data_4CH1 # _entry.id 4CH1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4CH1 PDBE EBI-59104 WWPDB D_1290059104 BMRB 19653 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 4CH0 unspecified 'RRM DOMAIN FROM C. ELEGANS SUP-12' BMRB 19653 unspecified . # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4CH1 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2013-11-28 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Amrane, S.' 1 ? 'Mackereth, C.D.' 2 ? # _citation.id primary _citation.title 'Backbone-Independent Nucleic Acid Binding by Splicing Factor Sup-12 Reveals Key Aspects of Molecular Recognition' _citation.journal_abbrev Nat.Commun. _citation.journal_volume 5 _citation.page_first 4595 _citation.page_last ? _citation.year 2014 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2041-1723 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25183497 _citation.pdbx_database_id_DOI 10.1038/NCOMMS5595 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Amrane, S.' 1 primary 'Rebora, K.' 2 primary 'Zniber, I.' 3 primary 'Dupuy, D.' 4 primary 'Mackereth, C.D.' 5 # _cell.entry_id 4CH1 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4CH1 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN SUP-12, ISOFORM B' 10831.196 1 ? ? 'RRM DOMAIN, RESIDUES 28-121' ? 2 polymer syn GGTGTGC 2169.433 1 ? ? 'SUP-12 BINDING MOTIF' 'THE HEPTAMER SEQUENCE IS DERIVED FROM THE INTRON BETWEEN EXONS 4 AND 5B FROM THE C. ELEGANS EGL-15 GENE.' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRK ANVNLAYLGAKPRTNVQ ; ;GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRK ANVNLAYLGAKPRTNVQ ; A ? 2 polydeoxyribonucleotide no no '(DG)(DG)(DT)(DG)(DT)(DG)(DC)' GGTGTGC B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 ARG n 1 7 ASP n 1 8 THR n 1 9 MET n 1 10 PHE n 1 11 THR n 1 12 LYS n 1 13 ILE n 1 14 PHE n 1 15 VAL n 1 16 GLY n 1 17 GLY n 1 18 LEU n 1 19 PRO n 1 20 TYR n 1 21 HIS n 1 22 THR n 1 23 SER n 1 24 ASP n 1 25 LYS n 1 26 THR n 1 27 LEU n 1 28 HIS n 1 29 GLU n 1 30 TYR n 1 31 PHE n 1 32 GLU n 1 33 GLN n 1 34 PHE n 1 35 GLY n 1 36 ASP n 1 37 ILE n 1 38 GLU n 1 39 GLU n 1 40 ALA n 1 41 VAL n 1 42 VAL n 1 43 ILE n 1 44 THR n 1 45 ASP n 1 46 ARG n 1 47 ASN n 1 48 THR n 1 49 GLN n 1 50 LYS n 1 51 SER n 1 52 ARG n 1 53 GLY n 1 54 TYR n 1 55 GLY n 1 56 PHE n 1 57 VAL n 1 58 THR n 1 59 MET n 1 60 LYS n 1 61 ASP n 1 62 ARG n 1 63 ALA n 1 64 SER n 1 65 ALA n 1 66 GLU n 1 67 ARG n 1 68 ALA n 1 69 CYS n 1 70 LYS n 1 71 ASP n 1 72 PRO n 1 73 ASN n 1 74 PRO n 1 75 ILE n 1 76 ILE n 1 77 ASP n 1 78 GLY n 1 79 ARG n 1 80 LYS n 1 81 ALA n 1 82 ASN n 1 83 VAL n 1 84 ASN n 1 85 LEU n 1 86 ALA n 1 87 TYR n 1 88 LEU n 1 89 GLY n 1 90 ALA n 1 91 LYS n 1 92 PRO n 1 93 ARG n 1 94 THR n 1 95 ASN n 1 96 VAL n 1 97 GLN n 2 1 DG n 2 2 DG n 2 3 DT n 2 4 DG n 2 5 DT n 2 6 DG n 2 7 DC n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'CAENORHABDITIS ELEGANS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6239 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant PLYSY _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-HIS1A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'CAENORHABDITIS ELEGANS' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 6239 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP H2L051_CAEEL 1 ? ? H2L051 ? 2 PDB 4CH1 2 ? ? 4CH1 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4CH1 A 4 ? 97 ? H2L051 28 ? 121 ? 28 121 2 2 4CH1 B 1 ? 7 ? 4CH1 1 ? 7 ? 1 7 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4CH1 GLY A 1 ? UNP H2L051 ? ? 'expression tag' 25 1 1 4CH1 ALA A 2 ? UNP H2L051 ? ? 'expression tag' 26 2 1 4CH1 MET A 3 ? UNP H2L051 ? ? 'expression tag' 27 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DC 'DNA linking' y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.197 DG 'DNA linking' y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 DT 'DNA linking' y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 15N-NOESY 1 2 2 13C-NOESY 1 3 3 'DOUBLE- FILTERED 1H' 1 4 4 '1H- NOESY' 1 5 5 1H-TOCSY 1 6 6 1H-NOESY 1 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.temperature_units _pdbx_nmr_exptl_sample_conditions.label 1 298.0 atm 1.0 6.5 300 mM pH K ? 2 298.0 atm 1.0 6.5 300 mM pH K ? 3 298.0 atm 1.0 6.5 300 mM pH K ? 4 298.0 atm 1.0 6.5 300 mM pH K ? 5 298.0 atm 1.0 6.5 300 mM pH K ? # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '10% WATER/90% D2O' ? ? ? ? 2 '100% D2O' ? ? ? ? 3 '100% D2O' ? ? ? ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 Avance Bruker 700 ? 2 Avance Bruker 800 ? # _pdbx_nmr_refine.entry_id 4CH1 _pdbx_nmr_refine.method ARIA1.2 _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 4CH1 _pdbx_nmr_details.text ;THE STRUCTURE WAS DETERMINED BY USING MULTI- DIMENSIONAL NMR SPECTRSOCOPY WITH 15N-, 13C,15N-, OR 2H- LABELED SUP-12 IN COMPLEX WITH A NATURAL ABUNDANCE GGTGTGC DNA LIGAND, OR A LIGAND WITH SITE-SPECIFIC 13C,15N- LABELING. ; # _pdbx_nmr_ensemble.entry_id 4CH1 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY AND NO VIOLATIONS' # _pdbx_nmr_representative.entry_id 4CH1 _pdbx_nmr_representative.conformer_id 6 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS1.1 ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' NMRPIPE ? ? 2 'structure solution' SPARKY ? ? 3 # _exptl.entry_id 4CH1 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 4CH1 _struct.title 'RRM domain from C. elegans SUP-12 bound to GGTGTGC DNA' _struct.pdbx_descriptor 'PROTEIN SUP-12, ISOFORM B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4CH1 _struct_keywords.pdbx_keywords TRANSCRIPTION/DNA _struct_keywords.text 'TRANSCRIPTION-DNA COMPLEX, MUSCLE, DEVELOPMENT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 23 ? GLU A 32 ? SER A 47 GLU A 56 1 ? 10 HELX_P HELX_P2 2 GLN A 33 ? GLY A 35 ? GLN A 57 GLY A 59 5 ? 3 HELX_P HELX_P3 3 ASP A 61 ? ASP A 71 ? ASP A 85 ASP A 95 1 ? 11 HELX_P HELX_P4 4 TYR A 87 ? GLY A 89 ? TYR A 111 GLY A 113 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 4 ? AB ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AB 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ILE A 37 ? THR A 44 ? ILE A 61 THR A 68 AA 2 SER A 51 ? MET A 59 ? SER A 75 MET A 83 AA 3 LYS A 12 ? GLY A 16 ? LYS A 36 GLY A 40 AA 4 ASN A 82 ? LEU A 85 ? ASN A 106 LEU A 109 AB 1 ILE A 75 ? ILE A 76 ? ILE A 99 ILE A 100 AB 2 ARG A 79 ? LYS A 80 ? ARG A 103 LYS A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 O ILE A 43 ? O ILE A 67 N ARG A 52 ? N ARG A 76 AA 2 3 N VAL A 57 ? N VAL A 81 O ILE A 13 ? O ILE A 37 AA 3 4 N GLY A 16 ? N GLY A 40 O ASN A 82 ? O ASN A 106 AB 1 2 N ILE A 76 ? N ILE A 100 O ARG A 79 ? O ARG A 103 # _database_PDB_matrix.entry_id 4CH1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4CH1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 25 25 GLY GLY A . n A 1 2 ALA 2 26 26 ALA ALA A . n A 1 3 MET 3 27 27 MET MET A . n A 1 4 GLY 4 28 28 GLY GLY A . n A 1 5 SER 5 29 29 SER SER A . n A 1 6 ARG 6 30 30 ARG ARG A . n A 1 7 ASP 7 31 31 ASP ASP A . n A 1 8 THR 8 32 32 THR THR A . n A 1 9 MET 9 33 33 MET MET A . n A 1 10 PHE 10 34 34 PHE PHE A . n A 1 11 THR 11 35 35 THR THR A . n A 1 12 LYS 12 36 36 LYS LYS A . n A 1 13 ILE 13 37 37 ILE ILE A . n A 1 14 PHE 14 38 38 PHE PHE A . n A 1 15 VAL 15 39 39 VAL VAL A . n A 1 16 GLY 16 40 40 GLY GLY A . n A 1 17 GLY 17 41 41 GLY GLY A . n A 1 18 LEU 18 42 42 LEU LEU A . n A 1 19 PRO 19 43 43 PRO PRO A . n A 1 20 TYR 20 44 44 TYR TYR A . n A 1 21 HIS 21 45 45 HIS HIS A . n A 1 22 THR 22 46 46 THR THR A . n A 1 23 SER 23 47 47 SER SER A . n A 1 24 ASP 24 48 48 ASP ASP A . n A 1 25 LYS 25 49 49 LYS LYS A . n A 1 26 THR 26 50 50 THR THR A . n A 1 27 LEU 27 51 51 LEU LEU A . n A 1 28 HIS 28 52 52 HIS HIS A . n A 1 29 GLU 29 53 53 GLU GLU A . n A 1 30 TYR 30 54 54 TYR TYR A . n A 1 31 PHE 31 55 55 PHE PHE A . n A 1 32 GLU 32 56 56 GLU GLU A . n A 1 33 GLN 33 57 57 GLN GLN A . n A 1 34 PHE 34 58 58 PHE PHE A . n A 1 35 GLY 35 59 59 GLY GLY A . n A 1 36 ASP 36 60 60 ASP ASP A . n A 1 37 ILE 37 61 61 ILE ILE A . n A 1 38 GLU 38 62 62 GLU GLU A . n A 1 39 GLU 39 63 63 GLU GLU A . n A 1 40 ALA 40 64 64 ALA ALA A . n A 1 41 VAL 41 65 65 VAL VAL A . n A 1 42 VAL 42 66 66 VAL VAL A . n A 1 43 ILE 43 67 67 ILE ILE A . n A 1 44 THR 44 68 68 THR THR A . n A 1 45 ASP 45 69 69 ASP ASP A . n A 1 46 ARG 46 70 70 ARG ARG A . n A 1 47 ASN 47 71 71 ASN ASN A . n A 1 48 THR 48 72 72 THR THR A . n A 1 49 GLN 49 73 73 GLN GLN A . n A 1 50 LYS 50 74 74 LYS LYS A . n A 1 51 SER 51 75 75 SER SER A . n A 1 52 ARG 52 76 76 ARG ARG A . n A 1 53 GLY 53 77 77 GLY GLY A . n A 1 54 TYR 54 78 78 TYR TYR A . n A 1 55 GLY 55 79 79 GLY GLY A . n A 1 56 PHE 56 80 80 PHE PHE A . n A 1 57 VAL 57 81 81 VAL VAL A . n A 1 58 THR 58 82 82 THR THR A . n A 1 59 MET 59 83 83 MET MET A . n A 1 60 LYS 60 84 84 LYS LYS A . n A 1 61 ASP 61 85 85 ASP ASP A . n A 1 62 ARG 62 86 86 ARG ARG A . n A 1 63 ALA 63 87 87 ALA ALA A . n A 1 64 SER 64 88 88 SER SER A . n A 1 65 ALA 65 89 89 ALA ALA A . n A 1 66 GLU 66 90 90 GLU GLU A . n A 1 67 ARG 67 91 91 ARG ARG A . n A 1 68 ALA 68 92 92 ALA ALA A . n A 1 69 CYS 69 93 93 CYS CYS A . n A 1 70 LYS 70 94 94 LYS LYS A . n A 1 71 ASP 71 95 95 ASP ASP A . n A 1 72 PRO 72 96 96 PRO PRO A . n A 1 73 ASN 73 97 97 ASN ASN A . n A 1 74 PRO 74 98 98 PRO PRO A . n A 1 75 ILE 75 99 99 ILE ILE A . n A 1 76 ILE 76 100 100 ILE ILE A . n A 1 77 ASP 77 101 101 ASP ASP A . n A 1 78 GLY 78 102 102 GLY GLY A . n A 1 79 ARG 79 103 103 ARG ARG A . n A 1 80 LYS 80 104 104 LYS LYS A . n A 1 81 ALA 81 105 105 ALA ALA A . n A 1 82 ASN 82 106 106 ASN ASN A . n A 1 83 VAL 83 107 107 VAL VAL A . n A 1 84 ASN 84 108 108 ASN ASN A . n A 1 85 LEU 85 109 109 LEU LEU A . n A 1 86 ALA 86 110 110 ALA ALA A . n A 1 87 TYR 87 111 111 TYR TYR A . n A 1 88 LEU 88 112 112 LEU LEU A . n A 1 89 GLY 89 113 113 GLY GLY A . n A 1 90 ALA 90 114 114 ALA ALA A . n A 1 91 LYS 91 115 115 LYS LYS A . n A 1 92 PRO 92 116 116 PRO PRO A . n A 1 93 ARG 93 117 117 ARG ARG A . n A 1 94 THR 94 118 118 THR THR A . n A 1 95 ASN 95 119 119 ASN ASN A . n A 1 96 VAL 96 120 120 VAL VAL A . n A 1 97 GLN 97 121 121 GLN GLN A . n B 2 1 DG 1 1 1 DG DG B . n B 2 2 DG 2 2 2 DG DG B . n B 2 3 DT 3 3 3 DT DT B . n B 2 4 DG 4 4 4 DG DG B . n B 2 5 DT 5 5 5 DT DT B . n B 2 6 DG 6 6 6 DG DG B . n B 2 7 DC 7 7 7 DC DC B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-09-03 2 'Structure model' 1 1 2014-09-10 3 'Structure model' 1 2 2014-09-17 4 'Structure model' 1 3 2016-04-27 5 'Structure model' 1 4 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 5 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_pdbx_nmr_spectrometer.manufacturer' 2 5 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_entry_details.entry_id 4CH1 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE SAMPLE CONTAINS AN ADDITIONAL GLY-ALA-MET- AT THE N- TERMINUS FOLLOWING CLEAVAGE BY TEV PROTEASE ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 62 ? ? HZ1 A LYS 84 ? ? 1.56 2 2 OD1 A ASP 69 ? ? HH11 A ARG 70 ? ? 1.58 3 2 HD1 A HIS 52 ? ? OE2 A GLU 53 ? ? 1.58 4 3 HA3 A GLY 77 ? ? H21 B DG 2 ? ? 1.15 5 7 OE1 A GLU 62 ? ? HZ1 A LYS 84 ? ? 1.58 6 7 HE2 A HIS 45 ? ? OD1 A ASP 101 ? ? 1.58 7 8 OE1 A GLU 62 ? ? HZ1 A LYS 84 ? ? 1.50 8 10 HD1 A HIS 52 ? ? OE2 A GLU 53 ? ? 1.60 9 11 HD3 A ARG 76 ? ? HH A TYR 78 ? ? 1.32 10 14 HH11 A ARG 76 ? ? HH A TYR 78 ? ? 1.33 11 14 OE1 A GLU 62 ? ? HZ2 A LYS 84 ? ? 1.55 12 15 HD3 A ARG 76 ? ? HH A TYR 78 ? ? 1.21 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 27 ? ? -122.28 -80.46 2 1 ARG A 117 ? ? 74.18 -24.56 3 2 PRO A 96 ? ? -69.72 2.55 4 3 PRO A 116 ? ? -74.45 31.98 5 3 VAL A 120 ? ? 74.88 -54.39 6 4 ASP A 60 ? ? 72.82 123.17 7 5 ALA A 26 ? ? 73.44 -50.24 8 5 MET A 27 ? ? 81.00 165.81 9 5 PRO A 96 ? ? -69.72 0.90 10 5 PRO A 116 ? ? -64.40 -147.64 11 5 THR A 118 ? ? -155.70 -47.52 12 6 ALA A 26 ? ? -119.07 -82.03 13 6 PRO A 116 ? ? -83.29 35.61 14 6 ARG A 117 ? ? -111.22 67.90 15 6 THR A 118 ? ? 169.28 174.58 16 7 PRO A 96 ? ? -69.55 3.62 17 7 ARG A 117 ? ? 57.81 -75.31 18 8 ARG A 117 ? ? 57.72 89.20 19 8 THR A 118 ? ? -84.24 -80.41 20 8 ASN A 119 ? ? 174.56 116.37 21 8 VAL A 120 ? ? -76.97 -74.32 22 9 VAL A 120 ? ? 72.99 144.15 23 10 PRO A 116 ? ? -75.74 39.52 24 10 THR A 118 ? ? 70.77 100.98 25 10 VAL A 120 ? ? 72.95 114.37 26 11 ALA A 26 ? ? 66.57 78.39 27 11 PRO A 96 ? ? -68.90 7.25 28 11 ASN A 119 ? ? 67.91 95.69 29 12 SER A 29 ? ? -79.52 35.42 30 12 ARG A 117 ? ? -160.22 119.71 31 12 ASN A 119 ? ? -58.95 -71.41 32 12 VAL A 120 ? ? 68.52 -63.66 33 13 ALA A 26 ? ? -163.45 104.31 34 14 MET A 27 ? ? 69.54 92.61 35 14 PRO A 116 ? ? -79.91 29.38 36 14 ASN A 119 ? ? -139.48 -54.77 37 15 ALA A 26 ? ? 67.09 -88.08 38 15 MET A 27 ? ? -102.65 76.82 39 15 SER A 29 ? ? 60.52 89.40 40 15 ARG A 117 ? ? 77.29 82.28 #