data_4BK8 # _entry.id 4BK8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4BK8 PDBE EBI-46402 WWPDB D_1290046402 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4BK8 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2013-04-22 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Romao, C.V.' 1 'Matias, P.M.' 2 'Pinho, F.G.' 3 'Sousa, C.M.' 4 'Barradas, A.R.' 5 'Pinto, A.F.' 6 'Teixeira, M.' 7 'Bandeiras, T.M.' 8 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of a Natural Sor Mutant' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'Cloning, Purification, Crystallization and X-Ray Crystallographic Analysis of Ignicoccus Hospitalis Neelaredoxin.' 'Acta Crystallogr.,Sect.F' 66 605 ? 2010 ? DK 1744-3091 ? ? 20445270 10.1107/S1744309110012030 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Pinho, F.G.' 1 primary 'Romao, C.V.' 2 primary 'Pinto, A.F.' 3 primary 'Matias, P.M.' 4 primary 'Teixeira, M.' 5 primary 'Bandeiras, T.M.' 6 1 'Pinho, F.G.' 7 1 'Romao, C.V.' 8 1 'Pinto, A.F.' 9 1 'Saraiva, L.M.' 10 1 'Huber, H.' 11 1 'Matias, P.M.' 12 1 'Teixeira, M.' 13 1 'Bandeiras, T.M.' 14 # _cell.entry_id 4BK8 _cell.length_a 108.995 _cell.length_b 108.995 _cell.length_c 61.430 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4BK8 _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DESULFOFERRODOXIN, FERROUS IRON-BINDING REGION' 14113.092 1 ? ? ? ? 2 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 3 water nat water 18.015 102 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SUPEROXIDE REDUCTASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKSFGELIYTPDRAEGEAISKAETHTPKIEAPEKVKADQPFQVRVSVGPHPNEAAHSIRWIELYFYEEGRPFNPVMLGRV AFEPGYAEPDVTFTLKLKKSGVLYAISYCNLHGLWEARKEIKVE ; _entity_poly.pdbx_seq_one_letter_code_can ;MKSFGELIYTPDRAEGEAISKAETHTPKIEAPEKVKADQPFQVRVSVGPHPNEAAHSIRWIELYFYEEGRPFNPVMLGRV AFEPGYAEPDVTFTLKLKKSGVLYAISYCNLHGLWEARKEIKVE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 SER n 1 4 PHE n 1 5 GLY n 1 6 GLU n 1 7 LEU n 1 8 ILE n 1 9 TYR n 1 10 THR n 1 11 PRO n 1 12 ASP n 1 13 ARG n 1 14 ALA n 1 15 GLU n 1 16 GLY n 1 17 GLU n 1 18 ALA n 1 19 ILE n 1 20 SER n 1 21 LYS n 1 22 ALA n 1 23 GLU n 1 24 THR n 1 25 HIS n 1 26 THR n 1 27 PRO n 1 28 LYS n 1 29 ILE n 1 30 GLU n 1 31 ALA n 1 32 PRO n 1 33 GLU n 1 34 LYS n 1 35 VAL n 1 36 LYS n 1 37 ALA n 1 38 ASP n 1 39 GLN n 1 40 PRO n 1 41 PHE n 1 42 GLN n 1 43 VAL n 1 44 ARG n 1 45 VAL n 1 46 SER n 1 47 VAL n 1 48 GLY n 1 49 PRO n 1 50 HIS n 1 51 PRO n 1 52 ASN n 1 53 GLU n 1 54 ALA n 1 55 ALA n 1 56 HIS n 1 57 SER n 1 58 ILE n 1 59 ARG n 1 60 TRP n 1 61 ILE n 1 62 GLU n 1 63 LEU n 1 64 TYR n 1 65 PHE n 1 66 TYR n 1 67 GLU n 1 68 GLU n 1 69 GLY n 1 70 ARG n 1 71 PRO n 1 72 PHE n 1 73 ASN n 1 74 PRO n 1 75 VAL n 1 76 MET n 1 77 LEU n 1 78 GLY n 1 79 ARG n 1 80 VAL n 1 81 ALA n 1 82 PHE n 1 83 GLU n 1 84 PRO n 1 85 GLY n 1 86 TYR n 1 87 ALA n 1 88 GLU n 1 89 PRO n 1 90 ASP n 1 91 VAL n 1 92 THR n 1 93 PHE n 1 94 THR n 1 95 LEU n 1 96 LYS n 1 97 LEU n 1 98 LYS n 1 99 LYS n 1 100 SER n 1 101 GLY n 1 102 VAL n 1 103 LEU n 1 104 TYR n 1 105 ALA n 1 106 ILE n 1 107 SER n 1 108 TYR n 1 109 CYS n 1 110 ASN n 1 111 LEU n 1 112 HIS n 1 113 GLY n 1 114 LEU n 1 115 TRP n 1 116 GLU n 1 117 ALA n 1 118 ARG n 1 119 LYS n 1 120 GLU n 1 121 ILE n 1 122 LYS n 1 123 VAL n 1 124 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'IGNICOCCUS HOSPITALIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 160233 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant GOLD _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PET24A _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A8AC72_IGNH4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession A8AC72 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4BK8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A8AC72 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 124 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4BK8 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.76 _exptl_crystal.density_percent_sol 67.32 _exptl_crystal.description ;THE 3D STRUCTURE WAS SOLVED FROM A SAD DATASET MEASURED IN-HOUSE TO 2.4A AND A PRELIMINARY REFINEMENT CARRIED OUT. FOLLOWING A MOLECULAR REPLACEMENT STEP TO CORRECTLY POSITION THE RESULTING MODEL IN THE UNIT CELL OF THE CRYSTAL MEASURED AT THE ESRF, IT WAS USED IN THE FINAL REFINEMENT. ; # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '85 MM TRISHCL PH 8.5, 8.5 MM NICL2, 15%(V/V) PEG 2000 MONOMETHYL ETHER AND 15%(V/V) GLYCEROL' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2009-07-14 _diffrn_detector.details 'BENT CYLINDRICAL MIRROR' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9800 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_wavelength 0.9800 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4BK8 _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 47.20 _reflns.d_resolution_high 1.85 _reflns.number_obs 18718 _reflns.number_all ? _reflns.percent_possible_obs 98.6 _reflns.pdbx_Rmerge_I_obs 0.10 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 18.23 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 11.6 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.85 _reflns_shell.d_res_low 1.96 _reflns_shell.percent_possible_all 98.0 _reflns_shell.Rmerge_I_obs 0.92 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.14 _reflns_shell.pdbx_redundancy 11.6 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4BK8 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 18715 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.88 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 47.196 _refine.ls_d_res_high 1.847 _refine.ls_percent_reflns_obs 98.68 _refine.ls_R_factor_obs 0.1788 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1777 _refine.ls_R_factor_R_free 0.1995 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.2 _refine.ls_number_reflns_R_free 968 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PRELIMINARY MODEL FROM SAD' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.14 _refine.pdbx_overall_phase_error 22.61 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 989 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 102 _refine_hist.number_atoms_total 1092 _refine_hist.d_res_high 1.847 _refine_hist.d_res_low 47.196 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.007 ? ? 1023 'X-RAY DIFFRACTION' ? f_angle_d 1.051 ? ? 1394 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.831 ? ? 382 'X-RAY DIFFRACTION' ? f_chiral_restr 0.080 ? ? 144 'X-RAY DIFFRACTION' ? f_plane_restr 0.006 ? ? 180 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.8469 1.9443 2444 0.2886 98.00 0.2956 . . 145 . . 'X-RAY DIFFRACTION' . 1.9443 2.0661 2507 0.2306 100.00 0.2367 . . 134 . . 'X-RAY DIFFRACTION' . 2.0661 2.2256 2530 0.2060 100.00 0.2442 . . 128 . . 'X-RAY DIFFRACTION' . 2.2256 2.4496 2515 0.1816 99.00 0.2343 . . 152 . . 'X-RAY DIFFRACTION' . 2.4496 2.8040 2509 0.1832 99.00 0.2260 . . 153 . . 'X-RAY DIFFRACTION' . 2.8040 3.5326 2557 0.1674 99.00 0.1852 . . 138 . . 'X-RAY DIFFRACTION' . 3.5326 47.2116 2685 0.1596 96.00 0.1670 . . 118 . . # _struct.entry_id 4BK8 _struct.title 'Superoxide reductase (Neelaredoxin) from Ignicoccus hospitalis' _struct.pdbx_descriptor 'DESULFOFERRODOXIN, FERROUS IRON-BINDING REGION' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4BK8 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'OXIDOREDUCTASE, NEELAREDOXIN, SYMBIOSIS, OXIDATIVE STRESS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? ILE A 8 ? SER A 3 ILE A 8 1 ? 6 HELX_P HELX_P2 2 THR A 10 ? GLU A 15 ? THR A 10 GLU A 15 1 ? 6 HELX_P HELX_P3 3 GLY A 16 ? ALA A 22 ? GLY A 16 ALA A 22 5 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B FE . FE ? ? ? 1_555 A HIS 50 NE2 ? ? A FE 1125 A HIS 50 1_555 ? ? ? ? ? ? ? 2.247 ? metalc2 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 109 SG ? ? A FE 1125 A CYS 109 1_555 ? ? ? ? ? ? ? 2.365 ? metalc3 metalc ? ? B FE . FE ? ? ? 1_555 A HIS 25 NE2 ? ? A FE 1125 A HIS 25 1_555 ? ? ? ? ? ? ? 2.173 ? metalc4 metalc ? ? B FE . FE ? ? ? 1_555 A HIS 56 NE2 ? ? A FE 1125 A HIS 56 1_555 ? ? ? ? ? ? ? 2.199 ? metalc5 metalc ? ? B FE . FE ? ? ? 1_555 A GLU 23 OE2 ? ? A FE 1125 A GLU 23 1_555 ? ? ? ? ? ? ? 2.470 ? metalc6 metalc ? ? B FE . FE ? ? ? 1_555 A HIS 112 ND1 ? ? A FE 1125 A HIS 112 1_555 ? ? ? ? ? ? ? 2.198 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 48 A . ? GLY 48 A PRO 49 A ? PRO 49 A 1 2.29 2 ASN 73 A . ? ASN 73 A PRO 74 A ? PRO 74 A 1 0.02 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 3 ? AB ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AB 1 2 ? parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AB 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 LYS A 28 ? GLU A 30 ? LYS A 28 GLU A 30 AA 2 PHE A 41 ? SER A 46 ? PHE A 41 SER A 46 AA 3 ASP A 90 ? LEU A 95 ? ASP A 90 LEU A 95 AB 1 LYS A 34 ? VAL A 35 ? LYS A 34 VAL A 35 AB 2 GLY A 113 ? VAL A 123 ? GLY A 113 VAL A 123 AB 3 GLY A 101 ? CYS A 109 ? GLY A 101 CYS A 109 AB 4 ILE A 58 ? GLU A 67 ? ILE A 58 GLU A 67 AB 5 VAL A 75 ? ALA A 81 ? VAL A 75 ALA A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N GLU A 30 ? N GLU A 30 O ARG A 44 ? O ARG A 44 AA 2 3 N VAL A 45 ? N VAL A 45 O VAL A 91 ? O VAL A 91 AB 1 2 N VAL A 35 ? N VAL A 35 O LYS A 122 ? O LYS A 122 AB 2 3 N ILE A 121 ? N ILE A 121 O GLY A 101 ? O GLY A 101 AB 3 4 O TYR A 108 ? O TYR A 108 N ARG A 59 ? N ARG A 59 AB 4 5 N PHE A 65 ? N PHE A 65 O VAL A 75 ? O VAL A 75 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE FE A 1125' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 23 ? GLU A 23 . ? 1_555 ? 2 AC1 6 HIS A 25 ? HIS A 25 . ? 1_555 ? 3 AC1 6 HIS A 50 ? HIS A 50 . ? 1_555 ? 4 AC1 6 HIS A 56 ? HIS A 56 . ? 1_555 ? 5 AC1 6 CYS A 109 ? CYS A 109 . ? 1_555 ? 6 AC1 6 HIS A 112 ? HIS A 112 . ? 1_555 ? # _database_PDB_matrix.entry_id 4BK8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4BK8 _atom_sites.fract_transf_matrix[1][1] 0.009175 _atom_sites.fract_transf_matrix[1][2] 0.005297 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010594 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016279 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 GLU 124 124 124 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE 1 1125 1125 FE FE A . C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . C 3 HOH 10 2010 2010 HOH HOH A . C 3 HOH 11 2011 2011 HOH HOH A . C 3 HOH 12 2012 2012 HOH HOH A . C 3 HOH 13 2013 2013 HOH HOH A . C 3 HOH 14 2014 2014 HOH HOH A . C 3 HOH 15 2015 2015 HOH HOH A . C 3 HOH 16 2016 2016 HOH HOH A . C 3 HOH 17 2017 2017 HOH HOH A . C 3 HOH 18 2018 2018 HOH HOH A . C 3 HOH 19 2019 2019 HOH HOH A . C 3 HOH 20 2020 2020 HOH HOH A . C 3 HOH 21 2021 2021 HOH HOH A . C 3 HOH 22 2022 2022 HOH HOH A . C 3 HOH 23 2023 2023 HOH HOH A . C 3 HOH 24 2024 2024 HOH HOH A . C 3 HOH 25 2025 2025 HOH HOH A . C 3 HOH 26 2026 2026 HOH HOH A . C 3 HOH 27 2027 2027 HOH HOH A . C 3 HOH 28 2028 2028 HOH HOH A . C 3 HOH 29 2029 2029 HOH HOH A . C 3 HOH 30 2030 2030 HOH HOH A . C 3 HOH 31 2031 2031 HOH HOH A . C 3 HOH 32 2032 2032 HOH HOH A . C 3 HOH 33 2033 2033 HOH HOH A . C 3 HOH 34 2034 2034 HOH HOH A . C 3 HOH 35 2035 2035 HOH HOH A . C 3 HOH 36 2036 2036 HOH HOH A . C 3 HOH 37 2037 2037 HOH HOH A . C 3 HOH 38 2038 2038 HOH HOH A . C 3 HOH 39 2039 2039 HOH HOH A . C 3 HOH 40 2040 2040 HOH HOH A . C 3 HOH 41 2041 2041 HOH HOH A . C 3 HOH 42 2042 2042 HOH HOH A . C 3 HOH 43 2043 2043 HOH HOH A . C 3 HOH 44 2044 2044 HOH HOH A . C 3 HOH 45 2045 2045 HOH HOH A . C 3 HOH 46 2046 2046 HOH HOH A . C 3 HOH 47 2047 2047 HOH HOH A . C 3 HOH 48 2048 2048 HOH HOH A . C 3 HOH 49 2049 2049 HOH HOH A . C 3 HOH 50 2050 2050 HOH HOH A . C 3 HOH 51 2051 2051 HOH HOH A . C 3 HOH 52 2052 2052 HOH HOH A . C 3 HOH 53 2053 2053 HOH HOH A . C 3 HOH 54 2054 2054 HOH HOH A . C 3 HOH 55 2055 2055 HOH HOH A . C 3 HOH 56 2056 2056 HOH HOH A . C 3 HOH 57 2057 2057 HOH HOH A . C 3 HOH 58 2058 2058 HOH HOH A . C 3 HOH 59 2059 2059 HOH HOH A . C 3 HOH 60 2060 2060 HOH HOH A . C 3 HOH 61 2061 2061 HOH HOH A . C 3 HOH 62 2062 2062 HOH HOH A . C 3 HOH 63 2063 2063 HOH HOH A . C 3 HOH 64 2064 2064 HOH HOH A . C 3 HOH 65 2065 2065 HOH HOH A . C 3 HOH 66 2066 2066 HOH HOH A . C 3 HOH 67 2067 2067 HOH HOH A . C 3 HOH 68 2068 2068 HOH HOH A . C 3 HOH 69 2069 2069 HOH HOH A . C 3 HOH 70 2070 2070 HOH HOH A . C 3 HOH 71 2071 2071 HOH HOH A . C 3 HOH 72 2072 2072 HOH HOH A . C 3 HOH 73 2073 2073 HOH HOH A . C 3 HOH 74 2074 2074 HOH HOH A . C 3 HOH 75 2075 2075 HOH HOH A . C 3 HOH 76 2076 2076 HOH HOH A . C 3 HOH 77 2077 2077 HOH HOH A . C 3 HOH 78 2078 2078 HOH HOH A . C 3 HOH 79 2079 2079 HOH HOH A . C 3 HOH 80 2080 2080 HOH HOH A . C 3 HOH 81 2081 2081 HOH HOH A . C 3 HOH 82 2082 2082 HOH HOH A . C 3 HOH 83 2083 2083 HOH HOH A . C 3 HOH 84 2084 2084 HOH HOH A . C 3 HOH 85 2085 2085 HOH HOH A . C 3 HOH 86 2086 2086 HOH HOH A . C 3 HOH 87 2087 2087 HOH HOH A . C 3 HOH 88 2088 2088 HOH HOH A . C 3 HOH 89 2089 2089 HOH HOH A . C 3 HOH 90 2090 2090 HOH HOH A . C 3 HOH 91 2091 2091 HOH HOH A . C 3 HOH 92 2092 2092 HOH HOH A . C 3 HOH 93 2093 2093 HOH HOH A . C 3 HOH 94 2094 2094 HOH HOH A . C 3 HOH 95 2095 2095 HOH HOH A . C 3 HOH 96 2096 2096 HOH HOH A . C 3 HOH 97 2097 2097 HOH HOH A . C 3 HOH 98 2098 2098 HOH HOH A . C 3 HOH 99 2099 2099 HOH HOH A . C 3 HOH 100 2100 2100 HOH HOH A . C 3 HOH 101 2101 2101 HOH HOH A . C 3 HOH 102 2102 2102 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9400 ? 1 MORE -43.7 ? 1 'SSA (A^2)' 19940 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_455 -x+y-1,y,-z -1.0000000000 0.0000000000 0.0000000000 -108.9950000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 4_455 -x-1,-y,z -1.0000000000 0.0000000000 0.0000000000 -108.9950000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 8_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 SG ? A CYS 109 ? A CYS 109 ? 1_555 99.2 ? 2 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 87.2 ? 3 SG ? A CYS 109 ? A CYS 109 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 105.0 ? 4 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 NE2 ? A HIS 56 ? A HIS 56 ? 1_555 85.1 ? 5 SG ? A CYS 109 ? A CYS 109 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 NE2 ? A HIS 56 ? A HIS 56 ? 1_555 91.5 ? 6 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 NE2 ? A HIS 56 ? A HIS 56 ? 1_555 162.7 ? 7 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 OE2 ? A GLU 23 ? A GLU 23 ? 1_555 80.5 ? 8 SG ? A CYS 109 ? A CYS 109 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 OE2 ? A GLU 23 ? A GLU 23 ? 1_555 176.4 ? 9 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 OE2 ? A GLU 23 ? A GLU 23 ? 1_555 78.6 ? 10 NE2 ? A HIS 56 ? A HIS 56 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 OE2 ? A GLU 23 ? A GLU 23 ? 1_555 84.8 ? 11 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 ND1 ? A HIS 112 ? A HIS 112 ? 1_555 159.5 ? 12 SG ? A CYS 109 ? A CYS 109 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 ND1 ? A HIS 112 ? A HIS 112 ? 1_555 101.3 ? 13 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 ND1 ? A HIS 112 ? A HIS 112 ? 1_555 87.2 ? 14 NE2 ? A HIS 56 ? A HIS 56 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 ND1 ? A HIS 112 ? A HIS 112 ? 1_555 94.7 ? 15 OE2 ? A GLU 23 ? A GLU 23 ? 1_555 FE ? B FE . ? A FE 1125 ? 1_555 ND1 ? A HIS 112 ? A HIS 112 ? 1_555 79.1 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2014-04-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -50.2978 21.3123 3.8024 0.4613 0.3027 0.3563 -0.0455 0.0025 -0.0156 0.0036 0.0090 0.0450 0.0000 -0.0209 0.0435 0.0505 -0.0708 0.5080 -0.5365 0.0279 0.1647 0.0153 -0.2578 -0.0001 'X-RAY DIFFRACTION' 2 ? refined -46.1868 22.2383 -8.1259 0.6126 0.4068 0.5333 -0.0939 0.0491 0.0093 0.1927 0.0272 0.1069 0.0714 0.0763 0.0256 0.0135 0.5545 0.4151 -0.4601 0.2498 -0.3374 -1.3623 0.5706 0.0003 'X-RAY DIFFRACTION' 3 ? refined -42.6526 15.4010 -12.7641 0.4669 0.5031 0.4831 -0.0735 0.0540 0.0571 0.1349 0.0545 -0.0024 -0.1057 -0.0276 0.0449 -0.1726 0.3971 0.2316 -0.3702 0.2558 -0.3379 -0.5666 0.6003 -0.0004 'X-RAY DIFFRACTION' 4 ? refined -63.1849 8.4412 -20.5560 0.4584 0.4792 0.2761 0.0281 -0.0808 0.0105 0.2560 0.0637 0.4870 -0.0815 0.0493 0.2125 0.1463 0.8427 -0.1213 -0.3973 -0.1273 0.1060 -0.2135 -0.0805 -0.0007 'X-RAY DIFFRACTION' 5 ? refined -38.4177 5.8239 -9.0085 0.3763 0.3689 0.5049 0.0039 0.0084 -0.0669 0.0669 0.0283 0.0432 0.0464 0.0029 0.0248 0.3992 0.0452 -0.4091 -0.1296 0.3064 -0.3933 0.3725 0.3159 0.0007 'X-RAY DIFFRACTION' 6 ? refined -61.0067 12.5752 -5.8120 0.3824 0.2829 0.3632 0.0474 -0.0306 0.0030 0.1279 0.3403 0.5177 0.2175 -0.1758 -0.0682 0.0045 0.2906 0.2569 -0.0382 -0.0331 -0.0272 -0.1602 -0.1251 -0.0000 'X-RAY DIFFRACTION' 7 ? refined -49.8262 1.5538 -7.8358 0.3467 0.3073 0.3513 0.0041 -0.0091 0.0220 0.2039 0.4676 0.1998 0.3155 0.1028 0.2358 -0.0417 -0.0746 0.0565 0.1607 -0.0848 -0.1293 -0.1354 0.1056 0.0000 'X-RAY DIFFRACTION' 8 ? refined -59.0455 9.3413 -11.9237 0.3473 0.3070 0.2959 0.0276 -0.0178 0.0238 0.0001 0.6542 0.3841 -0.0903 -0.0543 0.0955 -0.1021 0.0673 0.0039 -0.1255 0.0820 -0.0299 -0.2273 0.0570 0.0000 'X-RAY DIFFRACTION' 9 ? refined -54.1292 15.4585 -11.2044 0.3974 0.2778 0.4095 0.0135 -0.0190 0.0594 0.4129 0.4941 0.6759 -0.0031 -0.4459 0.4565 0.0059 -0.2822 0.4184 -0.1151 0.0070 -0.0484 -0.2035 -0.2802 -0.0004 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 2 THROUGH 7 )' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 8 THROUGH 16 )' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 17 THROUGH 30 )' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 31 THROUGH 46 )' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 47 THROUGH 57 )' 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 58 THROUGH 74 )' 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 75 THROUGH 89 )' 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 90 THROUGH 109 )' 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 110 THROUGH 124 )' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(PHENIX.REFINE: 1.8.1_1168)' ? 1 XDS 'data reduction' . ? 2 XSCALE 'data scaling' . ? 3 PHASER phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 83 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 2075 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.12 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 56 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -166.29 _pdbx_validate_torsion.psi 110.42 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (III) ION' FE 3 water HOH #