data_4CRD # _entry.id 4CRD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4CRD PDBE EBI-59833 WWPDB D_1290059833 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 4CR5 unspecified 'CREATING NOVEL F1 INHIBITORS THROUGH FRAGMENT BASED LEAD GENERATION AND STRUCTURE AIDED DRUG DESIGN' PDB 4CR9 unspecified 'CREATING NOVEL F1 INHIBITORS THROUGH FRAGMENT BASED LEAD GENERATION AND STRUCTURE AIDED DRUG DESIGN' PDB 4CRA unspecified 'CREATING NOVEL F1 INHIBITORS THROUGH FRAGMENT BASED LEAD GENERATION AND STRUCTURE AIDED DRUG DESIGN' PDB 4CRB unspecified 'CREATING NOVEL F1 INHIBITORS THROUGH FRAGMENT BASED LEAD GENERATION AND STRUCTURE AIDED DRUG DESIGN' PDB 4CRC unspecified 'CREATING NOVEL F1 INHIBITORS THROUGH FRAGMENT BASED LEAD GENERATION AND STRUCTURE AIDED DRUG DESIGN' PDB 4CRE unspecified 'CREATING NOVEL F1 INHIBITORS THROUGH FRAGMENT BASED LEAD GENERATION AND STRUCTURE AIDED DRUG DESIGN' PDB 4CRF unspecified 'CREATING NOVEL F1 INHIBITORS THROUGH FRAGMENT BASED LEAD GENERATION AND STRUCTURE AIDED DRUG DESIGN' PDB 4CRG unspecified 'CREATING NOVEL F1 INHIBITORS THROUGH FRAGMENT BASED LEAD GENERATION AND STRUCTURE AIDED DRUG DESIGN' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4CRD _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2014-02-26 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sandmark, J.' 1 'Oster, L.' 2 'Fjellstrom, O.' 3 'Akkaya, S.' 4 'Beisel, H.G.' 5 'Eriksson, P.O.' 6 'Erixon, K.' 7 'Gustafsson, D.' 8 'Jurva, U.' 9 'Kang, D.' 10 'Karis, D.' 11 'Knecht, W.' 12 'Nerme, V.' 13 'Nilsson, I.' 14 'Olsson, T.' 15 'Redzic, A.' 16 'Roth, R.' 17 'Tigerstrom, A.' 18 # _citation.id primary _citation.title 'Creating Novel Activated Factor Xi Inhibitors Through Fragment Based Lead Generation and Structure Aided Drug Design.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 10 _citation.page_first 13705 _citation.page_last ? _citation.year 2015 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25629509 _citation.pdbx_database_id_DOI 10.1371/JOURNAL.PONE.0113705 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Fjellstrom, O.' 1 primary 'Akkaya, S.' 2 primary 'Beisel, H.' 3 primary 'Eriksson, P.' 4 primary 'Erixon, K.' 5 primary 'Gustafsson, D.' 6 primary 'Jurva, U.' 7 primary 'Kang, D.' 8 primary 'Karis, D.' 9 primary 'Knecht, W.' 10 primary 'Nerme, V.' 11 primary 'Nilsson, I.' 12 primary 'Olsson, T.' 13 primary 'Redzic, A.' 14 primary 'Roth, R.' 15 primary 'Sandmark, J.' 16 primary 'Tigerstrom, A.' 17 primary 'Oster, L.' 18 # _cell.entry_id 4CRD _cell.length_a 120.535 _cell.length_b 120.535 _cell.length_c 120.535 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4CRD _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'COAGULATION FACTOR XI' 26752.369 1 3.4.21.27 YES 'CATALYTIC DOMAIN, RESIDUES 388-625' ? 2 non-polymer syn 'Methyl N-[4-[5-chloro-2-[[3-[5-chloro-2-(tetrazol-1-yl)phenyl]propanoylamino]methyl]-1H-imidazol-4-yl]phenyl]carbamate' 517.368 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 4 water nat water 18.015 76 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FXI, PLASMA THROMBOPLASTIN ANTECEDENT, PTA, COAGULATION FACTOR XIA LIGHT CHAIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQAEIAEDTSFFGVQEII IHDQYKMAESGYDIALLKLETTVNYADSQRPISLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQK RYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV ; _entity_poly.pdbx_seq_one_letter_code_can ;IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQAEIAEDTSFFGVQEII IHDQYKMAESGYDIALLKLETTVNYADSQRPISLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQK RYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 THR n 1 6 ALA n 1 7 SER n 1 8 VAL n 1 9 ARG n 1 10 GLY n 1 11 GLU n 1 12 TRP n 1 13 PRO n 1 14 TRP n 1 15 GLN n 1 16 VAL n 1 17 THR n 1 18 LEU n 1 19 HIS n 1 20 THR n 1 21 THR n 1 22 SER n 1 23 PRO n 1 24 THR n 1 25 GLN n 1 26 ARG n 1 27 HIS n 1 28 LEU n 1 29 CYS n 1 30 GLY n 1 31 GLY n 1 32 SER n 1 33 ILE n 1 34 ILE n 1 35 GLY n 1 36 ASN n 1 37 GLN n 1 38 TRP n 1 39 ILE n 1 40 LEU n 1 41 THR n 1 42 ALA n 1 43 ALA n 1 44 HIS n 1 45 CYS n 1 46 PHE n 1 47 TYR n 1 48 GLY n 1 49 VAL n 1 50 GLU n 1 51 SER n 1 52 PRO n 1 53 LYS n 1 54 ILE n 1 55 LEU n 1 56 ARG n 1 57 VAL n 1 58 TYR n 1 59 SER n 1 60 GLY n 1 61 ILE n 1 62 LEU n 1 63 ASN n 1 64 GLN n 1 65 ALA n 1 66 GLU n 1 67 ILE n 1 68 ALA n 1 69 GLU n 1 70 ASP n 1 71 THR n 1 72 SER n 1 73 PHE n 1 74 PHE n 1 75 GLY n 1 76 VAL n 1 77 GLN n 1 78 GLU n 1 79 ILE n 1 80 ILE n 1 81 ILE n 1 82 HIS n 1 83 ASP n 1 84 GLN n 1 85 TYR n 1 86 LYS n 1 87 MET n 1 88 ALA n 1 89 GLU n 1 90 SER n 1 91 GLY n 1 92 TYR n 1 93 ASP n 1 94 ILE n 1 95 ALA n 1 96 LEU n 1 97 LEU n 1 98 LYS n 1 99 LEU n 1 100 GLU n 1 101 THR n 1 102 THR n 1 103 VAL n 1 104 ASN n 1 105 TYR n 1 106 ALA n 1 107 ASP n 1 108 SER n 1 109 GLN n 1 110 ARG n 1 111 PRO n 1 112 ILE n 1 113 SER n 1 114 LEU n 1 115 PRO n 1 116 SER n 1 117 LYS n 1 118 GLY n 1 119 ASP n 1 120 ARG n 1 121 ASN n 1 122 VAL n 1 123 ILE n 1 124 TYR n 1 125 THR n 1 126 ASP n 1 127 CYS n 1 128 TRP n 1 129 VAL n 1 130 THR n 1 131 GLY n 1 132 TRP n 1 133 GLY n 1 134 TYR n 1 135 ARG n 1 136 LYS n 1 137 LEU n 1 138 ARG n 1 139 ASP n 1 140 LYS n 1 141 ILE n 1 142 GLN n 1 143 ASN n 1 144 THR n 1 145 LEU n 1 146 GLN n 1 147 LYS n 1 148 ALA n 1 149 LYS n 1 150 ILE n 1 151 PRO n 1 152 LEU n 1 153 VAL n 1 154 THR n 1 155 ASN n 1 156 GLU n 1 157 GLU n 1 158 CYS n 1 159 GLN n 1 160 LYS n 1 161 ARG n 1 162 TYR n 1 163 ARG n 1 164 GLY n 1 165 HIS n 1 166 LYS n 1 167 ILE n 1 168 THR n 1 169 HIS n 1 170 LYS n 1 171 MET n 1 172 ILE n 1 173 CYS n 1 174 ALA n 1 175 GLY n 1 176 TYR n 1 177 ARG n 1 178 GLU n 1 179 GLY n 1 180 GLY n 1 181 LYS n 1 182 ASP n 1 183 ALA n 1 184 CYS n 1 185 LYS n 1 186 GLY n 1 187 ASP n 1 188 SER n 1 189 GLY n 1 190 GLY n 1 191 PRO n 1 192 LEU n 1 193 SER n 1 194 CYS n 1 195 LYS n 1 196 HIS n 1 197 ASN n 1 198 GLU n 1 199 VAL n 1 200 TRP n 1 201 HIS n 1 202 LEU n 1 203 VAL n 1 204 GLY n 1 205 ILE n 1 206 THR n 1 207 SER n 1 208 TRP n 1 209 GLY n 1 210 GLU n 1 211 GLY n 1 212 CYS n 1 213 ALA n 1 214 GLN n 1 215 ARG n 1 216 GLU n 1 217 ARG n 1 218 PRO n 1 219 GLY n 1 220 VAL n 1 221 TYR n 1 222 THR n 1 223 ASN n 1 224 VAL n 1 225 VAL n 1 226 GLU n 1 227 TYR n 1 228 VAL n 1 229 ASP n 1 230 TRP n 1 231 ILE n 1 232 LEU n 1 233 GLU n 1 234 LYS n 1 235 THR n 1 236 GLN n 1 237 ALA n 1 238 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'PICHIA PASTORIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FA11_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P03951 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4CRD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 238 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03951 _struct_ref_seq.db_align_beg 388 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 625 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 245 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4CRD ALA A 65 ? UNP P03951 SER 452 'engineered mutation' 75 1 1 4CRD ALA A 68 ? UNP P03951 LYS 455 'engineered mutation' 78 2 1 4CRD ALA A 106 ? UNP P03951 THR 493 'engineered mutation' 115 3 1 4CRD SER A 113 ? UNP P03951 CYS 500 'engineered mutation' 123 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OTJ non-polymer . 'Methyl N-[4-[5-chloro-2-[[3-[5-chloro-2-(tetrazol-1-yl)phenyl]propanoylamino]methyl]-1H-imidazol-4-yl]phenyl]carbamate' ? 'C22 H22 Cl2 N8 O3' 517.368 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4CRD _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.73 _exptl_crystal.density_percent_sol 54.88 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '2M AMMONIUM SULFATE, 0.1M TRIS-CL PH 8.5, 0.2M NACL' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2009-06-25 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.94 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_wavelength 0.94 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4CRD _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 2.10 _reflns.number_obs 17077 _reflns.number_all ? _reflns.percent_possible_obs 99.5 _reflns.pdbx_Rmerge_I_obs 0.08 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.40 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 5.8 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.15 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.51 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.40 _reflns_shell.pdbx_redundancy 4.3 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4CRD _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 15814 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 85.38 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 97.05 _refine.ls_R_factor_obs 0.19220 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19057 _refine.ls_R_factor_R_free 0.22032 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 857 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.959 _refine.correlation_coeff_Fo_to_Fc_free 0.945 _refine.B_iso_mean 41.817 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.208 _refine.pdbx_overall_ESU_R_Free 0.169 _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1868 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 50 _refine_hist.number_atoms_solvent 76 _refine_hist.number_atoms_total 1994 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 85.38 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.010 0.019 ? 1976 'X-RAY DIFFRACTION' ? r_bond_other_d 0.000 0.020 ? 1802 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.391 1.958 ? 2686 'X-RAY DIFFRACTION' ? r_angle_other_deg 3.645 3.000 ? 4148 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.634 5.000 ? 237 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.402 23.793 ? 87 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.773 15.000 ? 328 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 16.867 15.000 ? 12 'X-RAY DIFFRACTION' ? r_chiral_restr 0.077 0.200 ? 283 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 2267 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.006 0.020 ? 456 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.301 3.920 ? 948 'X-RAY DIFFRACTION' ? r_mcbond_other 2.292 3.916 ? 947 'X-RAY DIFFRACTION' ? r_mcangle_it 3.145 5.868 ? 1185 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.997 4.347 ? 1028 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.100 _refine_ls_shell.d_res_low 2.155 _refine_ls_shell.number_reflns_R_work 1099 _refine_ls_shell.R_factor_R_work 0.258 _refine_ls_shell.percent_reflns_obs 91.14 _refine_ls_shell.R_factor_R_free 0.279 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 63 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 4CRD _struct.title 'Creating novel F1 inhibitors through fragment based lead generation and structure aided drug design' _struct.pdbx_descriptor 'COAGULATION FACTOR XI (E.C.3.4.21.27)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4CRD _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 42 ? TYR A 47 A ALA A 55 TYR A 59 5 ? 6 HELX_P HELX_P2 2 SER A 51 ? LYS A 53 ? SER A 61 LYS A 63 5 ? 3 HELX_P HELX_P3 3 GLN A 64 ? ILE A 67 ? GLN A 74 ILE A 77 5 ? 4 HELX_P HELX_P4 4 MET A 87 ? GLY A 91 ? MET A 96 GLY A 100 5 ? 5 HELX_P HELX_P5 5 SER A 116 ? ARG A 120 ? SER A 126 ARG A 130 5 ? 5 HELX_P HELX_P6 6 THR A 154 ? TYR A 162 ? THR A 164 TYR A 172 1 ? 9 HELX_P HELX_P7 7 TYR A 227 ? THR A 235 ? TYR A 234 THR A 242 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 29 SG B ? ? 1_555 A CYS 45 SG ? ? A CYS 40 A CYS 58 1_555 ? ? ? ? ? ? ? 2.018 ? disulf2 disulf ? ? A CYS 29 SG C ? ? 1_555 A CYS 45 SG ? ? A CYS 40 A CYS 58 1_555 ? ? ? ? ? ? ? 2.082 ? disulf3 disulf ? ? A CYS 127 SG ? ? ? 1_555 A CYS 194 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.049 ? disulf4 disulf ? ? A CYS 158 SG ? ? ? 1_555 A CYS 173 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.037 ? disulf5 disulf ? ? A CYS 184 SG ? ? ? 1_555 A CYS 212 SG ? ? A CYS 191 A CYS 219 1_555 ? ? ? ? ? ? ? 2.070 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 22 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 37 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 23 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 A _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 37 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.25 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 8 ? AB ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AA 6 7 ? anti-parallel AA 7 8 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AB 4 5 ? anti-parallel AB 5 6 ? anti-parallel AB 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 THR A 5 ? ALA A 6 ? THR A 20 ALA A 21 AA 2 GLN A 146 ? LYS A 149 ? GLN A 156 LYS A 159 AA 3 CYS A 127 ? GLY A 131 ? CYS A 136 GLY A 140 AA 4 PRO A 191 ? HIS A 196 A PRO A 198 HIS A 202 AA 5 VAL A 199 D TRP A 208 ? VAL A 202 TRP A 215 AA 6 GLY A 219 ? ASN A 223 ? GLY A 226 ASN A 230 AA 7 MET A 171 ? ALA A 174 ? MET A 180 ALA A 183 AA 8 LEU A 152 ? VAL A 153 ? LEU A 162 VAL A 163 AB 1 GLN A 15 ? THR A 20 ? GLN A 30 THR A 35 AB 2 ARG A 26 D GLY A 35 ? ARG A 37 GLY A 46 AB 3 TRP A 38 ? THR A 41 ? TRP A 51 THR A 54 AB 4 ALA A 95 ? LEU A 99 ? ALA A 104 LEU A 108 AB 5 PHE A 74 ? ILE A 81 ? PHE A 83 ILE A 90 AB 6 LEU A 55 ? TYR A 58 ? LEU A 65 TYR A 68 AB 7 GLN A 15 ? THR A 20 ? GLN A 30 THR A 35 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N THR A 5 ? N THR A 20 O LYS A 147 ? O LYS A 157 AA 2 3 N ALA A 148 ? N ALA A 158 O VAL A 129 ? O VAL A 138 AA 3 4 N THR A 130 ? N THR A 139 O PRO A 191 ? O PRO A 198 AA 4 5 N HIS A 196 A N HIS A 202 O VAL A 199 D O VAL A 202 AA 5 6 N TRP A 208 ? N TRP A 215 O VAL A 220 ? O VAL A 227 AA 6 7 N TYR A 221 ? N TYR A 228 O ILE A 172 ? O ILE A 181 AA 7 8 N CYS A 173 ? N CYS A 182 O VAL A 153 ? O VAL A 163 AB 1 2 N THR A 20 ? N THR A 35 O ARG A 26 D O ARG A 37 AB 2 3 N ILE A 34 ? N ILE A 45 O TRP A 38 ? O TRP A 51 AB 3 4 N THR A 41 ? N THR A 54 O ALA A 95 ? O ALA A 104 AB 4 5 O LYS A 98 ? O LYS A 107 N GLN A 77 ? N GLN A 86 AB 5 6 N VAL A 76 ? N VAL A 85 O LEU A 55 ? O LEU A 65 AB 6 7 N TYR A 58 ? N TYR A 68 O THR A 17 ? O THR A 32 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE OTJ A 1244' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 1245' AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 1246' AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 1247' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 21 ARG A 26 D ARG A 37 . ? 1_555 ? 2 AC1 21 HIS A 27 ? HIS A 38 . ? 1_555 ? 3 AC1 21 LEU A 28 ? LEU A 39 . ? 1_555 ? 4 AC1 21 ASN A 104 ? ASN A 113 . ? 22_444 ? 5 AC1 21 ILE A 141 ? ILE A 151 . ? 1_555 ? 6 AC1 21 ASP A 182 ? ASP A 189 . ? 1_555 ? 7 AC1 21 CYS A 184 ? CYS A 191 . ? 1_555 ? 8 AC1 21 LYS A 185 ? LYS A 192 . ? 1_555 ? 9 AC1 21 GLY A 186 ? GLY A 193 . ? 1_555 ? 10 AC1 21 ASP A 187 ? ASP A 194 . ? 1_555 ? 11 AC1 21 SER A 188 ? SER A 195 . ? 1_555 ? 12 AC1 21 SER A 207 ? SER A 214 . ? 1_555 ? 13 AC1 21 TRP A 208 ? TRP A 215 . ? 1_555 ? 14 AC1 21 GLY A 209 ? GLY A 216 . ? 1_555 ? 15 AC1 21 GLY A 211 ? GLY A 218 . ? 1_555 ? 16 AC1 21 CYS A 212 ? CYS A 219 . ? 1_555 ? 17 AC1 21 GLY A 219 ? GLY A 226 . ? 1_555 ? 18 AC1 21 VAL A 220 ? VAL A 227 . ? 1_555 ? 19 AC1 21 TYR A 221 ? TYR A 228 . ? 1_555 ? 20 AC1 21 HOH F . ? HOH A 2013 . ? 1_555 ? 21 AC1 21 HOH F . ? HOH A 2057 . ? 1_555 ? 22 AC2 6 LYS A 117 ? LYS A 127 . ? 9_555 ? 23 AC2 6 LYS A 117 ? LYS A 127 . ? 1_555 ? 24 AC2 6 LYS A 117 ? LYS A 127 . ? 5_555 ? 25 AC2 6 ARG A 120 ? ARG A 130 . ? 5_555 ? 26 AC2 6 ARG A 120 ? ARG A 130 . ? 1_555 ? 27 AC2 6 ARG A 120 ? ARG A 130 . ? 9_555 ? 28 AC3 3 TYR A 176 A TYR A 184 . ? 1_555 ? 29 AC3 3 ARG A 177 ? ARG A 185 . ? 1_555 ? 30 AC3 3 GLU A 178 ? GLU A 186 . ? 1_555 ? 31 AC4 3 ASN A 121 ? ASN A 131 . ? 9_555 ? 32 AC4 3 ASN A 121 ? ASN A 131 . ? 1_555 ? 33 AC4 3 ASN A 121 ? ASN A 131 . ? 5_555 ? # _database_PDB_matrix.entry_id 4CRD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4CRD _atom_sites.fract_transf_matrix[1][1] 0.008296 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008296 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008296 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 THR 5 20 20 THR THR A . n A 1 6 ALA 6 21 21 ALA ALA A . n A 1 7 SER 7 22 22 SER SER A . n A 1 8 VAL 8 23 23 VAL VAL A . n A 1 9 ARG 9 24 24 ARG ARG A . n A 1 10 GLY 10 25 25 GLY GLY A . n A 1 11 GLU 11 26 26 GLU GLU A . n A 1 12 TRP 12 27 27 TRP TRP A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 TRP 14 29 29 TRP TRP A . n A 1 15 GLN 15 30 30 GLN GLN A . n A 1 16 VAL 16 31 31 VAL VAL A . n A 1 17 THR 17 32 32 THR THR A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 HIS 19 34 34 HIS HIS A . n A 1 20 THR 20 35 35 THR THR A . n A 1 21 THR 21 36 36 THR THR A . n A 1 22 SER 22 37 37 SER SER A . n A 1 23 PRO 23 37 37 PRO PRO A A n A 1 24 THR 24 37 37 THR THR A B n A 1 25 GLN 25 37 37 GLN GLN A C n A 1 26 ARG 26 37 37 ARG ARG A D n A 1 27 HIS 27 38 38 HIS HIS A . n A 1 28 LEU 28 39 39 LEU LEU A . n A 1 29 CYS 29 40 40 CYS CYS A . n A 1 30 GLY 30 41 41 GLY GLY A . n A 1 31 GLY 31 42 42 GLY GLY A . n A 1 32 SER 32 43 43 SER SER A . n A 1 33 ILE 33 44 44 ILE ILE A . n A 1 34 ILE 34 45 45 ILE ILE A . n A 1 35 GLY 35 46 46 GLY GLY A . n A 1 36 ASN 36 47 47 ASN ASN A . n A 1 37 GLN 37 48 48 GLN GLN A . n A 1 38 TRP 38 51 51 TRP TRP A . n A 1 39 ILE 39 52 52 ILE ILE A . n A 1 40 LEU 40 53 53 LEU LEU A . n A 1 41 THR 41 54 54 THR THR A . n A 1 42 ALA 42 55 55 ALA ALA A . n A 1 43 ALA 43 56 56 ALA ALA A . n A 1 44 HIS 44 57 57 HIS HIS A . n A 1 45 CYS 45 58 58 CYS CYS A . n A 1 46 PHE 46 59 59 PHE PHE A . n A 1 47 TYR 47 59 59 TYR TYR A A n A 1 48 GLY 48 59 59 GLY GLY A B n A 1 49 VAL 49 59 59 VAL VAL A C n A 1 50 GLU 50 60 60 GLU GLU A . n A 1 51 SER 51 61 61 SER SER A . n A 1 52 PRO 52 62 62 PRO PRO A . n A 1 53 LYS 53 63 63 LYS LYS A . n A 1 54 ILE 54 64 64 ILE ILE A . n A 1 55 LEU 55 65 65 LEU LEU A . n A 1 56 ARG 56 66 66 ARG ARG A . n A 1 57 VAL 57 67 67 VAL VAL A . n A 1 58 TYR 58 68 68 TYR TYR A . n A 1 59 SER 59 69 69 SER SER A . n A 1 60 GLY 60 70 70 GLY GLY A . n A 1 61 ILE 61 71 71 ILE ILE A . n A 1 62 LEU 62 72 72 LEU LEU A . n A 1 63 ASN 63 73 73 ASN ASN A . n A 1 64 GLN 64 74 74 GLN GLN A . n A 1 65 ALA 65 75 75 ALA ALA A . n A 1 66 GLU 66 76 76 GLU GLU A . n A 1 67 ILE 67 77 77 ILE ILE A . n A 1 68 ALA 68 78 78 ALA ALA A . n A 1 69 GLU 69 79 79 GLU GLU A . n A 1 70 ASP 70 80 80 ASP ASP A . n A 1 71 THR 71 81 81 THR THR A . n A 1 72 SER 72 81 81 SER SER A A n A 1 73 PHE 73 82 82 PHE PHE A . n A 1 74 PHE 74 83 83 PHE PHE A . n A 1 75 GLY 75 84 84 GLY GLY A . n A 1 76 VAL 76 85 85 VAL VAL A . n A 1 77 GLN 77 86 86 GLN GLN A . n A 1 78 GLU 78 87 87 GLU GLU A . n A 1 79 ILE 79 88 88 ILE ILE A . n A 1 80 ILE 80 89 89 ILE ILE A . n A 1 81 ILE 81 90 90 ILE ILE A . n A 1 82 HIS 82 91 91 HIS HIS A . n A 1 83 ASP 83 92 92 ASP ASP A . n A 1 84 GLN 84 93 93 GLN GLN A . n A 1 85 TYR 85 94 94 TYR TYR A . n A 1 86 LYS 86 95 95 LYS LYS A . n A 1 87 MET 87 96 96 MET MET A . n A 1 88 ALA 88 97 97 ALA ALA A . n A 1 89 GLU 89 98 98 GLU GLU A . n A 1 90 SER 90 99 99 SER SER A . n A 1 91 GLY 91 100 100 GLY GLY A . n A 1 92 TYR 92 101 101 TYR TYR A . n A 1 93 ASP 93 102 102 ASP ASP A . n A 1 94 ILE 94 103 103 ILE ILE A . n A 1 95 ALA 95 104 104 ALA ALA A . n A 1 96 LEU 96 105 105 LEU LEU A . n A 1 97 LEU 97 106 106 LEU LEU A . n A 1 98 LYS 98 107 107 LYS LYS A . n A 1 99 LEU 99 108 108 LEU LEU A . n A 1 100 GLU 100 109 109 GLU GLU A . n A 1 101 THR 101 110 110 THR THR A . n A 1 102 THR 102 111 111 THR THR A . n A 1 103 VAL 103 112 112 VAL VAL A . n A 1 104 ASN 104 113 113 ASN ASN A . n A 1 105 TYR 105 114 114 TYR TYR A . n A 1 106 ALA 106 115 115 ALA ALA A . n A 1 107 ASP 107 116 116 ASP ASP A . n A 1 108 SER 108 117 117 SER SER A . n A 1 109 GLN 109 118 118 GLN GLN A . n A 1 110 ARG 110 119 119 ARG ARG A . n A 1 111 PRO 111 121 121 PRO PRO A . n A 1 112 ILE 112 122 122 ILE ILE A . n A 1 113 SER 113 123 123 SER SER A . n A 1 114 LEU 114 124 124 LEU LEU A . n A 1 115 PRO 115 125 125 PRO PRO A . n A 1 116 SER 116 126 126 SER SER A . n A 1 117 LYS 117 127 127 LYS LYS A . n A 1 118 GLY 118 128 128 GLY GLY A . n A 1 119 ASP 119 129 129 ASP ASP A . n A 1 120 ARG 120 130 130 ARG ARG A . n A 1 121 ASN 121 131 131 ASN ASN A . n A 1 122 VAL 122 132 132 VAL VAL A . n A 1 123 ILE 123 132 132 ILE ILE A A n A 1 124 TYR 124 133 133 TYR TYR A . n A 1 125 THR 125 134 134 THR THR A . n A 1 126 ASP 126 135 135 ASP ASP A . n A 1 127 CYS 127 136 136 CYS CYS A . n A 1 128 TRP 128 137 137 TRP TRP A . n A 1 129 VAL 129 138 138 VAL VAL A . n A 1 130 THR 130 139 139 THR THR A . n A 1 131 GLY 131 140 140 GLY GLY A . n A 1 132 TRP 132 141 141 TRP TRP A . n A 1 133 GLY 133 142 142 GLY GLY A . n A 1 134 TYR 134 143 143 TYR TYR A . n A 1 135 ARG 135 144 144 ARG ARG A . n A 1 136 LYS 136 145 145 LYS LYS A . n A 1 137 LEU 137 146 146 LEU LEU A . n A 1 138 ARG 138 147 147 ARG ARG A . n A 1 139 ASP 139 148 148 ASP ASP A . n A 1 140 LYS 140 149 149 LYS LYS A . n A 1 141 ILE 141 151 151 ILE ILE A . n A 1 142 GLN 142 152 152 GLN GLN A . n A 1 143 ASN 143 153 153 ASN ASN A . n A 1 144 THR 144 154 154 THR THR A . n A 1 145 LEU 145 155 155 LEU LEU A . n A 1 146 GLN 146 156 156 GLN GLN A . n A 1 147 LYS 147 157 157 LYS LYS A . n A 1 148 ALA 148 158 158 ALA ALA A . n A 1 149 LYS 149 159 159 LYS LYS A . n A 1 150 ILE 150 160 160 ILE ILE A . n A 1 151 PRO 151 161 161 PRO PRO A . n A 1 152 LEU 152 162 162 LEU LEU A . n A 1 153 VAL 153 163 163 VAL VAL A . n A 1 154 THR 154 164 164 THR THR A . n A 1 155 ASN 155 165 165 ASN ASN A . n A 1 156 GLU 156 166 166 GLU GLU A . n A 1 157 GLU 157 167 167 GLU GLU A . n A 1 158 CYS 158 168 168 CYS CYS A . n A 1 159 GLN 159 169 169 GLN GLN A . n A 1 160 LYS 160 170 170 LYS LYS A . n A 1 161 ARG 161 171 171 ARG ARG A . n A 1 162 TYR 162 172 172 TYR TYR A . n A 1 163 ARG 163 173 173 ARG ARG A . n A 1 164 GLY 164 173 173 GLY GLY A A n A 1 165 HIS 165 174 174 HIS HIS A . n A 1 166 LYS 166 175 175 LYS LYS A . n A 1 167 ILE 167 176 176 ILE ILE A . n A 1 168 THR 168 177 177 THR THR A . n A 1 169 HIS 169 178 178 HIS HIS A . n A 1 170 LYS 170 179 179 LYS LYS A . n A 1 171 MET 171 180 180 MET MET A . n A 1 172 ILE 172 181 181 ILE ILE A . n A 1 173 CYS 173 182 182 CYS CYS A . n A 1 174 ALA 174 183 183 ALA ALA A . n A 1 175 GLY 175 184 184 GLY GLY A . n A 1 176 TYR 176 184 184 TYR TYR A A n A 1 177 ARG 177 185 185 ARG ARG A . n A 1 178 GLU 178 186 186 GLU GLU A . n A 1 179 GLY 179 187 187 GLY GLY A . n A 1 180 GLY 180 188 188 GLY GLY A . n A 1 181 LYS 181 188 188 LYS LYS A A n A 1 182 ASP 182 189 189 ASP ASP A . n A 1 183 ALA 183 190 190 ALA ALA A . n A 1 184 CYS 184 191 191 CYS CYS A . n A 1 185 LYS 185 192 192 LYS LYS A . n A 1 186 GLY 186 193 193 GLY GLY A . n A 1 187 ASP 187 194 194 ASP ASP A . n A 1 188 SER 188 195 195 SER SER A . n A 1 189 GLY 189 196 196 GLY GLY A . n A 1 190 GLY 190 197 197 GLY GLY A . n A 1 191 PRO 191 198 198 PRO PRO A . n A 1 192 LEU 192 198 198 LEU LEU A A n A 1 193 SER 193 198 198 SER SER A B n A 1 194 CYS 194 201 201 CYS CYS A . n A 1 195 LYS 195 202 202 LYS LYS A . n A 1 196 HIS 196 202 202 HIS HIS A A n A 1 197 ASN 197 202 202 ASN ASN A B n A 1 198 GLU 198 202 202 GLU GLU A C n A 1 199 VAL 199 202 202 VAL VAL A D n A 1 200 TRP 200 203 203 TRP TRP A . n A 1 201 HIS 201 204 204 HIS HIS A . n A 1 202 LEU 202 209 209 LEU LEU A . n A 1 203 VAL 203 210 210 VAL VAL A . n A 1 204 GLY 204 211 211 GLY GLY A . n A 1 205 ILE 205 212 212 ILE ILE A . n A 1 206 THR 206 213 213 THR THR A . n A 1 207 SER 207 214 214 SER SER A . n A 1 208 TRP 208 215 215 TRP TRP A . n A 1 209 GLY 209 216 216 GLY GLY A . n A 1 210 GLU 210 217 217 GLU GLU A . n A 1 211 GLY 211 218 218 GLY GLY A . n A 1 212 CYS 212 219 219 CYS CYS A . n A 1 213 ALA 213 220 220 ALA ALA A . n A 1 214 GLN 214 221 221 GLN GLN A . n A 1 215 ARG 215 222 222 ARG ARG A . n A 1 216 GLU 216 223 223 GLU GLU A . n A 1 217 ARG 217 224 224 ARG ARG A . n A 1 218 PRO 218 225 225 PRO PRO A . n A 1 219 GLY 219 226 226 GLY GLY A . n A 1 220 VAL 220 227 227 VAL VAL A . n A 1 221 TYR 221 228 228 TYR TYR A . n A 1 222 THR 222 229 229 THR THR A . n A 1 223 ASN 223 230 230 ASN ASN A . n A 1 224 VAL 224 231 231 VAL VAL A . n A 1 225 VAL 225 232 232 VAL VAL A . n A 1 226 GLU 226 233 233 GLU GLU A . n A 1 227 TYR 227 234 234 TYR TYR A . n A 1 228 VAL 228 235 235 VAL VAL A . n A 1 229 ASP 229 236 236 ASP ASP A . n A 1 230 TRP 230 237 237 TRP TRP A . n A 1 231 ILE 231 238 238 ILE ILE A . n A 1 232 LEU 232 239 239 LEU LEU A . n A 1 233 GLU 233 240 240 GLU GLU A . n A 1 234 LYS 234 241 241 LYS LYS A . n A 1 235 THR 235 242 242 THR THR A . n A 1 236 GLN 236 243 243 GLN GLN A . n A 1 237 ALA 237 244 ? ? ? A . n A 1 238 VAL 238 245 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 OTJ 1 1244 1244 OTJ OTJ A . C 3 SO4 1 1245 1245 SO4 SO4 A . D 3 SO4 1 1246 1246 SO4 SO4 A . E 3 SO4 1 1247 1247 SO4 SO4 A . F 4 HOH 1 2001 2001 HOH HOH A . F 4 HOH 2 2002 2002 HOH HOH A . F 4 HOH 3 2003 2003 HOH HOH A . F 4 HOH 4 2004 2004 HOH HOH A . F 4 HOH 5 2005 2005 HOH HOH A . F 4 HOH 6 2006 2006 HOH HOH A . F 4 HOH 7 2007 2007 HOH HOH A . F 4 HOH 8 2008 2008 HOH HOH A . F 4 HOH 9 2009 2009 HOH HOH A . F 4 HOH 10 2010 2010 HOH HOH A . F 4 HOH 11 2011 2011 HOH HOH A . F 4 HOH 12 2012 2012 HOH HOH A . F 4 HOH 13 2013 2013 HOH HOH A . F 4 HOH 14 2014 2014 HOH HOH A . F 4 HOH 15 2015 2015 HOH HOH A . F 4 HOH 16 2016 2016 HOH HOH A . F 4 HOH 17 2017 2017 HOH HOH A . F 4 HOH 18 2018 2018 HOH HOH A . F 4 HOH 19 2019 2019 HOH HOH A . F 4 HOH 20 2020 2020 HOH HOH A . F 4 HOH 21 2021 2021 HOH HOH A . F 4 HOH 22 2022 2022 HOH HOH A . F 4 HOH 23 2023 2023 HOH HOH A . F 4 HOH 24 2024 2024 HOH HOH A . F 4 HOH 25 2025 2025 HOH HOH A . F 4 HOH 26 2026 2026 HOH HOH A . F 4 HOH 27 2027 2027 HOH HOH A . F 4 HOH 28 2028 2028 HOH HOH A . F 4 HOH 29 2029 2029 HOH HOH A . F 4 HOH 30 2030 2030 HOH HOH A . F 4 HOH 31 2031 2031 HOH HOH A . F 4 HOH 32 2032 2032 HOH HOH A . F 4 HOH 33 2033 2033 HOH HOH A . F 4 HOH 34 2034 2034 HOH HOH A . F 4 HOH 35 2035 2035 HOH HOH A . F 4 HOH 36 2036 2036 HOH HOH A . F 4 HOH 37 2037 2037 HOH HOH A . F 4 HOH 38 2038 2038 HOH HOH A . F 4 HOH 39 2039 2039 HOH HOH A . F 4 HOH 40 2040 2040 HOH HOH A . F 4 HOH 41 2041 2041 HOH HOH A . F 4 HOH 42 2042 2042 HOH HOH A . F 4 HOH 43 2043 2043 HOH HOH A . F 4 HOH 44 2044 2044 HOH HOH A . F 4 HOH 45 2045 2045 HOH HOH A . F 4 HOH 46 2046 2046 HOH HOH A . F 4 HOH 47 2047 2047 HOH HOH A . F 4 HOH 48 2048 2048 HOH HOH A . F 4 HOH 49 2049 2049 HOH HOH A . F 4 HOH 50 2050 2050 HOH HOH A . F 4 HOH 51 2051 2051 HOH HOH A . F 4 HOH 52 2052 2052 HOH HOH A . F 4 HOH 53 2053 2053 HOH HOH A . F 4 HOH 54 2054 2054 HOH HOH A . F 4 HOH 55 2055 2055 HOH HOH A . F 4 HOH 56 2056 2056 HOH HOH A . F 4 HOH 57 2057 2057 HOH HOH A . F 4 HOH 58 2058 2058 HOH HOH A . F 4 HOH 59 2059 2059 HOH HOH A . F 4 HOH 60 2060 2060 HOH HOH A . F 4 HOH 61 2061 2061 HOH HOH A . F 4 HOH 62 2062 2062 HOH HOH A . F 4 HOH 63 2063 2063 HOH HOH A . F 4 HOH 64 2064 2064 HOH HOH A . F 4 HOH 65 2065 2065 HOH HOH A . F 4 HOH 66 2066 2066 HOH HOH A . F 4 HOH 67 2067 2067 HOH HOH A . F 4 HOH 68 2068 2068 HOH HOH A . F 4 HOH 69 2069 2069 HOH HOH A . F 4 HOH 70 2070 2070 HOH HOH A . F 4 HOH 71 2071 2071 HOH HOH A . F 4 HOH 72 2072 2072 HOH HOH A . F 4 HOH 73 2073 2073 HOH HOH A . F 4 HOH 74 2074 2074 HOH HOH A . F 4 HOH 75 2075 2075 HOH HOH A . F 4 HOH 76 2076 2076 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3890 ? 1 MORE -132.7 ? 1 'SSA (A^2)' 31240 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 1245 ? C SO4 . 2 1 A SO4 1245 ? C SO4 . 3 1 A SO4 1247 ? E SO4 . 4 1 A SO4 1247 ? E SO4 . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2015-02-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.8.0049 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 MOLREP phasing . ? 4 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ; SHEET DETERMINATION METHOD: DSSP THE SHEETS PRESENTED AS "AB" IN EACH CHAIN ON SHEET RECORDS BELOW IS ACTUALLY AN 6-STRANDED BARREL THIS IS REPRESENTED BY A 7-STRANDED SHEET IN WHICH THE FIRST AND LAST STRANDS ARE IDENTICAL. ; # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLY _pdbx_validate_rmsd_bond.auth_seq_id_1 128 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 N _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 ASP _pdbx_validate_rmsd_bond.auth_seq_id_2 129 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.509 _pdbx_validate_rmsd_bond.bond_target_value 1.336 _pdbx_validate_rmsd_bond.bond_deviation 0.173 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.023 _pdbx_validate_rmsd_bond.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 148 ? ? -162.05 -147.55 2 1 SER A 214 ? ? -130.24 -65.63 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 244 ? A ALA 237 2 1 Y 1 A VAL 245 ? A VAL 238 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'Methyl N-[4-[5-chloro-2-[[3-[5-chloro-2-(tetrazol-1-yl)phenyl]propanoylamino]methyl]-1H-imidazol-4-yl]phenyl]carbamate' OTJ 3 'SULFATE ION' SO4 4 water HOH #