 1 68 ALA n 1 69 ASP n 1 70 ASP n 1 71 SER n 1 72 GLN n 1 73 SER n 1 74 ILE n 1 75 ILE n 1 76 TYR n 1 77 GLN n 1 78 ILE n 1 79 VAL n 1 80 ASP n 1 81 ASP n 1 82 LYS n 1 83 GLY n 1 84 ARG n 1 85 LYS n 1 86 MET n 1 87 LEU n 1 88 LYS n 1 89 ASP n 1 90 HIS n 1 91 GLY n 1 92 ALA n 1 93 GLU n 1 94 VAL n 1 95 THR n 1 96 PRO n 1 97 ASN n 1 98 GLN n 1 99 GLN n 1 100 ILE n 1 101 THR n 1 102 PHE n 1 103 ARG n 1 104 ALA n 1 105 LEU n 1 106 ASN n 1 107 TYR n 1 108 THR n 1 109 SER n 1 110 GLY n 1 111 ASP n 1 112 LYS n 1 113 GLU n 1 114 ILE n 1 115 PRO n 1 116 PRO n 1 117 GLY n 1 118 ILE n 1 119 TYR n 1 120 ASN n 1 121 ASP n 1 122 GLN n 1 123 VAL n 1 124 MET n 1 125 VAL n 1 126 GLY n 1 127 TYR n 1 128 TYR n 1 129 VAL n 1 130 ASN n 1 131 ASP n 1 132 ASN n 1 133 LYS n 1 134 GLN n 1 135 ARG n 1 136 THR n 1 137 GLU n 1 138 ILE n 1 139 ALA n 1 140 THR n 1 141 LYS n 1 142 ASN n 1 143 PHE n 1 144 PRO n 1 145 VAL n 1 146 SER n 1 147 THR n 1 148 THR n 1 149 ILE n 1 150 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'O167\:H5 / E10703 / EIEC' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-CSSADSB _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CSSA1_ECOLX _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P53508 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4B9J A 4 ? 130 ? P53508 28 ? 154 ? 4 130 2 1 4B9J A 135 ? 150 ? P53508 19 ? 34 ? 135 174 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4B9J ARG A 1 ? UNP P53508 ? ? 'expression tag' 1 1 1 4B9J THR A 2 ? UNP P53508 ? ? 'expression tag' 2 2 1 4B9J GLU A 3 ? UNP P53508 ? ? 'expression tag' 3 3 1 4B9J ASP A 131 ? UNP P53508 ? ? linker 131 4 1 4B9J ASN A 132 ? UNP P53508 ? ? linker 132 5 1 4B9J LYS A 133 ? UNP P53508 ? ? linker 133 6 1 4B9J GLN A 134 ? UNP P53508 ? ? linker 134 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4B9J _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.78 _exptl_crystal.density_percent_sol 31 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '24-30 % PEG4000 IN 0.2 M AMMONIUM ACETATE, 0.1 M NA ACETATE, PH 4.6' # _diffrn.id 1 _diffrn.ambient_temp 287 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2011-02-24 _diffrn_detector.details 'BAND PASS 1.9X10-4 FOR A SI(111) MONOCHROMATOR' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111) MONOCHROMATOR' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.93340 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_wavelength 0.93340 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4B9J _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 43.00 _reflns.d_resolution_high 2.54 _reflns.number_obs 4190 _reflns.number_all ? _reflns.percent_possible_obs 98.8 _reflns.pdbx_Rmerge_I_obs 0.03 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 33.90 _reflns.B_iso_Wilson_estimate 37.719 _reflns.pdbx_redundancy 3.2 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.54 _reflns_shell.d_res_low 2.68 _reflns_shell.percent_possible_all 98.3 _reflns_shell.Rmerge_I_obs 0.07 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 16.80 _reflns_shell.pdbx_redundancy 3.2 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4B9J _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 4124 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 37.125 _refine.ls_d_res_high 2.542 _refine.ls_percent_reflns_obs 96.92 _refine.ls_R_factor_obs 0.2078 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2046 _refine.ls_R_factor_R_free 0.2771 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.6 _refine.ls_number_reflns_R_free 191 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] 0.7955 _refine.aniso_B[2][2] -5.3967 _refine.aniso_B[3][3] 4.6012 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.355 _refine.solvent_model_param_bsol 32.603 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.95 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 4B9I' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.27 _refine.pdbx_overall_phase_error 27.10 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 949 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 977 _refine_hist.d_res_high 2.542 _refine_hist.d_res_low 37.125 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.005 ? ? 967 'X-RAY DIFFRACTION' ? f_angle_d 0.834 ? ? 1316 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.625 ? ? 352 'X-RAY DIFFRACTION' ? f_chiral_restr 0.052 ? ? 152 'X-RAY DIFFRACTION' ? f_plane_restr 0.003 ? ? 171 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 2.5423 _refine_ls_shell.d_res_low 37.1289 _refine_ls_shell.number_reflns_R_work 3933 _refine_ls_shell.R_factor_R_work 0.2046 _refine_ls_shell.percent_reflns_obs 97.00 _refine_ls_shell.R_factor_R_free 0.2771 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 191 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 4B9J _struct.title 'Structure of self-complemented CssA subunit of enterotoxigenic Escherichia coli colonization factor CS6' _struct.pdbx_descriptor 'CS6 FIMBRIAL SUBUNIT A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4B9J _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'CELL ADHESION, DIARRHEAL DISEASE, FIMBRIAE, FUSION PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 57 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 59 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 57 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 59 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 7 ? AB ? 8 ? AC ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AA 6 7 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AB 4 5 ? anti-parallel AB 5 6 ? anti-parallel AB 6 7 ? parallel AB 7 8 ? anti-parallel AC 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLN A 19 ? PRO A 22 ? GLN A 19 PRO A 22 AA 2 LEU A 34 ? THR A 41 ? LEU A 34 THR A 41 AA 3 GLN A 99 ? ASN A 106 ? GLN A 99 ASN A 106 AA 4 ASP A 69 ? VAL A 79 ? ASP A 69 VAL A 79 AA 5 LEU A 61 ? ASN A 66 ? LEU A 61 ASN A 66 AA 6 GLY A 117 ? TYR A 128 ? GLY A 117 TYR A 128 AA 7 ILE A 138 ? ILE A 149 ? ILE A 162 ILE A 173 AB 1 GLN A 19 ? PRO A 22 ? GLN A 19 PRO A 22 AB 2 LEU A 34 ? THR A 41 ? LEU A 34 THR A 41 AB 3 GLN A 99 ? ASN A 106 ? GLN A 99 ASN A 106 AB 4 ASP A 69 ? VAL A 79 ? ASP A 69 VAL A 79 AB 5 LEU A 61 ? ASN A 66 ? LEU A 61 ASN A 66 AB 6 GLY A 117 ? TYR A 128 ? GLY A 117 TYR A 128 AB 7 GLN A 48 ? PRO A 53 ? GLN A 48 PRO A 53 AB 8 ALA A 92 ? GLU A 93 ? ALA A 92 GLU A 93 AC 1 ILE A 138 ? ILE A 149 ? ILE A 162 ILE A 173 AC 2 GLY A 117 ? TYR A 128 ? GLY A 117 TYR A 128 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N GLN A 21 ? N GLN A 21 O SER A 37 ? O SER A 37 AA 2 3 N LEU A 40 ? N LEU A 40 O ILE A 100 ? O ILE A 100 AA 3 4 N LEU A 105 ? N LEU A 105 O GLN A 77 ? O GLN A 77 AA 4 5 N TYR A 76 ? N TYR A 76 O GLY A 62 ? O GLY A 62 AA 5 6 N VAL A 65 ? N VAL A 65 O ASN A 120 ? O ASN A 120 AA 6 7 N TYR A 127 ? N TYR A 127 O ALA A 139 ? O ALA A 163 AB 1 2 N GLN A 21 ? N GLN A 21 O SER A 37 ? O SER A 37 AB 2 3 N LEU A 40 ? N LEU A 40 O ILE A 100 ? O ILE A 100 AB 3 4 N LEU A 105 ? N LEU A 105 O GLN A 77 ? O GLN A 77 AB 4 5 N TYR A 76 ? N TYR A 76 O GLY A 62 ? O GLY A 62 AB 5 6 N VAL A 65 ? N VAL A 65 O ASN A 120 ? O ASN A 120 AB 6 7 N TYR A 128 ? N TYR A 128 O GLN A 48 ? O GLN A 48 AB 7 8 N VAL A 49 ? N VAL A 49 O ALA A 92 ? O ALA A 92 AC 1 2 N ILE A 149 ? N ILE A 173 O GLY A 117 ? O GLY A 117 # _database_PDB_matrix.entry_id 4B9J _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4B9J _atom_sites.fract_transf_matrix[1][1] 0.023257 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020427 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017558 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 VAL 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 THR 8 8 ? ? ? A . n A 1 9 ILE 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 LYS 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 PHE 13 13 ? ? ? A . n A 1 14 PHE 14 14 ? ? ? A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 GLY 25 25 ? ? ? A . n A 1 26 LYS 26 26 ? ? ? A . n A 1 27 ASN 27 27 ? ? ? A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ASP 111 111 ? ? ? A . n A 1 112 LYS 112 112 ? ? ? A . n A 1 113 GLU 113 113 ? ? ? A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 MET 124 124 124 MET MET A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 ASN 130 130 ? ? ? A . n A 1 131 ASP 131 131 ? ? ? A . n A 1 132 ASN 132 132 ? ? ? A . n A 1 133 LYS 133 133 ? ? ? A . n A 1 134 GLN 134 134 ? ? ? A . n A 1 135 ARG 135 135 ? ? ? A . n A 1 136 THR 136 136 ? ? ? A . n A 1 137 GLU 137 161 161 GLU GLU A . n A 1 138 ILE 138 162 162 ILE ILE A . n A 1 139 ALA 139 163 163 ALA ALA A . n A 1 140 THR 140 164 164 THR THR A . n A 1 141 LYS 141 165 165 LYS LYS A . n A 1 142 ASN 142 166 166 ASN ASN A . n A 1 143 PHE 143 167 167 PHE PHE A . n A 1 144 PRO 144 168 168 PRO PRO A . n A 1 145 VAL 145 169 169 VAL VAL A . n A 1 146 SER 146 170 170 SER SER A . n A 1 147 THR 147 171 171 THR THR A . n A 1 148 THR 148 172 172 THR THR A . n A 1 149 ILE 149 173 173 ILE ILE A . n A 1 150 SER 150 174 174 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 2001 2001 HOH HOH A . B 2 HOH 2 2002 2002 HOH HOH A . B 2 HOH 3 2003 2003 HOH HOH A . B 2 HOH 4 2004 2004 HOH HOH A . B 2 HOH 5 2005 2005 HOH HOH A . B 2 HOH 6 2006 2006 HOH HOH A . B 2 HOH 7 2007 2007 HOH HOH A . B 2 HOH 8 2008 2008 HOH HOH A . B 2 HOH 9 2009 2009 HOH HOH A . B 2 HOH 10 2010 2010 HOH HOH A . B 2 HOH 11 2011 2011 HOH HOH A . B 2 HOH 12 2012 2012 HOH HOH A . B 2 HOH 13 2013 2013 HOH HOH A . B 2 HOH 14 2014 2014 HOH HOH A . B 2 HOH 15 2015 2015 HOH HOH A . B 2 HOH 16 2016 2016 HOH HOH A . B 2 HOH 17 2017 2017 HOH HOH A . B 2 HOH 18 2018 2018 HOH HOH A . B 2 HOH 19 2019 2019 HOH HOH A . B 2 HOH 20 2020 2020 HOH HOH A . B 2 HOH 21 2021 2021 HOH HOH A . B 2 HOH 22 2022 2022 HOH HOH A . B 2 HOH 23 2023 2023 HOH HOH A . B 2 HOH 24 2024 2024 HOH HOH A . B 2 HOH 25 2025 2025 HOH HOH A . B 2 HOH 26 2026 2026 HOH HOH A . B 2 HOH 27 2027 2027 HOH HOH A . B 2 HOH 28 2028 2028 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2013 ? B HOH . 2 1 A HOH 2025 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-11-07 2 'Structure model' 1 1 2012-12-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(PHENIX.REFINE)' ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 MOLREP phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OG1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 THR _pdbx_validate_close_contact.auth_seq_id_1 171 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 2006 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 69 ? ? -160.30 106.08 2 1 ASN A 97 ? ? 74.18 -1.90 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 161 ? CG ? A GLU 137 CG 2 1 Y 1 A GLU 161 ? CD ? A GLU 137 CD 3 1 Y 1 A GLU 161 ? OE1 ? A GLU 137 OE1 4 1 Y 1 A GLU 161 ? OE2 ? A GLU 137 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 1 ? A ARG 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A VAL 5 ? A VAL 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A THR 8 ? A THR 8 9 1 Y 1 A ILE 9 ? A ILE 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A LYS 11 ? A LYS 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A PHE 13 ? A PHE 13 14 1 Y 1 A PHE 14 ? A PHE 14 15 1 Y 1 A GLY 25 ? A GLY 25 16 1 Y 1 A LYS 26 ? A LYS 26 17 1 Y 1 A ASN 27 ? A ASN 27 18 1 Y 1 A ASP 111 ? A ASP 111 19 1 Y 1 A LYS 112 ? A LYS 112 20 1 Y 1 A GLU 113 ? A GLU 113 21 1 Y 1 A ASN 130 ? A ASN 130 22 1 Y 1 A ASP 131 ? A ASP 131 23 1 Y 1 A ASN 132 ? A ASN 132 24 1 Y 1 A LYS 133 ? A LYS 133 25 1 Y 1 A GLN 134 ? A GLN 134 26 1 Y 1 A ARG 135 ? A ARG 135 27 1 Y 1 A THR 136 ? A THR 136 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #