data_4CII # _entry.id 4CII # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4CII PDBE EBI-57205 WWPDB D_1290057205 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4CII _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2013-12-09 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Barden, S.' 1 'Schomburg, B.' 2 'Niemann, H.H.' 3 # _citation.id primary _citation.title 'Structure of a Three-Dimensional Domain-Swapped Dimer of the Helicobacter Pylori Type Iv Secretion System Pilus Protein Cagl.' _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume 70 _citation.page_first 1391 _citation.page_last ? _citation.year 2014 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24816107 _citation.pdbx_database_id_DOI 10.1107/S1399004714003150 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barden, S.' 1 ? primary 'Schomburg, B.' 2 ? primary 'Conradi, J.' 3 ? primary 'Backert, S.' 4 ? primary 'Sewald, N.' 5 ? primary 'Niemann, H.H.' 6 ? # _cell.entry_id 4CII _cell.length_a 61.841 _cell.length_b 61.841 _cell.length_c 244.499 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4CII _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CAG PATHOGENICITY ISLAND PROTEIN (CAG18)' 25747.236 1 ? ? 'RESIDUES 21-237' 'FRAGMENT OF UNSPECIFIC N-TERMINAL PROTEOLYSIS OF CAGL(AA21-237)-LEHHHHHH IN THE CRYSTALLISATION DROP' 2 non-polymer syn '(4R)-2-METHYLPENTANE-2,4-DIOL' 118.174 1 ? ? ? ? 3 water nat water 18.015 46 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CAG PATHOGENICITY ISLAND PROTEIN 18' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EDITSGLKQLDSTYQETNQQVLKNLDEIFSTTSPSANNEMGEEDALNIKKAAIALRGDLALLKANFEANELFFISEDVIF KTYMSSPELLLTYMKINPLDQNTAEQQCGISDKVLVLYCEGKLKIEQEKQNIRERLETSLKAYQSNIGGTASLITASQTL VESLKNKNFIKGIRKLMLAHNKVFLNYLEELDALERSLEQSKRQYLQERQSSKIIVKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;EDITSGLKQLDSTYQETNQQVLKNLDEIFSTTSPSANNEMGEEDALNIKKAAIALRGDLALLKANFEANELFFISEDVIF KTYMSSPELLLTYMKINPLDQNTAEQQCGISDKVLVLYCEGKLKIEQEKQNIRERLETSLKAYQSNIGGTASLITASQTL VESLKNKNFIKGIRKLMLAHNKVFLNYLEELDALERSLEQSKRQYLQERQSSKIIVKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ASP n 1 3 ILE n 1 4 THR n 1 5 SER n 1 6 GLY n 1 7 LEU n 1 8 LYS n 1 9 GLN n 1 10 LEU n 1 11 ASP n 1 12 SER n 1 13 THR n 1 14 TYR n 1 15 GLN n 1 16 GLU n 1 17 THR n 1 18 ASN n 1 19 GLN n 1 20 GLN n 1 21 VAL n 1 22 LEU n 1 23 LYS n 1 24 ASN n 1 25 LEU n 1 26 ASP n 1 27 GLU n 1 28 ILE n 1 29 PHE n 1 30 SER n 1 31 THR n 1 32 THR n 1 33 SER n 1 34 PRO n 1 35 SER n 1 36 ALA n 1 37 ASN n 1 38 ASN n 1 39 GLU n 1 40 MET n 1 41 GLY n 1 42 GLU n 1 43 GLU n 1 44 ASP n 1 45 ALA n 1 46 LEU n 1 47 ASN n 1 48 ILE n 1 49 LYS n 1 50 LYS n 1 51 ALA n 1 52 ALA n 1 53 ILE n 1 54 ALA n 1 55 LEU n 1 56 ARG n 1 57 GLY n 1 58 ASP n 1 59 LEU n 1 60 ALA n 1 61 LEU n 1 62 LEU n 1 63 LYS n 1 64 ALA n 1 65 ASN n 1 66 PHE n 1 67 GLU n 1 68 ALA n 1 69 ASN n 1 70 GLU n 1 71 LEU n 1 72 PHE n 1 73 PHE n 1 74 ILE n 1 75 SER n 1 76 GLU n 1 77 ASP n 1 78 VAL n 1 79 ILE n 1 80 PHE n 1 81 LYS n 1 82 THR n 1 83 TYR n 1 84 MET n 1 85 SER n 1 86 SER n 1 87 PRO n 1 88 GLU n 1 89 LEU n 1 90 LEU n 1 91 LEU n 1 92 THR n 1 93 TYR n 1 94 MET n 1 95 LYS n 1 96 ILE n 1 97 ASN n 1 98 PRO n 1 99 LEU n 1 100 ASP n 1 101 GLN n 1 102 ASN n 1 103 THR n 1 104 ALA n 1 105 GLU n 1 106 GLN n 1 107 GLN n 1 108 CYS n 1 109 GLY n 1 110 ILE n 1 111 SER n 1 112 ASP n 1 113 LYS n 1 114 VAL n 1 115 LEU n 1 116 VAL n 1 117 LEU n 1 118 TYR n 1 119 CYS n 1 120 GLU n 1 121 GLY n 1 122 LYS n 1 123 LEU n 1 124 LYS n 1 125 ILE n 1 126 GLU n 1 127 GLN n 1 128 GLU n 1 129 LYS n 1 130 GLN n 1 131 ASN n 1 132 ILE n 1 133 ARG n 1 134 GLU n 1 135 ARG n 1 136 LEU n 1 137 GLU n 1 138 THR n 1 139 SER n 1 140 LEU n 1 141 LYS n 1 142 ALA n 1 143 TYR n 1 144 GLN n 1 145 SER n 1 146 ASN n 1 147 ILE n 1 148 GLY n 1 149 GLY n 1 150 THR n 1 151 ALA n 1 152 SER n 1 153 LEU n 1 154 ILE n 1 155 THR n 1 156 ALA n 1 157 SER n 1 158 GLN n 1 159 THR n 1 160 LEU n 1 161 VAL n 1 162 GLU n 1 163 SER n 1 164 LEU n 1 165 LYS n 1 166 ASN n 1 167 LYS n 1 168 ASN n 1 169 PHE n 1 170 ILE n 1 171 LYS n 1 172 GLY n 1 173 ILE n 1 174 ARG n 1 175 LYS n 1 176 LEU n 1 177 MET n 1 178 LEU n 1 179 ALA n 1 180 HIS n 1 181 ASN n 1 182 LYS n 1 183 VAL n 1 184 PHE n 1 185 LEU n 1 186 ASN n 1 187 TYR n 1 188 LEU n 1 189 GLU n 1 190 GLU n 1 191 LEU n 1 192 ASP n 1 193 ALA n 1 194 LEU n 1 195 GLU n 1 196 ARG n 1 197 SER n 1 198 LEU n 1 199 GLU n 1 200 GLN n 1 201 SER n 1 202 LYS n 1 203 ARG n 1 204 GLN n 1 205 TYR n 1 206 LEU n 1 207 GLN n 1 208 GLU n 1 209 ARG n 1 210 GLN n 1 211 SER n 1 212 SER n 1 213 LYS n 1 214 ILE n 1 215 ILE n 1 216 VAL n 1 217 LYS n 1 218 LEU n 1 219 GLU n 1 220 HIS n 1 221 HIS n 1 222 HIS n 1 223 HIS n 1 224 HIS n 1 225 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 26695 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HELICOBACTER PYLORI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 85962 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant 'CODONPLUS RIL' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET28-A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O25272_HELPY _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession O25272 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4CII _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 217 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O25272 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 237 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 21 _struct_ref_seq.pdbx_auth_seq_align_end 237 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4CII LEU A 218 ? UNP O25272 ? ? 'expression tag' 238 1 1 4CII GLU A 219 ? UNP O25272 ? ? 'expression tag' 239 2 1 4CII HIS A 220 ? UNP O25272 ? ? 'expression tag' 240 3 1 4CII HIS A 221 ? UNP O25272 ? ? 'expression tag' 241 4 1 4CII HIS A 222 ? UNP O25272 ? ? 'expression tag' 242 5 1 4CII HIS A 223 ? UNP O25272 ? ? 'expression tag' 243 6 1 4CII HIS A 224 ? UNP O25272 ? ? 'expression tag' 244 7 1 4CII HIS A 225 ? UNP O25272 ? ? 'expression tag' 245 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MRD non-polymer . '(4R)-2-METHYLPENTANE-2,4-DIOL' ? 'C6 H14 O2' 118.174 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4CII _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 2 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.3 _exptl_crystal.density_percent_sol 62.6 _exptl_crystal.description NONE _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;100 MM CITRATE/PHOSPHATE PH 4.2, 40% (V/V) 2-METHYL-2,4-PENTANEDIOL, 6.4% TERT-BUTANOL. VAPOR DIFFUSION AT 277 K WITH DROP RATIO OF 2:1 PROTEIN TO RESERVOIR. ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2010-06-24 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97950 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_wavelength 0.97950 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4CII _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 44.75 _reflns.d_resolution_high 2.15 _reflns.number_obs 16080 _reflns.number_all ? _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.08 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.70 _reflns.B_iso_Wilson_estimate 30.24 _reflns.pdbx_redundancy 9 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.15 _reflns_shell.d_res_low 2.27 _reflns_shell.percent_possible_all 99.5 _reflns_shell.Rmerge_I_obs 0.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.20 _reflns_shell.pdbx_redundancy 6.3 _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4CII _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 15977 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40.282 _refine.ls_d_res_high 2.150 _refine.ls_percent_reflns_obs 99.69 _refine.ls_R_factor_obs 0.2003 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1985 _refine.ls_R_factor_R_free 0.2374 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 784 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 51.67 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 3CZI' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.21 _refine.pdbx_overall_phase_error 24.11 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1443 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 46 _refine_hist.number_atoms_total 1497 _refine_hist.d_res_high 2.150 _refine_hist.d_res_low 40.282 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.009 ? ? 1512 'X-RAY DIFFRACTION' ? f_angle_d 0.968 ? ? 2035 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.573 ? ? 593 'X-RAY DIFFRACTION' ? f_chiral_restr 0.069 ? ? 234 'X-RAY DIFFRACTION' ? f_plane_restr 0.003 ? ? 262 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.1500 2.2847 2443 0.2365 99.00 0.2621 . . 130 . . . . 'X-RAY DIFFRACTION' . 2.2847 2.4611 2450 0.1966 100.00 0.2176 . . 119 . . . . 'X-RAY DIFFRACTION' . 2.4611 2.7087 2474 0.1729 100.00 0.2457 . . 132 . . . . 'X-RAY DIFFRACTION' . 2.7087 3.1006 2522 0.1821 100.00 0.2423 . . 125 . . . . 'X-RAY DIFFRACTION' . 3.1006 3.9059 2547 0.1912 100.00 0.2230 . . 145 . . . . 'X-RAY DIFFRACTION' . 3.9059 40.2886 2757 0.2089 100.00 0.2424 . . 133 . . . . # _struct.entry_id 4CII _struct.title 'Crystal structure of N-terminally truncated Helicobacter pylori T4SS Protein CagL as domain swapped dimer' _struct.pdbx_descriptor 'CAG PATHOGENICITY ISLAND PROTEIN (CAG18)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4CII _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'PROTEIN BINDING, ADHESION, RGD MOTIF, INTEGRIN BINDING, TYPE IV SECRETION, T4S, VIRULENCE, HP0539' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 41 ? THR A 82 ? GLY A 61 THR A 102 1 ? 42 HELX_P HELX_P2 2 SER A 86 ? ASN A 97 ? SER A 106 ASN A 117 1 ? 12 HELX_P HELX_P3 3 ASP A 100 ? GLY A 109 ? ASP A 120 GLY A 129 1 ? 10 HELX_P HELX_P4 4 ASP A 112 ? SER A 145 ? ASP A 132 SER A 165 1 ? 34 HELX_P HELX_P5 5 ASN A 146 ? GLU A 219 ? ASN A 166 GLU A 239 1 ? 74 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 108 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 119 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 128 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 139 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.050 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE MRD A 1241' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 GLU A 88 ? GLU A 108 . ? 8_545 ? 2 AC1 3 SER A 197 ? SER A 217 . ? 2_544 ? 3 AC1 3 SER A 201 ? SER A 221 . ? 2_544 ? # _database_PDB_matrix.entry_id 4CII _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4CII _atom_sites.fract_transf_matrix[1][1] 0.016171 _atom_sites.fract_transf_matrix[1][2] 0.009336 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018672 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004090 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 21 ? ? ? A . n A 1 2 ASP 2 22 ? ? ? A . n A 1 3 ILE 3 23 ? ? ? A . n A 1 4 THR 4 24 ? ? ? A . n A 1 5 SER 5 25 ? ? ? A . n A 1 6 GLY 6 26 ? ? ? A . n A 1 7 LEU 7 27 ? ? ? A . n A 1 8 LYS 8 28 ? ? ? A . n A 1 9 GLN 9 29 ? ? ? A . n A 1 10 LEU 10 30 ? ? ? A . n A 1 11 ASP 11 31 ? ? ? A . n A 1 12 SER 12 32 ? ? ? A . n A 1 13 THR 13 33 ? ? ? A . n A 1 14 TYR 14 34 ? ? ? A . n A 1 15 GLN 15 35 ? ? ? A . n A 1 16 GLU 16 36 ? ? ? A . n A 1 17 THR 17 37 ? ? ? A . n A 1 18 ASN 18 38 ? ? ? A . n A 1 19 GLN 19 39 ? ? ? A . n A 1 20 GLN 20 40 ? ? ? A . n A 1 21 VAL 21 41 ? ? ? A . n A 1 22 LEU 22 42 ? ? ? A . n A 1 23 LYS 23 43 ? ? ? A . n A 1 24 ASN 24 44 ? ? ? A . n A 1 25 LEU 25 45 ? ? ? A . n A 1 26 ASP 26 46 ? ? ? A . n A 1 27 GLU 27 47 ? ? ? A . n A 1 28 ILE 28 48 ? ? ? A . n A 1 29 PHE 29 49 ? ? ? A . n A 1 30 SER 30 50 ? ? ? A . n A 1 31 THR 31 51 ? ? ? A . n A 1 32 THR 32 52 ? ? ? A . n A 1 33 SER 33 53 ? ? ? A . n A 1 34 PRO 34 54 ? ? ? A . n A 1 35 SER 35 55 ? ? ? A . n A 1 36 ALA 36 56 ? ? ? A . n A 1 37 ASN 37 57 ? ? ? A . n A 1 38 ASN 38 58 ? ? ? A . n A 1 39 GLU 39 59 ? ? ? A . n A 1 40 MET 40 60 ? ? ? A . n A 1 41 GLY 41 61 61 GLY GLY A . n A 1 42 GLU 42 62 62 GLU GLU A . n A 1 43 GLU 43 63 63 GLU GLU A . n A 1 44 ASP 44 64 64 ASP ASP A . n A 1 45 ALA 45 65 65 ALA ALA A . n A 1 46 LEU 46 66 66 LEU LEU A . n A 1 47 ASN 47 67 67 ASN ASN A . n A 1 48 ILE 48 68 68 ILE ILE A . n A 1 49 LYS 49 69 69 LYS LYS A . n A 1 50 LYS 50 70 70 LYS LYS A . n A 1 51 ALA 51 71 71 ALA ALA A . n A 1 52 ALA 52 72 72 ALA ALA A . n A 1 53 ILE 53 73 73 ILE ILE A . n A 1 54 ALA 54 74 74 ALA ALA A . n A 1 55 LEU 55 75 75 LEU LEU A . n A 1 56 ARG 56 76 76 ARG ARG A . n A 1 57 GLY 57 77 77 GLY GLY A . n A 1 58 ASP 58 78 78 ASP ASP A . n A 1 59 LEU 59 79 79 LEU LEU A . n A 1 60 ALA 60 80 80 ALA ALA A . n A 1 61 LEU 61 81 81 LEU LEU A . n A 1 62 LEU 62 82 82 LEU LEU A . n A 1 63 LYS 63 83 83 LYS LYS A . n A 1 64 ALA 64 84 84 ALA ALA A . n A 1 65 ASN 65 85 85 ASN ASN A . n A 1 66 PHE 66 86 86 PHE PHE A . n A 1 67 GLU 67 87 87 GLU GLU A . n A 1 68 ALA 68 88 88 ALA ALA A . n A 1 69 ASN 69 89 89 ASN ASN A . n A 1 70 GLU 70 90 90 GLU GLU A . n A 1 71 LEU 71 91 91 LEU LEU A . n A 1 72 PHE 72 92 92 PHE PHE A . n A 1 73 PHE 73 93 93 PHE PHE A . n A 1 74 ILE 74 94 94 ILE ILE A . n A 1 75 SER 75 95 95 SER SER A . n A 1 76 GLU 76 96 96 GLU GLU A . n A 1 77 ASP 77 97 97 ASP ASP A . n A 1 78 VAL 78 98 98 VAL VAL A . n A 1 79 ILE 79 99 99 ILE ILE A . n A 1 80 PHE 80 100 100 PHE PHE A . n A 1 81 LYS 81 101 101 LYS LYS A . n A 1 82 THR 82 102 102 THR THR A . n A 1 83 TYR 83 103 103 TYR TYR A . n A 1 84 MET 84 104 104 MET MET A . n A 1 85 SER 85 105 105 SER SER A . n A 1 86 SER 86 106 106 SER SER A . n A 1 87 PRO 87 107 107 PRO PRO A . n A 1 88 GLU 88 108 108 GLU GLU A . n A 1 89 LEU 89 109 109 LEU LEU A . n A 1 90 LEU 90 110 110 LEU LEU A . n A 1 91 LEU 91 111 111 LEU LEU A . n A 1 92 THR 92 112 112 THR THR A . n A 1 93 TYR 93 113 113 TYR TYR A . n A 1 94 MET 94 114 114 MET MET A . n A 1 95 LYS 95 115 115 LYS LYS A . n A 1 96 ILE 96 116 116 ILE ILE A . n A 1 97 ASN 97 117 117 ASN ASN A . n A 1 98 PRO 98 118 118 PRO PRO A . n A 1 99 LEU 99 119 119 LEU LEU A . n A 1 100 ASP 100 120 120 ASP ASP A . n A 1 101 GLN 101 121 121 GLN GLN A . n A 1 102 ASN 102 122 122 ASN ASN A . n A 1 103 THR 103 123 123 THR THR A . n A 1 104 ALA 104 124 124 ALA ALA A . n A 1 105 GLU 105 125 125 GLU GLU A . n A 1 106 GLN 106 126 126 GLN GLN A . n A 1 107 GLN 107 127 127 GLN GLN A . n A 1 108 CYS 108 128 128 CYS CYS A . n A 1 109 GLY 109 129 129 GLY GLY A . n A 1 110 ILE 110 130 130 ILE ILE A . n A 1 111 SER 111 131 131 SER SER A . n A 1 112 ASP 112 132 132 ASP ASP A . n A 1 113 LYS 113 133 133 LYS LYS A . n A 1 114 VAL 114 134 134 VAL VAL A . n A 1 115 LEU 115 135 135 LEU LEU A . n A 1 116 VAL 116 136 136 VAL VAL A . n A 1 117 LEU 117 137 137 LEU LEU A . n A 1 118 TYR 118 138 138 TYR TYR A . n A 1 119 CYS 119 139 139 CYS CYS A . n A 1 120 GLU 120 140 140 GLU GLU A . n A 1 121 GLY 121 141 141 GLY GLY A . n A 1 122 LYS 122 142 142 LYS LYS A . n A 1 123 LEU 123 143 143 LEU LEU A . n A 1 124 LYS 124 144 144 LYS LYS A . n A 1 125 ILE 125 145 145 ILE ILE A . n A 1 126 GLU 126 146 146 GLU GLU A . n A 1 127 GLN 127 147 147 GLN GLN A . n A 1 128 GLU 128 148 148 GLU GLU A . n A 1 129 LYS 129 149 149 LYS LYS A . n A 1 130 GLN 130 150 150 GLN GLN A . n A 1 131 ASN 131 151 151 ASN ASN A . n A 1 132 ILE 132 152 152 ILE ILE A . n A 1 133 ARG 133 153 153 ARG ARG A . n A 1 134 GLU 134 154 154 GLU GLU A . n A 1 135 ARG 135 155 155 ARG ARG A . n A 1 136 LEU 136 156 156 LEU LEU A . n A 1 137 GLU 137 157 157 GLU GLU A . n A 1 138 THR 138 158 158 THR THR A . n A 1 139 SER 139 159 159 SER SER A . n A 1 140 LEU 140 160 160 LEU LEU A . n A 1 141 LYS 141 161 161 LYS LYS A . n A 1 142 ALA 142 162 162 ALA ALA A . n A 1 143 TYR 143 163 163 TYR TYR A . n A 1 144 GLN 144 164 164 GLN GLN A . n A 1 145 SER 145 165 165 SER SER A . n A 1 146 ASN 146 166 166 ASN ASN A . n A 1 147 ILE 147 167 167 ILE ILE A . n A 1 148 GLY 148 168 168 GLY GLY A . n A 1 149 GLY 149 169 169 GLY GLY A . n A 1 150 THR 150 170 170 THR THR A . n A 1 151 ALA 151 171 171 ALA ALA A . n A 1 152 SER 152 172 172 SER SER A . n A 1 153 LEU 153 173 173 LEU LEU A . n A 1 154 ILE 154 174 174 ILE ILE A . n A 1 155 THR 155 175 175 THR THR A . n A 1 156 ALA 156 176 176 ALA ALA A . n A 1 157 SER 157 177 177 SER SER A . n A 1 158 GLN 158 178 178 GLN GLN A . n A 1 159 THR 159 179 179 THR THR A . n A 1 160 LEU 160 180 180 LEU LEU A . n A 1 161 VAL 161 181 181 VAL VAL A . n A 1 162 GLU 162 182 182 GLU GLU A . n A 1 163 SER 163 183 183 SER SER A . n A 1 164 LEU 164 184 184 LEU LEU A . n A 1 165 LYS 165 185 185 LYS LYS A . n A 1 166 ASN 166 186 186 ASN ASN A . n A 1 167 LYS 167 187 187 LYS LYS A . n A 1 168 ASN 168 188 188 ASN ASN A . n A 1 169 PHE 169 189 189 PHE PHE A . n A 1 170 ILE 170 190 190 ILE ILE A . n A 1 171 LYS 171 191 191 LYS LYS A . n A 1 172 GLY 172 192 192 GLY GLY A . n A 1 173 ILE 173 193 193 ILE ILE A . n A 1 174 ARG 174 194 194 ARG ARG A . n A 1 175 LYS 175 195 195 LYS LYS A . n A 1 176 LEU 176 196 196 LEU LEU A . n A 1 177 MET 177 197 197 MET MET A . n A 1 178 LEU 178 198 198 LEU LEU A . n A 1 179 ALA 179 199 199 ALA ALA A . n A 1 180 HIS 180 200 200 HIS HIS A . n A 1 181 ASN 181 201 201 ASN ASN A . n A 1 182 LYS 182 202 202 LYS LYS A . n A 1 183 VAL 183 203 203 VAL VAL A . n A 1 184 PHE 184 204 204 PHE PHE A . n A 1 185 LEU 185 205 205 LEU LEU A . n A 1 186 ASN 186 206 206 ASN ASN A . n A 1 187 TYR 187 207 207 TYR TYR A . n A 1 188 LEU 188 208 208 LEU LEU A . n A 1 189 GLU 189 209 209 GLU GLU A . n A 1 190 GLU 190 210 210 GLU GLU A . n A 1 191 LEU 191 211 211 LEU LEU A . n A 1 192 ASP 192 212 212 ASP ASP A . n A 1 193 ALA 193 213 213 ALA ALA A . n A 1 194 LEU 194 214 214 LEU LEU A . n A 1 195 GLU 195 215 215 GLU GLU A . n A 1 196 ARG 196 216 216 ARG ARG A . n A 1 197 SER 197 217 217 SER SER A . n A 1 198 LEU 198 218 218 LEU LEU A . n A 1 199 GLU 199 219 219 GLU GLU A . n A 1 200 GLN 200 220 220 GLN GLN A . n A 1 201 SER 201 221 221 SER SER A . n A 1 202 LYS 202 222 222 LYS LYS A . n A 1 203 ARG 203 223 223 ARG ARG A . n A 1 204 GLN 204 224 224 GLN GLN A . n A 1 205 TYR 205 225 225 TYR TYR A . n A 1 206 LEU 206 226 226 LEU LEU A . n A 1 207 GLN 207 227 227 GLN GLN A . n A 1 208 GLU 208 228 228 GLU GLU A . n A 1 209 ARG 209 229 229 ARG ARG A . n A 1 210 GLN 210 230 230 GLN GLN A . n A 1 211 SER 211 231 231 SER SER A . n A 1 212 SER 212 232 232 SER SER A . n A 1 213 LYS 213 233 233 LYS LYS A . n A 1 214 ILE 214 234 234 ILE ILE A . n A 1 215 ILE 215 235 235 ILE ILE A . n A 1 216 VAL 216 236 236 VAL VAL A . n A 1 217 LYS 217 237 237 LYS LYS A . n A 1 218 LEU 218 238 238 LEU LEU A . n A 1 219 GLU 219 239 239 GLU GLU A . n A 1 220 HIS 220 240 240 HIS HIS A . n A 1 221 HIS 221 241 ? ? ? A . n A 1 222 HIS 222 242 ? ? ? A . n A 1 223 HIS 223 243 ? ? ? A . n A 1 224 HIS 224 244 ? ? ? A . n A 1 225 HIS 225 245 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MRD 1 1241 1241 MRD MRD A . C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . C 3 HOH 10 2010 2010 HOH HOH A . C 3 HOH 11 2011 2011 HOH HOH A . C 3 HOH 12 2012 2012 HOH HOH A . C 3 HOH 13 2013 2013 HOH HOH A . C 3 HOH 14 2014 2014 HOH HOH A . C 3 HOH 15 2015 2015 HOH HOH A . C 3 HOH 16 2016 2016 HOH HOH A . C 3 HOH 17 2017 2017 HOH HOH A . C 3 HOH 18 2018 2018 HOH HOH A . C 3 HOH 19 2019 2019 HOH HOH A . C 3 HOH 20 2020 2020 HOH HOH A . C 3 HOH 21 2021 2021 HOH HOH A . C 3 HOH 22 2022 2022 HOH HOH A . C 3 HOH 23 2023 2023 HOH HOH A . C 3 HOH 24 2024 2024 HOH HOH A . C 3 HOH 25 2025 2025 HOH HOH A . C 3 HOH 26 2026 2026 HOH HOH A . C 3 HOH 27 2027 2027 HOH HOH A . C 3 HOH 28 2028 2028 HOH HOH A . C 3 HOH 29 2029 2029 HOH HOH A . C 3 HOH 30 2030 2030 HOH HOH A . C 3 HOH 31 2031 2031 HOH HOH A . C 3 HOH 32 2032 2032 HOH HOH A . C 3 HOH 33 2033 2033 HOH HOH A . C 3 HOH 34 2034 2034 HOH HOH A . C 3 HOH 35 2035 2035 HOH HOH A . C 3 HOH 36 2036 2036 HOH HOH A . C 3 HOH 37 2037 2037 HOH HOH A . C 3 HOH 38 2038 2038 HOH HOH A . C 3 HOH 39 2039 2039 HOH HOH A . C 3 HOH 40 2040 2040 HOH HOH A . C 3 HOH 41 2041 2041 HOH HOH A . C 3 HOH 42 2042 2042 HOH HOH A . C 3 HOH 43 2043 2043 HOH HOH A . C 3 HOH 44 2044 2044 HOH HOH A . C 3 HOH 45 2045 2045 HOH HOH A . C 3 HOH 46 2046 2046 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6750 ? 1 MORE -77.9 ? 1 'SSA (A^2)' 22920 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 9_555 -x,-x+y,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 81.4996666667 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2038 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-02-19 2 'Structure model' 1 1 2014-05-14 3 'Structure model' 1 2 2014-05-21 4 'Structure model' 1 3 2019-03-06 5 'Structure model' 1 4 2019-09-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Experimental preparation' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Experimental preparation' 8 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' exptl_crystal_grow 2 4 'Structure model' pdbx_database_proc 3 4 'Structure model' pdbx_database_status 4 5 'Structure model' exptl_crystal_grow 5 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_exptl_crystal_grow.temp' 2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 3 5 'Structure model' '_exptl_crystal_grow.method' 4 5 'Structure model' '_pdbx_database_status.status_code_sf' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 24.2325 -18.3455 27.9105 0.2348 0.3011 0.2367 -0.0660 -0.0651 -0.0034 4.2637 5.1948 7.8466 0.6129 1.4605 -0.0750 -0.0653 -0.7160 0.1635 0.8129 -0.2531 -0.4199 -0.6356 0.3070 0.1242 'X-RAY DIFFRACTION' 2 ? refined 9.7116 -13.7497 -8.8105 0.7506 0.4681 0.4405 -0.1711 -0.2134 0.1194 1.8402 3.1895 5.2266 0.0219 3.1084 -0.5437 -0.8674 0.2231 0.4924 -0.7590 0.0753 0.0112 -1.8959 -0.0363 0.2774 'X-RAY DIFFRACTION' 3 ? refined 17.8330 -22.3756 0.3047 0.2837 0.4083 0.2477 -0.1333 -0.0561 0.0060 3.0180 0.8699 9.1376 0.5160 3.1315 -1.0854 -0.4430 1.0017 0.1313 -0.3375 0.1353 0.1056 0.1318 1.2853 -0.0919 'X-RAY DIFFRACTION' 4 ? refined 17.5803 -23.3063 60.2615 0.3188 0.3628 0.2655 -0.1242 0.0485 -0.0081 1.2578 0.6829 2.5687 -0.3984 -2.1287 0.3801 -0.0471 -0.0924 0.1456 -0.1238 -0.0909 -0.2418 -0.2350 0.8051 0.1475 'X-RAY DIFFRACTION' 5 ? refined 20.2948 -13.8897 104.8281 0.3608 0.5036 0.2885 -0.1594 0.0358 -0.1232 2.9450 3.7970 3.6812 1.3418 2.6452 3.1674 0.1129 -0.0867 0.0404 0.4544 -0.1487 0.1222 1.1830 -0.0403 -0.0398 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 61:90)' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 91:125)' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 126:178)' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 179:208)' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 209:240)' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language PHENIX refinement '(PHENIX.REFINE)' ? 1 ? ? ? ? XDS 'data reduction' . ? 2 ? ? ? ? SCALA 'data scaling' . ? 3 ? ? ? ? PHASER phasing . ? 4 ? ? ? ? # _pdbx_entry_details.entry_id 4CII _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;N-TERMINALLY (SIGNAL PEPTIDE) TRUNCATED CAGL (AA21-237) WITH A C-TERMINAL EXPRESSION TAG (LEHHHHHH) ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 102 ? ? -113.91 -107.75 2 1 ASN A 117 ? ? -117.84 69.97 3 1 ASN A 122 ? ? -55.36 -72.92 4 1 ALA A 124 ? ? -53.46 -71.51 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 21 ? A GLU 1 2 1 Y 1 A ASP 22 ? A ASP 2 3 1 Y 1 A ILE 23 ? A ILE 3 4 1 Y 1 A THR 24 ? A THR 4 5 1 Y 1 A SER 25 ? A SER 5 6 1 Y 1 A GLY 26 ? A GLY 6 7 1 Y 1 A LEU 27 ? A LEU 7 8 1 Y 1 A LYS 28 ? A LYS 8 9 1 Y 1 A GLN 29 ? A GLN 9 10 1 Y 1 A LEU 30 ? A LEU 10 11 1 Y 1 A ASP 31 ? A ASP 11 12 1 Y 1 A SER 32 ? A SER 12 13 1 Y 1 A THR 33 ? A THR 13 14 1 Y 1 A TYR 34 ? A TYR 14 15 1 Y 1 A GLN 35 ? A GLN 15 16 1 Y 1 A GLU 36 ? A GLU 16 17 1 Y 1 A THR 37 ? A THR 17 18 1 Y 1 A ASN 38 ? A ASN 18 19 1 Y 1 A GLN 39 ? A GLN 19 20 1 Y 1 A GLN 40 ? A GLN 20 21 1 Y 1 A VAL 41 ? A VAL 21 22 1 Y 1 A LEU 42 ? A LEU 22 23 1 Y 1 A LYS 43 ? A LYS 23 24 1 Y 1 A ASN 44 ? A ASN 24 25 1 Y 1 A LEU 45 ? A LEU 25 26 1 Y 1 A ASP 46 ? A ASP 26 27 1 Y 1 A GLU 47 ? A GLU 27 28 1 Y 1 A ILE 48 ? A ILE 28 29 1 Y 1 A PHE 49 ? A PHE 29 30 1 Y 1 A SER 50 ? A SER 30 31 1 Y 1 A THR 51 ? A THR 31 32 1 Y 1 A THR 52 ? A THR 32 33 1 Y 1 A SER 53 ? A SER 33 34 1 Y 1 A PRO 54 ? A PRO 34 35 1 Y 1 A SER 55 ? A SER 35 36 1 Y 1 A ALA 56 ? A ALA 36 37 1 Y 1 A ASN 57 ? A ASN 37 38 1 Y 1 A ASN 58 ? A ASN 38 39 1 Y 1 A GLU 59 ? A GLU 39 40 1 Y 1 A MET 60 ? A MET 40 41 1 Y 1 A HIS 241 ? A HIS 221 42 1 Y 1 A HIS 242 ? A HIS 222 43 1 Y 1 A HIS 243 ? A HIS 223 44 1 Y 1 A HIS 244 ? A HIS 224 45 1 Y 1 A HIS 245 ? A HIS 225 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(4R)-2-METHYLPENTANE-2,4-DIOL' MRD 3 water HOH #