data_4BKG # _entry.id 4BKG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.294 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4BKG PDBE EBI-56542 WWPDB D_1290056542 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4BKG _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2013-04-25 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Keusekotten, K.' 1 'Bade, V.N.' 2 'Meyer-Teschendorf, K.' 3 'Sriramachandran, A.' 4 'Fischer-Schrader, K.' 5 'Krause, A.' 6 'Horst, C.' 7 'Hofmann, K.' 8 'Dohmen, R.J.' 9 'Praefcke, G.J.K.' 10 # _citation.id primary _citation.title ;Multivalent Interactions of the Sumo-Interaction Motifs in the Ring-Finger Protein 4 (Rnf4) Determine the Specificity for Chains of the Small Ubiquitin-Related Modifier (Sumo). ; _citation.journal_abbrev Biochem.J. _citation.journal_volume 457 _citation.page_first 207 _citation.page_last ? _citation.year 2014 _citation.journal_id_ASTM BIJOAK _citation.country UK _citation.journal_id_ISSN 0264-6021 _citation.journal_id_CSD 0043 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24151981 _citation.pdbx_database_id_DOI 10.1042/BJ20130753 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Keusekotten, K.' 1 primary 'Bade, V.N.' 2 primary 'Meyer-Teschendorf, K.' 3 primary 'Sriramachandran, A.M.' 4 primary 'Fischer-Schrader, K.' 5 primary 'Krause, A.' 6 primary 'Horst, C.' 7 primary 'Schwarz, G.' 8 primary 'Hofmann, K.' 9 primary 'Dohmen, R.J.' 10 primary 'Praefcke, G.J.' 11 # _cell.entry_id 4BKG _cell.length_a 74.988 _cell.length_b 74.988 _cell.length_c 33.267 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 9 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4BKG _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SMALL UBIQUITIN-RELATED MODIFIER 2' 19185.377 1 ? ? 'SUMO-2DELTAN11, RESIDUES 12-93' ;LINEAR FUSION-PROTEIN OF 2 SUMO2-DELTAN11 FRAGMENTS, WHICH ARE PRESENT IN DIFFERENT ASU, RELATED VIA A CRYSTALLOGRAPHIC SYMMETRY AXIS ; 2 water nat water 18.015 27 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SUMO-2, HSMT3, SMT3 HOMOLOG 2, SUMO-3, SENTRIN-2, SMT3A, UBIQUITIN-LIKE PROTEIN SMT3A, SMALL UBIQUITIN-LIKE MODIFER 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQ QTGGRSTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTID VFQQQTGG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQ QTGGRSTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTID VFQQQTGG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 THR n 1 4 GLU n 1 5 ASN n 1 6 ASN n 1 7 ASP n 1 8 HIS n 1 9 ILE n 1 10 ASN n 1 11 LEU n 1 12 LYS n 1 13 VAL n 1 14 ALA n 1 15 GLY n 1 16 GLN n 1 17 ASP n 1 18 GLY n 1 19 SER n 1 20 VAL n 1 21 VAL n 1 22 GLN n 1 23 PHE n 1 24 LYS n 1 25 ILE n 1 26 LYS n 1 27 ARG n 1 28 HIS n 1 29 THR n 1 30 PRO n 1 31 LEU n 1 32 SER n 1 33 LYS n 1 34 LEU n 1 35 MET n 1 36 LYS n 1 37 ALA n 1 38 TYR n 1 39 CYS n 1 40 GLU n 1 41 ARG n 1 42 GLN n 1 43 GLY n 1 44 LEU n 1 45 SER n 1 46 MET n 1 47 ARG n 1 48 GLN n 1 49 ILE n 1 50 ARG n 1 51 PHE n 1 52 ARG n 1 53 PHE n 1 54 ASP n 1 55 GLY n 1 56 GLN n 1 57 PRO n 1 58 ILE n 1 59 ASN n 1 60 GLU n 1 61 THR n 1 62 ASP n 1 63 THR n 1 64 PRO n 1 65 ALA n 1 66 GLN n 1 67 LEU n 1 68 GLU n 1 69 MET n 1 70 GLU n 1 71 ASP n 1 72 GLU n 1 73 ASP n 1 74 THR n 1 75 ILE n 1 76 ASP n 1 77 VAL n 1 78 PHE n 1 79 GLN n 1 80 GLN n 1 81 GLN n 1 82 THR n 1 83 GLY n 1 84 GLY n 1 85 ARG n 1 86 SER n 1 87 THR n 1 88 GLU n 1 89 ASN n 1 90 ASN n 1 91 ASP n 1 92 HIS n 1 93 ILE n 1 94 ASN n 1 95 LEU n 1 96 LYS n 1 97 VAL n 1 98 ALA n 1 99 GLY n 1 100 GLN n 1 101 ASP n 1 102 GLY n 1 103 SER n 1 104 VAL n 1 105 VAL n 1 106 GLN n 1 107 PHE n 1 108 LYS n 1 109 ILE n 1 110 LYS n 1 111 ARG n 1 112 HIS n 1 113 THR n 1 114 PRO n 1 115 LEU n 1 116 SER n 1 117 LYS n 1 118 LEU n 1 119 MET n 1 120 LYS n 1 121 ALA n 1 122 TYR n 1 123 CYS n 1 124 GLU n 1 125 ARG n 1 126 GLN n 1 127 GLY n 1 128 LEU n 1 129 SER n 1 130 MET n 1 131 ARG n 1 132 GLN n 1 133 ILE n 1 134 ARG n 1 135 PHE n 1 136 ARG n 1 137 PHE n 1 138 ASP n 1 139 GLY n 1 140 GLN n 1 141 PRO n 1 142 ILE n 1 143 ASN n 1 144 GLU n 1 145 THR n 1 146 ASP n 1 147 THR n 1 148 PRO n 1 149 ALA n 1 150 GLN n 1 151 LEU n 1 152 GLU n 1 153 MET n 1 154 GLU n 1 155 ASP n 1 156 GLU n 1 157 ASP n 1 158 THR n 1 159 ILE n 1 160 ASP n 1 161 VAL n 1 162 PHE n 1 163 GLN n 1 164 GLN n 1 165 GLN n 1 166 THR n 1 167 GLY n 1 168 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX-4T2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SUMO2_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P61956 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4BKG A 3 ? 84 ? P61956 12 ? 93 ? 12 93 2 1 4BKG A 87 ? 168 ? P61956 12 ? 93 ? 96 177 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4BKG GLY A 1 ? UNP P61956 ? ? 'expression tag' 10 1 1 4BKG SER A 2 ? UNP P61956 ? ? 'expression tag' 11 2 1 4BKG ARG A 85 ? UNP P61956 ? ? linker 94 3 1 4BKG SER A 86 ? UNP P61956 ? ? linker 95 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4BKG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.89 _exptl_crystal.density_percent_sol 34.91 _exptl_crystal.description NONE _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.1 M TRIS/HCL PH 8.0, 28% PEG 350MME,0.05% DIOXANE' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'OXFORD DIFFRACTION' _diffrn_detector.pdbx_collection_date 2013-01-24 _diffrn_detector.details NOVA # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5406 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'SEALED TUBE' _diffrn_source.type 'OXFORD DIFFRACTION NOVA' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5406 _diffrn_source.pdbx_wavelength_list 1.5406 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4BKG _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 23.24 _reflns.d_resolution_high 2.10 _reflns.number_obs 3842 _reflns.number_all ? _reflns.percent_possible_obs 94.8 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.50 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.8 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.17 _reflns_shell.percent_possible_all 73.9 _reflns_shell.Rmerge_I_obs 0.44 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 1.90 _reflns_shell.pdbx_redundancy 1.4 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4BKG _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 3668 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.76 _refine.ls_d_res_high 2.11 _refine.ls_percent_reflns_obs 94.79 _refine.ls_R_factor_obs 0.18092 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.17872 _refine.ls_R_factor_R_free 0.23074 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.5 _refine.ls_number_reflns_R_free 171 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.951 _refine.correlation_coeff_Fo_to_Fc_free 0.918 _refine.B_iso_mean 27.678 _refine.aniso_B[1][1] -0.39 _refine.aniso_B[2][2] -0.39 _refine.aniso_B[3][3] 1.28 _refine.aniso_B[1][2] -0.39 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. RESIDUES 17-89 MAKE UP THE CONTENT OF THE ASU. RESIDUES 101-173 ARE IDENTICAL TO RESIDUES 17-89, AND SEGMENTED INTO DIFFERENT ASU VIA A CRYSTALLOGRAPHIC SYMMETRY AXIS. THE GAP OF APPROX. 14 A BETWEEN THE C-TERMINUS OF A MOLECULE IN A ASU TO THE N-TERMINUS OF A SYMMETRY-RELATED MOLECULE IN THE ADJACENT ASU CAN BE FILLED BY 11 RESIDUES FROM THE LINKER (90-100) WHICH ARE DELOCALIZED. THE TERMINAL RESIDUES 10-16 AND 174-177 ARE FLEXIBLE AND NOT OBSERVED IN THE CRYSTAL STRUCTURE. ; _refine.pdbx_starting_model 'PDB ENTRY 1WM3' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.287 _refine.pdbx_overall_ESU_R_Free 0.208 _refine.overall_SU_ML 0.140 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 5.426 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 585 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 612 _refine_hist.d_res_high 2.11 _refine_hist.d_res_low 19.76 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.019 0.019 ? 612 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 588 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.879 1.957 ? 824 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.917 3.000 ? 1357 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.814 5.000 ? 76 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 36.978 25.312 ? 32 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 18.805 15.000 ? 118 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 25.625 15.000 ? 4 'X-RAY DIFFRACTION' ? r_chiral_restr 0.104 0.200 ? 89 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.009 0.021 ? 706 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.002 0.020 ? 143 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.106 _refine_ls_shell.d_res_low 2.160 _refine_ls_shell.number_reflns_R_work 217 _refine_ls_shell.R_factor_R_work 0.244 _refine_ls_shell.percent_reflns_obs 72.73 _refine_ls_shell.R_factor_R_free 0.195 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 7 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 4BKG _struct.title 'crystal structure of human diSUMO-2' _struct.pdbx_descriptor 'SMALL UBIQUITIN-RELATED MODIFIER 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4BKG _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ;THE PROTEIN CHAIN IS SEGMENTED INTO DIFFERENT ASUS VIA A CRYSTALLOGRAPHIC SYMMETRY AXIS. THUS THE DIMERIC ASSEMBLY IS ACTUALLY A MONOMER IN WHICH THE HALVES ARE RELATED BY SYMMETRY AND LINKED VIA AN UNOBSERVED LINKER ; # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 31 ? GLY A 43 ? LEU A 40 GLY A 52 1 ? 13 HELX_P HELX_P2 2 SER A 45 ? ARG A 47 ? SER A 54 ARG A 56 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 VAL A 20 ? ILE A 25 ? VAL A 29 ILE A 34 AA 2 ILE A 9 ? ALA A 14 ? ILE A 18 ALA A 23 AA 3 ASP A 73 ? GLN A 79 ? ASP A 82 GLN A 88 AA 4 ILE A 49 ? PHE A 53 ? ILE A 58 PHE A 62 AA 5 GLN A 56 ? PRO A 57 ? GLN A 65 PRO A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 25 ? N ILE A 34 O ILE A 9 ? O ILE A 18 AA 2 3 N LYS A 12 ? N LYS A 21 O ASP A 73 ? O ASP A 82 AA 3 4 N PHE A 78 ? N PHE A 87 O ARG A 50 ? O ARG A 59 AA 4 5 N PHE A 53 ? N PHE A 62 O GLN A 56 ? O GLN A 65 # _database_PDB_matrix.entry_id 4BKG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4BKG _atom_sites.fract_transf_matrix[1][1] 0.013335 _atom_sites.fract_transf_matrix[1][2] 0.007699 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015398 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.030060 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 10 ? ? ? A . n A 1 2 SER 2 11 ? ? ? A . n A 1 3 THR 3 12 ? ? ? A . n A 1 4 GLU 4 13 ? ? ? A . n A 1 5 ASN 5 14 ? ? ? A . n A 1 6 ASN 6 15 ? ? ? A . n A 1 7 ASP 7 16 ? ? ? A . n A 1 8 HIS 8 17 17 HIS HIS A . n A 1 9 ILE 9 18 18 ILE ILE A . n A 1 10 ASN 10 19 19 ASN ASN A . n A 1 11 LEU 11 20 20 LEU LEU A . n A 1 12 LYS 12 21 21 LYS LYS A . n A 1 13 VAL 13 22 22 VAL VAL A . n A 1 14 ALA 14 23 23 ALA ALA A . n A 1 15 GLY 15 24 24 GLY GLY A . n A 1 16 GLN 16 25 25 GLN GLN A . n A 1 17 ASP 17 26 26 ASP ASP A . n A 1 18 GLY 18 27 27 GLY GLY A . n A 1 19 SER 19 28 28 SER SER A . n A 1 20 VAL 20 29 29 VAL VAL A . n A 1 21 VAL 21 30 30 VAL VAL A . n A 1 22 GLN 22 31 31 GLN GLN A . n A 1 23 PHE 23 32 32 PHE PHE A . n A 1 24 LYS 24 33 33 LYS LYS A . n A 1 25 ILE 25 34 34 ILE ILE A . n A 1 26 LYS 26 35 35 LYS LYS A . n A 1 27 ARG 27 36 36 ARG ARG A . n A 1 28 HIS 28 37 37 HIS HIS A . n A 1 29 THR 29 38 38 THR THR A . n A 1 30 PRO 30 39 39 PRO PRO A . n A 1 31 LEU 31 40 40 LEU LEU A . n A 1 32 SER 32 41 41 SER SER A . n A 1 33 LYS 33 42 42 LYS LYS A . n A 1 34 LEU 34 43 43 LEU LEU A . n A 1 35 MET 35 44 44 MET MET A . n A 1 36 LYS 36 45 45 LYS LYS A . n A 1 37 ALA 37 46 46 ALA ALA A . n A 1 38 TYR 38 47 47 TYR TYR A . n A 1 39 CYS 39 48 48 CYS CYS A . n A 1 40 GLU 40 49 49 GLU GLU A . n A 1 41 ARG 41 50 50 ARG ARG A . n A 1 42 GLN 42 51 51 GLN GLN A . n A 1 43 GLY 43 52 52 GLY GLY A . n A 1 44 LEU 44 53 53 LEU LEU A . n A 1 45 SER 45 54 54 SER SER A . n A 1 46 MET 46 55 55 MET MET A . n A 1 47 ARG 47 56 56 ARG ARG A . n A 1 48 GLN 48 57 57 GLN GLN A . n A 1 49 ILE 49 58 58 ILE ILE A . n A 1 50 ARG 50 59 59 ARG ARG A . n A 1 51 PHE 51 60 60 PHE PHE A . n A 1 52 ARG 52 61 61 ARG ARG A . n A 1 53 PHE 53 62 62 PHE PHE A . n A 1 54 ASP 54 63 63 ASP ASP A . n A 1 55 GLY 55 64 64 GLY GLY A . n A 1 56 GLN 56 65 65 GLN GLN A . n A 1 57 PRO 57 66 66 PRO PRO A . n A 1 58 ILE 58 67 67 ILE ILE A . n A 1 59 ASN 59 68 68 ASN ASN A . n A 1 60 GLU 60 69 69 GLU GLU A . n A 1 61 THR 61 70 70 THR THR A . n A 1 62 ASP 62 71 71 ASP ASP A . n A 1 63 THR 63 72 72 THR THR A . n A 1 64 PRO 64 73 73 PRO PRO A . n A 1 65 ALA 65 74 74 ALA ALA A . n A 1 66 GLN 66 75 75 GLN GLN A . n A 1 67 LEU 67 76 76 LEU LEU A . n A 1 68 GLU 68 77 77 GLU GLU A . n A 1 69 MET 69 78 78 MET MET A . n A 1 70 GLU 70 79 79 GLU GLU A . n A 1 71 ASP 71 80 80 ASP ASP A . n A 1 72 GLU 72 81 81 GLU GLU A . n A 1 73 ASP 73 82 82 ASP ASP A . n A 1 74 THR 74 83 83 THR THR A . n A 1 75 ILE 75 84 84 ILE ILE A . n A 1 76 ASP 76 85 85 ASP ASP A . n A 1 77 VAL 77 86 86 VAL VAL A . n A 1 78 PHE 78 87 87 PHE PHE A . n A 1 79 GLN 79 88 88 GLN GLN A . n A 1 80 GLN 80 89 89 GLN GLN A . n A 1 81 GLN 81 90 ? ? ? A . n A 1 82 THR 82 91 ? ? ? A . n A 1 83 GLY 83 92 ? ? ? A . n A 1 84 GLY 84 93 ? ? ? A . n A 1 85 ARG 85 94 ? ? ? A . n A 1 86 SER 86 95 ? ? ? A . n A 1 87 THR 87 96 ? ? ? A . n A 1 88 GLU 88 97 ? ? ? A . n A 1 89 ASN 89 98 ? ? ? A . n A 1 90 ASN 90 99 ? ? ? A . n A 1 91 ASP 91 100 ? ? ? A . n A 1 92 HIS 92 101 ? ? ? A . n A 1 93 ILE 93 102 ? ? ? A . n A 1 94 ASN 94 103 ? ? ? A . n A 1 95 LEU 95 104 ? ? ? A . n A 1 96 LYS 96 105 ? ? ? A . n A 1 97 VAL 97 106 ? ? ? A . n A 1 98 ALA 98 107 ? ? ? A . n A 1 99 GLY 99 108 ? ? ? A . n A 1 100 GLN 100 109 ? ? ? A . n A 1 101 ASP 101 110 ? ? ? A . n A 1 102 GLY 102 111 ? ? ? A . n A 1 103 SER 103 112 ? ? ? A . n A 1 104 VAL 104 113 ? ? ? A . n A 1 105 VAL 105 114 ? ? ? A . n A 1 106 GLN 106 115 ? ? ? A . n A 1 107 PHE 107 116 ? ? ? A . n A 1 108 LYS 108 117 ? ? ? A . n A 1 109 ILE 109 118 ? ? ? A . n A 1 110 LYS 110 119 ? ? ? A . n A 1 111 ARG 111 120 ? ? ? A . n A 1 112 HIS 112 121 ? ? ? A . n A 1 113 THR 113 122 ? ? ? A . n A 1 114 PRO 114 123 ? ? ? A . n A 1 115 LEU 115 124 ? ? ? A . n A 1 116 SER 116 125 ? ? ? A . n A 1 117 LYS 117 126 ? ? ? A . n A 1 118 LEU 118 127 ? ? ? A . n A 1 119 MET 119 128 ? ? ? A . n A 1 120 LYS 120 129 ? ? ? A . n A 1 121 ALA 121 130 ? ? ? A . n A 1 122 TYR 122 131 ? ? ? A . n A 1 123 CYS 123 132 ? ? ? A . n A 1 124 GLU 124 133 ? ? ? A . n A 1 125 ARG 125 134 ? ? ? A . n A 1 126 GLN 126 135 ? ? ? A . n A 1 127 GLY 127 136 ? ? ? A . n A 1 128 LEU 128 137 ? ? ? A . n A 1 129 SER 129 138 ? ? ? A . n A 1 130 MET 130 139 ? ? ? A . n A 1 131 ARG 131 140 ? ? ? A . n A 1 132 GLN 132 141 ? ? ? A . n A 1 133 ILE 133 142 ? ? ? A . n A 1 134 ARG 134 143 ? ? ? A . n A 1 135 PHE 135 144 ? ? ? A . n A 1 136 ARG 136 145 ? ? ? A . n A 1 137 PHE 137 146 ? ? ? A . n A 1 138 ASP 138 147 ? ? ? A . n A 1 139 GLY 139 148 ? ? ? A . n A 1 140 GLN 140 149 ? ? ? A . n A 1 141 PRO 141 150 ? ? ? A . n A 1 142 ILE 142 151 ? ? ? A . n A 1 143 ASN 143 152 ? ? ? A . n A 1 144 GLU 144 153 ? ? ? A . n A 1 145 THR 145 154 ? ? ? A . n A 1 146 ASP 146 155 ? ? ? A . n A 1 147 THR 147 156 ? ? ? A . n A 1 148 PRO 148 157 ? ? ? A . n A 1 149 ALA 149 158 ? ? ? A . n A 1 150 GLN 150 159 ? ? ? A . n A 1 151 LEU 151 160 ? ? ? A . n A 1 152 GLU 152 161 ? ? ? A . n A 1 153 MET 153 162 ? ? ? A . n A 1 154 GLU 154 163 ? ? ? A . n A 1 155 ASP 155 164 ? ? ? A . n A 1 156 GLU 156 165 ? ? ? A . n A 1 157 ASP 157 166 ? ? ? A . n A 1 158 THR 158 167 ? ? ? A . n A 1 159 ILE 159 168 ? ? ? A . n A 1 160 ASP 160 169 ? ? ? A . n A 1 161 VAL 161 170 ? ? ? A . n A 1 162 PHE 162 171 ? ? ? A . n A 1 163 GLN 163 172 ? ? ? A . n A 1 164 GLN 164 173 ? ? ? A . n A 1 165 GLN 165 174 ? ? ? A . n A 1 166 THR 166 175 ? ? ? A . n A 1 167 GLY 167 176 ? ? ? A . n A 1 168 GLY 168 177 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 2001 2001 HOH HOH A . B 2 HOH 2 2002 2002 HOH HOH A . B 2 HOH 3 2003 2003 HOH HOH A . B 2 HOH 4 2004 2004 HOH HOH A . B 2 HOH 5 2005 2005 HOH HOH A . B 2 HOH 6 2006 2006 HOH HOH A . B 2 HOH 7 2007 2007 HOH HOH A . B 2 HOH 8 2008 2008 HOH HOH A . B 2 HOH 9 2009 2009 HOH HOH A . B 2 HOH 10 2010 2010 HOH HOH A . B 2 HOH 11 2011 2011 HOH HOH A . B 2 HOH 12 2012 2012 HOH HOH A . B 2 HOH 13 2013 2013 HOH HOH A . B 2 HOH 14 2014 2014 HOH HOH A . B 2 HOH 15 2015 2015 HOH HOH A . B 2 HOH 16 2016 2016 HOH HOH A . B 2 HOH 17 2017 2017 HOH HOH A . B 2 HOH 18 2018 2018 HOH HOH A . B 2 HOH 19 2019 2019 HOH HOH A . B 2 HOH 20 2020 2020 HOH HOH A . B 2 HOH 21 2021 2021 HOH HOH A . B 2 HOH 22 2022 2022 HOH HOH A . B 2 HOH 23 2023 2023 HOH HOH A . B 2 HOH 24 2024 2024 HOH HOH A . B 2 HOH 25 2025 2025 HOH HOH A . B 2 HOH 26 2026 2026 HOH HOH A . B 2 HOH 27 2027 2027 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_444 -x+y-1/3,-x-2/3,z-2/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 -43.2943419860 0.0000000000 0.0000000000 1.0000000000 -22.1780000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-11-06 2 'Structure model' 1 1 2013-12-25 3 'Structure model' 1 2 2016-09-21 4 'Structure model' 1 3 2018-04-04 5 'Structure model' 1 4 2018-06-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Source and taxonomy' 3 4 'Structure model' 'Data collection' 4 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_source 2 5 'Structure model' diffrn_source # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_diffrn_source.type' 2 5 'Structure model' '_diffrn_source.pdbx_wavelength_list' 3 5 'Structure model' '_diffrn_source.source' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language REFMAC refinement 5.7.0029 ? 1 ? ? ? ? XDS 'data reduction' . ? 2 ? ? ? ? XDS 'data scaling' . ? 3 ? ? ? ? PHASER phasing . ? 4 ? ? ? ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 81 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 81.53 _pdbx_validate_torsion.psi 5.93 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 57 ? CD ? A GLN 48 CD 2 1 Y 1 A GLN 57 ? OE1 ? A GLN 48 OE1 3 1 Y 1 A GLN 57 ? NE2 ? A GLN 48 NE2 4 1 Y 1 A ARG 59 ? CD ? A ARG 50 CD 5 1 Y 1 A ARG 59 ? NE ? A ARG 50 NE 6 1 Y 1 A ARG 59 ? CZ ? A ARG 50 CZ 7 1 Y 1 A ARG 59 ? NH1 ? A ARG 50 NH1 8 1 Y 1 A ARG 59 ? NH2 ? A ARG 50 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 10 ? A GLY 1 2 1 Y 1 A SER 11 ? A SER 2 3 1 Y 1 A THR 12 ? A THR 3 4 1 Y 1 A GLU 13 ? A GLU 4 5 1 Y 1 A ASN 14 ? A ASN 5 6 1 Y 1 A ASN 15 ? A ASN 6 7 1 Y 1 A ASP 16 ? A ASP 7 8 1 Y 1 A GLN 90 ? A GLN 81 9 1 Y 1 A THR 91 ? A THR 82 10 1 Y 1 A GLY 92 ? A GLY 83 11 1 Y 1 A GLY 93 ? A GLY 84 12 1 Y 1 A ARG 94 ? A ARG 85 13 1 Y 1 A SER 95 ? A SER 86 14 1 Y 1 A THR 96 ? A THR 87 15 1 Y 1 A GLU 97 ? A GLU 88 16 1 Y 1 A ASN 98 ? A ASN 89 17 1 Y 1 A ASN 99 ? A ASN 90 18 1 Y 1 A ASP 100 ? A ASP 91 19 1 Y 1 A HIS 101 ? A HIS 92 20 1 Y 1 A ILE 102 ? A ILE 93 21 1 Y 1 A ASN 103 ? A ASN 94 22 1 Y 1 A LEU 104 ? A LEU 95 23 1 Y 1 A LYS 105 ? A LYS 96 24 1 Y 1 A VAL 106 ? A VAL 97 25 1 Y 1 A ALA 107 ? A ALA 98 26 1 Y 1 A GLY 108 ? A GLY 99 27 1 Y 1 A GLN 109 ? A GLN 100 28 1 Y 1 A ASP 110 ? A ASP 101 29 1 Y 1 A GLY 111 ? A GLY 102 30 1 Y 1 A SER 112 ? A SER 103 31 1 Y 1 A VAL 113 ? A VAL 104 32 1 Y 1 A VAL 114 ? A VAL 105 33 1 Y 1 A GLN 115 ? A GLN 106 34 1 Y 1 A PHE 116 ? A PHE 107 35 1 Y 1 A LYS 117 ? A LYS 108 36 1 Y 1 A ILE 118 ? A ILE 109 37 1 Y 1 A LYS 119 ? A LYS 110 38 1 Y 1 A ARG 120 ? A ARG 111 39 1 Y 1 A HIS 121 ? A HIS 112 40 1 Y 1 A THR 122 ? A THR 113 41 1 Y 1 A PRO 123 ? A PRO 114 42 1 Y 1 A LEU 124 ? A LEU 115 43 1 Y 1 A SER 125 ? A SER 116 44 1 Y 1 A LYS 126 ? A LYS 117 45 1 Y 1 A LEU 127 ? A LEU 118 46 1 Y 1 A MET 128 ? A MET 119 47 1 Y 1 A LYS 129 ? A LYS 120 48 1 Y 1 A ALA 130 ? A ALA 121 49 1 Y 1 A TYR 131 ? A TYR 122 50 1 Y 1 A CYS 132 ? A CYS 123 51 1 Y 1 A GLU 133 ? A GLU 124 52 1 Y 1 A ARG 134 ? A ARG 125 53 1 Y 1 A GLN 135 ? A GLN 126 54 1 Y 1 A GLY 136 ? A GLY 127 55 1 Y 1 A LEU 137 ? A LEU 128 56 1 Y 1 A SER 138 ? A SER 129 57 1 Y 1 A MET 139 ? A MET 130 58 1 Y 1 A ARG 140 ? A ARG 131 59 1 Y 1 A GLN 141 ? A GLN 132 60 1 Y 1 A ILE 142 ? A ILE 133 61 1 Y 1 A ARG 143 ? A ARG 134 62 1 Y 1 A PHE 144 ? A PHE 135 63 1 Y 1 A ARG 145 ? A ARG 136 64 1 Y 1 A PHE 146 ? A PHE 137 65 1 Y 1 A ASP 147 ? A ASP 138 66 1 Y 1 A GLY 148 ? A GLY 139 67 1 Y 1 A GLN 149 ? A GLN 140 68 1 Y 1 A PRO 150 ? A PRO 141 69 1 Y 1 A ILE 151 ? A ILE 142 70 1 Y 1 A ASN 152 ? A ASN 143 71 1 Y 1 A GLU 153 ? A GLU 144 72 1 Y 1 A THR 154 ? A THR 145 73 1 Y 1 A ASP 155 ? A ASP 146 74 1 Y 1 A THR 156 ? A THR 147 75 1 Y 1 A PRO 157 ? A PRO 148 76 1 Y 1 A ALA 158 ? A ALA 149 77 1 Y 1 A GLN 159 ? A GLN 150 78 1 Y 1 A LEU 160 ? A LEU 151 79 1 Y 1 A GLU 161 ? A GLU 152 80 1 Y 1 A MET 162 ? A MET 153 81 1 Y 1 A GLU 163 ? A GLU 154 82 1 Y 1 A ASP 164 ? A ASP 155 83 1 Y 1 A GLU 165 ? A GLU 156 84 1 Y 1 A ASP 166 ? A ASP 157 85 1 Y 1 A THR 167 ? A THR 158 86 1 Y 1 A ILE 168 ? A ILE 159 87 1 Y 1 A ASP 169 ? A ASP 160 88 1 Y 1 A VAL 170 ? A VAL 161 89 1 Y 1 A PHE 171 ? A PHE 162 90 1 Y 1 A GLN 172 ? A GLN 163 91 1 Y 1 A GLN 173 ? A GLN 164 92 1 Y 1 A GLN 174 ? A GLN 165 93 1 Y 1 A THR 175 ? A THR 166 94 1 Y 1 A GLY 176 ? A GLY 167 95 1 Y 1 A GLY 177 ? A GLY 168 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #