data_4CUP # _entry.id 4CUP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4CUP PDBE EBI-60082 WWPDB D_1290060082 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 4CUQ unspecified 'CRYSTAL STRUCTURE OF HUMAN BAZ2B IN COMPLEX WITH FRAGMENT-2 N09594' PDB 4CUR unspecified 'CRYSTAL STRUCTURE OF HUMAN BAZ2B IN COMPLEX WITH FRAGMENT-3 N09555' PDB 4CUS unspecified 'CRYSTAL STRUCTURE OF HUMAN BAZ2B IN COMPLEX WITH FRAGMENT-4 N09496' PDB 4CUT unspecified 'CRYSTAL STRUCTURE OF HUMAN BAZ2B IN COMPLEX WITH FRAGMENT-5 N09428' PDB 4CUU unspecified 'CRYSTAL STRUCTURE OF HUMAN BAZ2B IN COMPLEX WITH FRAGMENT-6 N09645' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4CUP _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2014-03-21 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bradley, A.R.' 1 'Liu, Y.' 2 'Krojer, T.' 3 'Bountra, C.' 4 'Arrowsmith, C.H.' 5 'Edwards, A.' 6 'Knapp, S.' 7 'von Delft, F.' 8 # _citation.id primary _citation.title 'Crystal Structure of Human Baz2B in Complex with Fragment-1 N09421' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'R Bradley, A.' 1 primary 'Liu, Y.' 2 primary 'Krojer, T.' 3 primary 'Bountra, C.' 4 primary 'Arrowsmith, C.H.' 5 primary 'Edwards, A.' 6 primary 'Knapp, S.' 7 primary 'von Delft, F.' 8 # _cell.entry_id 4CUP _cell.length_a 80.370 _cell.length_b 96.120 _cell.length_c 57.670 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4CUP _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'BROMODOMAIN ADJACENT TO ZINC FINGER DOMAIN PROTEIN 2B' 13618.652 1 ? ? 'BROMODOMAIN, RESIDUES 1858-1972' ? 2 non-polymer syn 4-Fluorobenzamidoxime 154.142 1 ? ? ? ? 3 non-polymer syn METHANOL 32.042 3 ? ? ? ? 4 water nat water 18.015 146 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HWALP4, BAZ2B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRL VFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFKVS ; _entity_poly.pdbx_seq_one_letter_code_can ;SMSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRL VFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFKVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 SER n 1 4 VAL n 1 5 LYS n 1 6 LYS n 1 7 PRO n 1 8 LYS n 1 9 ARG n 1 10 ASP n 1 11 ASP n 1 12 SER n 1 13 LYS n 1 14 ASP n 1 15 LEU n 1 16 ALA n 1 17 LEU n 1 18 CYS n 1 19 SER n 1 20 MET n 1 21 ILE n 1 22 LEU n 1 23 THR n 1 24 GLU n 1 25 MET n 1 26 GLU n 1 27 THR n 1 28 HIS n 1 29 GLU n 1 30 ASP n 1 31 ALA n 1 32 TRP n 1 33 PRO n 1 34 PHE n 1 35 LEU n 1 36 LEU n 1 37 PRO n 1 38 VAL n 1 39 ASN n 1 40 LEU n 1 41 LYS n 1 42 LEU n 1 43 VAL n 1 44 PRO n 1 45 GLY n 1 46 TYR n 1 47 LYS n 1 48 LYS n 1 49 VAL n 1 50 ILE n 1 51 LYS n 1 52 LYS n 1 53 PRO n 1 54 MET n 1 55 ASP n 1 56 PHE n 1 57 SER n 1 58 THR n 1 59 ILE n 1 60 ARG n 1 61 GLU n 1 62 LYS n 1 63 LEU n 1 64 SER n 1 65 SER n 1 66 GLY n 1 67 GLN n 1 68 TYR n 1 69 PRO n 1 70 ASN n 1 71 LEU n 1 72 GLU n 1 73 THR n 1 74 PHE n 1 75 ALA n 1 76 LEU n 1 77 ASP n 1 78 VAL n 1 79 ARG n 1 80 LEU n 1 81 VAL n 1 82 PHE n 1 83 ASP n 1 84 ASN n 1 85 CYS n 1 86 GLU n 1 87 THR n 1 88 PHE n 1 89 ASN n 1 90 GLU n 1 91 ASP n 1 92 ASP n 1 93 SER n 1 94 ASP n 1 95 ILE n 1 96 GLY n 1 97 ARG n 1 98 ALA n 1 99 GLY n 1 100 HIS n 1 101 ASN n 1 102 MET n 1 103 ARG n 1 104 LYS n 1 105 TYR n 1 106 PHE n 1 107 GLU n 1 108 LYS n 1 109 LYS n 1 110 TRP n 1 111 THR n 1 112 ASP n 1 113 THR n 1 114 PHE n 1 115 LYS n 1 116 VAL n 1 117 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant R3 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PNIC28-BSA4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BAZ2B_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q9UIF8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4CUP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 117 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UIF8 _struct_ref_seq.db_align_beg 1858 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1972 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1858 _struct_ref_seq.pdbx_auth_seq_align_end 1972 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4CUP SER A 1 ? UNP Q9UIF8 ? ? 'expression tag' 1856 1 1 4CUP MET A 2 ? UNP Q9UIF8 ? ? 'expression tag' 1857 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MOH non-polymer . METHANOL ? 'C H4 O' 32.042 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZYB non-polymer . 4-Fluorobenzamidoxime ? 'C7 H7 F N2 O' 154.142 # _exptl.entry_id 4CUP _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.3 _exptl_crystal.density_percent_sol 70 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.4 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '34% PEG SMEAR LOW, 0.1M MES PH 6.4' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS' _diffrn_detector.pdbx_collection_date 2012-04-29 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_wavelength 0.97 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4CUP _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 32.97 _reflns.d_resolution_high 1.88 _reflns.number_obs 18470 _reflns.number_all ? _reflns.percent_possible_obs 99.5 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 16.20 _reflns.B_iso_Wilson_estimate 26.58 _reflns.pdbx_redundancy 5.4 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.88 _reflns_shell.d_res_low 1.93 _reflns_shell.percent_possible_all 98.6 _reflns_shell.Rmerge_I_obs 0.74 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 1.90 _reflns_shell.pdbx_redundancy 4.8 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4CUP _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 18429 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.90 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 18.538 _refine.ls_d_res_high 1.880 _refine.ls_percent_reflns_obs 99.44 _refine.ls_R_factor_obs 0.1779 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1763 _refine.ls_R_factor_R_free 0.2078 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 940 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.20 _refine.pdbx_overall_phase_error 25.38 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 924 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.number_atoms_solvent 146 _refine_hist.number_atoms_total 1087 _refine_hist.d_res_high 1.880 _refine_hist.d_res_low 18.538 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.006 ? ? 973 'X-RAY DIFFRACTION' ? f_angle_d 0.898 ? ? 1309 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 12.740 ? ? 365 'X-RAY DIFFRACTION' ? f_chiral_restr 0.034 ? ? 141 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 168 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.8800 1.9790 2458 0.3152 99.00 0.3338 . . 133 . . 'X-RAY DIFFRACTION' . 1.9790 2.1029 2430 0.2368 99.00 0.2971 . . 139 . . 'X-RAY DIFFRACTION' . 2.1029 2.2650 2453 0.1915 99.00 0.2154 . . 138 . . 'X-RAY DIFFRACTION' . 2.2650 2.4924 2496 0.1683 100.00 0.2131 . . 137 . . 'X-RAY DIFFRACTION' . 2.4924 2.8519 2493 0.1662 100.00 0.2138 . . 138 . . 'X-RAY DIFFRACTION' . 2.8519 3.5889 2505 0.1669 100.00 0.1748 . . 143 . . 'X-RAY DIFFRACTION' . 3.5889 18.5386 2654 0.1558 100.00 0.1894 . . 112 . . # _struct.entry_id 4CUP _struct.title 'Crystal structure of human BAZ2B in complex with fragment-1 N09421' _struct.pdbx_descriptor 'BROMODOMAIN ADJACENT TO ZINC FINGER DOMAIN PROTEIN 2B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4CUP _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 13 ? HIS A 28 ? LYS A 1868 HIS A 1883 1 ? 16 HELX_P HELX_P2 2 ALA A 31 ? LEU A 35 ? ALA A 1886 LEU A 1890 5 ? 5 HELX_P HELX_P3 3 GLY A 45 ? ILE A 50 ? GLY A 1900 ILE A 1905 1 ? 6 HELX_P HELX_P4 4 ASP A 55 ? SER A 65 ? ASP A 1910 SER A 1920 1 ? 11 HELX_P HELX_P5 5 ASN A 70 ? ASN A 89 ? ASN A 1925 ASN A 1944 1 ? 20 HELX_P HELX_P6 6 SER A 93 ? LYS A 115 ? SER A 1948 LYS A 1970 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE ZYB A 2971' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 VAL A 43 ? VAL A 1898 . ? 1_555 ? 2 AC1 6 PRO A 44 ? PRO A 1899 . ? 4_566 ? 3 AC1 6 ASN A 89 ? ASN A 1944 . ? 1_555 ? 4 AC1 6 ILE A 95 ? ILE A 1950 . ? 1_555 ? 5 AC1 6 HOH F . ? HOH A 2072 . ? 4_566 ? 6 AC1 6 HOH F . ? HOH A 2124 . ? 1_555 ? # _database_PDB_matrix.entry_id 4CUP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4CUP _atom_sites.fract_transf_matrix[1][1] 0.012442 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010404 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017340 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1856 1856 SER SER A . n A 1 2 MET 2 1857 1857 MET MET A . n A 1 3 SER 3 1858 1858 SER SER A . n A 1 4 VAL 4 1859 1859 VAL VAL A . n A 1 5 LYS 5 1860 1860 LYS LYS A . n A 1 6 LYS 6 1861 1861 LYS LYS A . n A 1 7 PRO 7 1862 1862 PRO PRO A . n A 1 8 LYS 8 1863 1863 LYS LYS A . n A 1 9 ARG 9 1864 1864 ARG ARG A . n A 1 10 ASP 10 1865 1865 ASP ASP A . n A 1 11 ASP 11 1866 1866 ASP ASP A . n A 1 12 SER 12 1867 1867 SER SER A . n A 1 13 LYS 13 1868 1868 LYS LYS A . n A 1 14 ASP 14 1869 1869 ASP ASP A . n A 1 15 LEU 15 1870 1870 LEU LEU A . n A 1 16 ALA 16 1871 1871 ALA ALA A . n A 1 17 LEU 17 1872 1872 LEU LEU A . n A 1 18 CYS 18 1873 1873 CYS CYS A . n A 1 19 SER 19 1874 1874 SER SER A . n A 1 20 MET 20 1875 1875 MET MET A . n A 1 21 ILE 21 1876 1876 ILE ILE A . n A 1 22 LEU 22 1877 1877 LEU LEU A . n A 1 23 THR 23 1878 1878 THR THR A . n A 1 24 GLU 24 1879 1879 GLU GLU A . n A 1 25 MET 25 1880 1880 MET MET A . n A 1 26 GLU 26 1881 1881 GLU GLU A . n A 1 27 THR 27 1882 1882 THR THR A . n A 1 28 HIS 28 1883 1883 HIS HIS A . n A 1 29 GLU 29 1884 1884 GLU GLU A . n A 1 30 ASP 30 1885 1885 ASP ASP A . n A 1 31 ALA 31 1886 1886 ALA ALA A . n A 1 32 TRP 32 1887 1887 TRP TRP A . n A 1 33 PRO 33 1888 1888 PRO PRO A . n A 1 34 PHE 34 1889 1889 PHE PHE A . n A 1 35 LEU 35 1890 1890 LEU LEU A . n A 1 36 LEU 36 1891 1891 LEU LEU A . n A 1 37 PRO 37 1892 1892 PRO PRO A . n A 1 38 VAL 38 1893 1893 VAL VAL A . n A 1 39 ASN 39 1894 1894 ASN ASN A . n A 1 40 LEU 40 1895 1895 LEU LEU A . n A 1 41 LYS 41 1896 1896 LYS LYS A . n A 1 42 LEU 42 1897 1897 LEU LEU A . n A 1 43 VAL 43 1898 1898 VAL VAL A . n A 1 44 PRO 44 1899 1899 PRO PRO A . n A 1 45 GLY 45 1900 1900 GLY GLY A . n A 1 46 TYR 46 1901 1901 TYR TYR A . n A 1 47 LYS 47 1902 1902 LYS LYS A . n A 1 48 LYS 48 1903 1903 LYS LYS A . n A 1 49 VAL 49 1904 1904 VAL VAL A . n A 1 50 ILE 50 1905 1905 ILE ILE A . n A 1 51 LYS 51 1906 1906 LYS LYS A . n A 1 52 LYS 52 1907 1907 LYS LYS A . n A 1 53 PRO 53 1908 1908 PRO PRO A . n A 1 54 MET 54 1909 1909 MET MET A . n A 1 55 ASP 55 1910 1910 ASP ASP A . n A 1 56 PHE 56 1911 1911 PHE PHE A . n A 1 57 SER 57 1912 1912 SER SER A . n A 1 58 THR 58 1913 1913 THR THR A . n A 1 59 ILE 59 1914 1914 ILE ILE A . n A 1 60 ARG 60 1915 1915 ARG ARG A . n A 1 61 GLU 61 1916 1916 GLU GLU A . n A 1 62 LYS 62 1917 1917 LYS LYS A . n A 1 63 LEU 63 1918 1918 LEU LEU A . n A 1 64 SER 64 1919 1919 SER SER A . n A 1 65 SER 65 1920 1920 SER SER A . n A 1 66 GLY 66 1921 1921 GLY GLY A . n A 1 67 GLN 67 1922 1922 GLN GLN A . n A 1 68 TYR 68 1923 1923 TYR TYR A . n A 1 69 PRO 69 1924 1924 PRO PRO A . n A 1 70 ASN 70 1925 1925 ASN ASN A . n A 1 71 LEU 71 1926 1926 LEU LEU A . n A 1 72 GLU 72 1927 1927 GLU GLU A . n A 1 73 THR 73 1928 1928 THR THR A . n A 1 74 PHE 74 1929 1929 PHE PHE A . n A 1 75 ALA 75 1930 1930 ALA ALA A . n A 1 76 LEU 76 1931 1931 LEU LEU A . n A 1 77 ASP 77 1932 1932 ASP ASP A . n A 1 78 VAL 78 1933 1933 VAL VAL A . n A 1 79 ARG 79 1934 1934 ARG ARG A . n A 1 80 LEU 80 1935 1935 LEU LEU A . n A 1 81 VAL 81 1936 1936 VAL VAL A . n A 1 82 PHE 82 1937 1937 PHE PHE A . n A 1 83 ASP 83 1938 1938 ASP ASP A . n A 1 84 ASN 84 1939 1939 ASN ASN A . n A 1 85 CYS 85 1940 1940 CYS CYS A . n A 1 86 GLU 86 1941 1941 GLU GLU A . n A 1 87 THR 87 1942 1942 THR THR A . n A 1 88 PHE 88 1943 1943 PHE PHE A . n A 1 89 ASN 89 1944 1944 ASN ASN A . n A 1 90 GLU 90 1945 1945 GLU GLU A . n A 1 91 ASP 91 1946 1946 ASP ASP A . n A 1 92 ASP 92 1947 1947 ASP ASP A . n A 1 93 SER 93 1948 1948 SER SER A . n A 1 94 ASP 94 1949 1949 ASP ASP A . n A 1 95 ILE 95 1950 1950 ILE ILE A . n A 1 96 GLY 96 1951 1951 GLY GLY A . n A 1 97 ARG 97 1952 1952 ARG ARG A . n A 1 98 ALA 98 1953 1953 ALA ALA A . n A 1 99 GLY 99 1954 1954 GLY GLY A . n A 1 100 HIS 100 1955 1955 HIS HIS A . n A 1 101 ASN 101 1956 1956 ASN ASN A . n A 1 102 MET 102 1957 1957 MET MET A . n A 1 103 ARG 103 1958 1958 ARG ARG A . n A 1 104 LYS 104 1959 1959 LYS LYS A . n A 1 105 TYR 105 1960 1960 TYR TYR A . n A 1 106 PHE 106 1961 1961 PHE PHE A . n A 1 107 GLU 107 1962 1962 GLU GLU A . n A 1 108 LYS 108 1963 1963 LYS LYS A . n A 1 109 LYS 109 1964 1964 LYS LYS A . n A 1 110 TRP 110 1965 1965 TRP TRP A . n A 1 111 THR 111 1966 1966 THR THR A . n A 1 112 ASP 112 1967 1967 ASP ASP A . n A 1 113 THR 113 1968 1968 THR THR A . n A 1 114 PHE 114 1969 1969 PHE PHE A . n A 1 115 LYS 115 1970 1970 LYS LYS A . n A 1 116 VAL 116 1971 ? ? ? A . n A 1 117 SER 117 1972 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZYB 1 2971 2971 ZYB ZYB A . C 3 MOH 1 2972 2972 MOH MOH A . D 3 MOH 1 2973 2973 MOH MOH A . E 3 MOH 1 2974 2974 MOH MOH A . F 4 HOH 1 2001 2001 HOH HOH A . F 4 HOH 2 2002 2002 HOH HOH A . F 4 HOH 3 2003 2003 HOH HOH A . F 4 HOH 4 2004 2004 HOH HOH A . F 4 HOH 5 2005 2005 HOH HOH A . F 4 HOH 6 2006 2006 HOH HOH A . F 4 HOH 7 2007 2007 HOH HOH A . F 4 HOH 8 2008 2008 HOH HOH A . F 4 HOH 9 2009 2009 HOH HOH A . F 4 HOH 10 2010 2010 HOH HOH A . F 4 HOH 11 2011 2011 HOH HOH A . F 4 HOH 12 2012 2012 HOH HOH A . F 4 HOH 13 2013 2013 HOH HOH A . F 4 HOH 14 2014 2014 HOH HOH A . F 4 HOH 15 2015 2015 HOH HOH A . F 4 HOH 16 2016 2016 HOH HOH A . F 4 HOH 17 2017 2017 HOH HOH A . F 4 HOH 18 2018 2018 HOH HOH A . F 4 HOH 19 2019 2019 HOH HOH A . F 4 HOH 20 2020 2020 HOH HOH A . F 4 HOH 21 2021 2021 HOH HOH A . F 4 HOH 22 2022 2022 HOH HOH A . F 4 HOH 23 2023 2023 HOH HOH A . F 4 HOH 24 2024 2024 HOH HOH A . F 4 HOH 25 2025 2025 HOH HOH A . F 4 HOH 26 2026 2026 HOH HOH A . F 4 HOH 27 2027 2027 HOH HOH A . F 4 HOH 28 2028 2028 HOH HOH A . F 4 HOH 29 2029 2029 HOH HOH A . F 4 HOH 30 2030 2030 HOH HOH A . F 4 HOH 31 2031 2031 HOH HOH A . F 4 HOH 32 2032 2032 HOH HOH A . F 4 HOH 33 2033 2033 HOH HOH A . F 4 HOH 34 2034 2034 HOH HOH A . F 4 HOH 35 2035 2035 HOH HOH A . F 4 HOH 36 2036 2036 HOH HOH A . F 4 HOH 37 2037 2037 HOH HOH A . F 4 HOH 38 2038 2038 HOH HOH A . F 4 HOH 39 2039 2039 HOH HOH A . F 4 HOH 40 2040 2040 HOH HOH A . F 4 HOH 41 2041 2041 HOH HOH A . F 4 HOH 42 2042 2042 HOH HOH A . F 4 HOH 43 2043 2043 HOH HOH A . F 4 HOH 44 2044 2044 HOH HOH A . F 4 HOH 45 2045 2045 HOH HOH A . F 4 HOH 46 2046 2046 HOH HOH A . F 4 HOH 47 2047 2047 HOH HOH A . F 4 HOH 48 2048 2048 HOH HOH A . F 4 HOH 49 2049 2049 HOH HOH A . F 4 HOH 50 2050 2050 HOH HOH A . F 4 HOH 51 2051 2051 HOH HOH A . F 4 HOH 52 2052 2052 HOH HOH A . F 4 HOH 53 2053 2053 HOH HOH A . F 4 HOH 54 2054 2054 HOH HOH A . F 4 HOH 55 2055 2055 HOH HOH A . F 4 HOH 56 2056 2056 HOH HOH A . F 4 HOH 57 2057 2057 HOH HOH A . F 4 HOH 58 2058 2058 HOH HOH A . F 4 HOH 59 2059 2059 HOH HOH A . F 4 HOH 60 2060 2060 HOH HOH A . F 4 HOH 61 2061 2061 HOH HOH A . F 4 HOH 62 2062 2062 HOH HOH A . F 4 HOH 63 2063 2063 HOH HOH A . F 4 HOH 64 2064 2064 HOH HOH A . F 4 HOH 65 2065 2065 HOH HOH A . F 4 HOH 66 2066 2066 HOH HOH A . F 4 HOH 67 2067 2067 HOH HOH A . F 4 HOH 68 2068 2068 HOH HOH A . F 4 HOH 69 2069 2069 HOH HOH A . F 4 HOH 70 2070 2070 HOH HOH A . F 4 HOH 71 2071 2071 HOH HOH A . F 4 HOH 72 2072 2072 HOH HOH A . F 4 HOH 73 2073 2073 HOH HOH A . F 4 HOH 74 2074 2074 HOH HOH A . F 4 HOH 75 2075 2075 HOH HOH A . F 4 HOH 76 2076 2076 HOH HOH A . F 4 HOH 77 2077 2077 HOH HOH A . F 4 HOH 78 2078 2078 HOH HOH A . F 4 HOH 79 2079 2079 HOH HOH A . F 4 HOH 80 2080 2080 HOH HOH A . F 4 HOH 81 2081 2081 HOH HOH A . F 4 HOH 82 2082 2082 HOH HOH A . F 4 HOH 83 2083 2083 HOH HOH A . F 4 HOH 84 2084 2084 HOH HOH A . F 4 HOH 85 2085 2085 HOH HOH A . F 4 HOH 86 2086 2086 HOH HOH A . F 4 HOH 87 2087 2087 HOH HOH A . F 4 HOH 88 2088 2088 HOH HOH A . F 4 HOH 89 2089 2089 HOH HOH A . F 4 HOH 90 2090 2090 HOH HOH A . F 4 HOH 91 2091 2091 HOH HOH A . F 4 HOH 92 2092 2092 HOH HOH A . F 4 HOH 93 2093 2093 HOH HOH A . F 4 HOH 94 2094 2094 HOH HOH A . F 4 HOH 95 2095 2095 HOH HOH A . F 4 HOH 96 2096 2096 HOH HOH A . F 4 HOH 97 2097 2097 HOH HOH A . F 4 HOH 98 2098 2098 HOH HOH A . F 4 HOH 99 2099 2099 HOH HOH A . F 4 HOH 100 2100 2100 HOH HOH A . F 4 HOH 101 2101 2101 HOH HOH A . F 4 HOH 102 2102 2102 HOH HOH A . F 4 HOH 103 2103 2103 HOH HOH A . F 4 HOH 104 2104 2104 HOH HOH A . F 4 HOH 105 2105 2105 HOH HOH A . F 4 HOH 106 2106 2106 HOH HOH A . F 4 HOH 107 2107 2107 HOH HOH A . F 4 HOH 108 2108 2108 HOH HOH A . F 4 HOH 109 2109 2109 HOH HOH A . F 4 HOH 110 2110 2110 HOH HOH A . F 4 HOH 111 2111 2111 HOH HOH A . F 4 HOH 112 2112 2112 HOH HOH A . F 4 HOH 113 2113 2113 HOH HOH A . F 4 HOH 114 2114 2114 HOH HOH A . F 4 HOH 115 2115 2115 HOH HOH A . F 4 HOH 116 2116 2116 HOH HOH A . F 4 HOH 117 2117 2117 HOH HOH A . F 4 HOH 118 2118 2118 HOH HOH A . F 4 HOH 119 2119 2119 HOH HOH A . F 4 HOH 120 2120 2120 HOH HOH A . F 4 HOH 121 2121 2121 HOH HOH A . F 4 HOH 122 2122 2122 HOH HOH A . F 4 HOH 123 2123 2123 HOH HOH A . F 4 HOH 124 2124 2124 HOH HOH A . F 4 HOH 125 2125 2125 HOH HOH A . F 4 HOH 126 2126 2126 HOH HOH A . F 4 HOH 127 2127 2127 HOH HOH A . F 4 HOH 128 2128 2128 HOH HOH A . F 4 HOH 129 2129 2129 HOH HOH A . F 4 HOH 130 2130 2130 HOH HOH A . F 4 HOH 131 2131 2131 HOH HOH A . F 4 HOH 132 2132 2132 HOH HOH A . F 4 HOH 133 2133 2133 HOH HOH A . F 4 HOH 134 2134 2134 HOH HOH A . F 4 HOH 135 2135 2135 HOH HOH A . F 4 HOH 136 2136 2136 HOH HOH A . F 4 HOH 137 2137 2137 HOH HOH A . F 4 HOH 138 2138 2138 HOH HOH A . F 4 HOH 139 2139 2139 HOH HOH A . F 4 HOH 140 2140 2140 HOH HOH A . F 4 HOH 141 2141 2141 HOH HOH A . F 4 HOH 142 2142 2142 HOH HOH A . F 4 HOH 143 2143 2143 HOH HOH A . F 4 HOH 144 2144 2144 HOH HOH A . F 4 HOH 145 2145 2145 HOH HOH A . F 4 HOH 146 2146 2146 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2050 ? 1 MORE -16.8 ? 1 'SSA (A^2)' 14260 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_655 -x+1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 80.3700000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 28.8350000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-04-02 2 'Structure model' 1 1 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation_author # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_citation_author.name' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 51.7028 17.1821 14.0205 0.5031 0.3420 0.2895 -0.0671 0.0101 0.0176 5.7992 3.5258 6.0477 3.2401 2.5199 1.0981 -0.1168 -0.2207 -0.2330 -0.5495 0.0610 -0.3682 0.0226 -0.7649 0.0478 'X-RAY DIFFRACTION' 2 ? refined 42.4520 13.1926 21.0656 0.4230 0.6859 0.6532 0.0898 -0.0825 0.3308 4.0626 3.8144 6.1364 -2.3137 -4.9969 3.1409 -1.3114 -0.2286 0.6970 0.3171 0.9615 0.6816 -0.3104 -0.3295 0.3944 'X-RAY DIFFRACTION' 3 ? refined 30.9297 10.9717 20.1215 0.6035 0.4343 0.6338 0.1338 0.1929 0.0564 4.8720 3.6220 8.1344 3.1681 -1.7368 2.2974 -0.5739 -0.1423 -2.0455 -1.0255 -0.4365 -1.5901 1.2374 1.0387 1.0343 'X-RAY DIFFRACTION' 4 ? refined 24.9736 15.8473 22.3096 0.5504 0.2498 0.3584 0.0361 -0.0383 -0.0065 7.0249 3.3900 5.0728 -2.8125 -3.8763 4.1012 -0.1369 0.1165 -0.6617 0.3502 -0.1947 0.0007 -0.1270 0.1826 0.2831 'X-RAY DIFFRACTION' 5 ? refined 19.8248 18.4657 26.3083 0.5076 0.2863 0.3932 0.0095 -0.0044 0.0375 2.1489 2.1690 2.2850 -0.0077 -1.3098 1.8074 -0.0188 -0.3145 -1.0586 0.7185 -0.1463 -0.1241 0.3930 -0.1897 0.1294 'X-RAY DIFFRACTION' 6 ? refined 16.5283 22.0022 29.2251 0.4324 0.2186 0.3336 -0.0452 0.0328 0.0454 2.4656 2.5873 2.0098 -2.1360 -0.4599 1.4935 -0.4931 0.1661 -0.8137 0.1552 -0.0212 -0.0001 1.0938 -0.2369 0.5633 'X-RAY DIFFRACTION' 7 ? refined 12.0584 25.3550 35.2106 0.4467 0.3712 0.3756 -0.0106 0.0959 0.0082 4.7862 2.5992 3.6907 3.4538 4.1960 2.9932 -0.1064 -0.4934 -0.2901 1.7150 -0.4447 1.3036 0.9397 -0.7725 0.5716 'X-RAY DIFFRACTION' 8 ? refined 12.2558 32.3038 28.3473 0.4360 0.2224 0.2301 0.0152 -0.0008 -0.0103 5.3004 2.4000 4.3745 0.1590 -1.0980 -3.1474 -0.2325 -0.1494 0.1781 0.1259 0.1722 0.4258 0.3504 -0.1263 0.1180 'X-RAY DIFFRACTION' 9 ? refined 11.5957 42.8738 20.2128 0.6552 0.2868 0.5332 0.0442 -0.1285 0.0101 6.0673 3.4729 3.8865 0.1395 -4.5955 1.0862 0.7227 0.6985 0.2798 -1.2197 -0.3470 1.8211 -0.5498 -0.5622 -0.3211 'X-RAY DIFFRACTION' 10 ? refined 16.3571 46.5450 23.5539 0.6036 0.2413 0.3569 0.0195 -0.0108 -0.0286 6.9735 5.2432 2.7354 3.1230 -1.1141 0.6592 -0.1130 0.1813 0.2376 -0.4285 0.0510 0.6625 -0.2049 0.0641 0.0605 'X-RAY DIFFRACTION' 11 ? refined 23.6802 41.1211 21.8391 0.5657 0.2720 0.3311 0.0137 0.0586 -0.0140 4.1251 4.0476 5.3170 -4.0621 -4.6203 4.6329 0.5135 0.3499 0.8601 -1.4383 0.0666 -1.1686 0.0655 0.8293 -0.6056 'X-RAY DIFFRACTION' 12 ? refined 18.4353 27.5606 20.0883 0.3986 0.2077 0.1894 0.0090 -0.0497 0.0046 6.0865 7.5463 9.7191 -1.8657 -3.0431 -0.7044 0.1115 0.5094 -0.0441 -0.4900 -0.0858 0.0693 -0.3356 -0.2682 -0.0162 'X-RAY DIFFRACTION' 13 ? refined 24.4900 23.9184 14.6960 0.6220 0.3324 0.2481 0.0078 -0.0132 -0.0121 5.1692 4.8504 2.0828 0.9603 1.6702 -0.5802 -0.0147 -0.0525 -0.0270 -0.8332 -0.1793 0.0751 0.1942 0.3749 0.1700 'X-RAY DIFFRACTION' 14 ? refined 31.2758 23.4917 21.2425 0.4733 0.4321 0.3634 0.0615 -0.0186 -0.0631 2.8833 3.2327 3.2546 -1.1102 1.3483 2.1959 -0.4924 -0.2820 -0.2985 1.0556 1.4267 -1.0819 0.1691 0.9400 -0.9175 'X-RAY DIFFRACTION' 15 ? refined 26.8945 27.5460 23.7543 0.4822 0.2508 0.1870 -0.0216 0.0094 -0.0124 8.0179 7.1898 8.3202 -5.8089 -6.6000 3.1255 -0.1503 0.0185 0.1006 -0.5472 -0.0187 -0.1842 -0.5116 0.1461 0.1819 'X-RAY DIFFRACTION' 16 ? refined 22.7495 36.5039 30.4054 0.4434 0.2548 0.2240 -0.0050 -0.0107 0.0143 2.6955 9.8561 3.7702 -3.5102 -2.0328 4.8267 0.1136 -0.0208 0.1876 0.2430 -0.0417 -0.2487 -0.0826 0.1457 -0.0535 'X-RAY DIFFRACTION' 17 ? refined 17.2344 37.4881 39.5019 0.6457 0.2743 0.2348 0.0444 -0.0230 -0.0001 5.3185 6.4588 5.7668 1.0649 -2.5329 1.0621 -0.1798 -0.3139 0.0723 1.0978 0.2017 0.2587 -0.1173 0.2469 -0.1121 'X-RAY DIFFRACTION' 18 ? refined 22.2045 26.2103 34.8182 0.5133 0.2435 0.2278 0.0105 -0.0345 0.0298 9.3593 8.2893 4.5231 0.5053 -4.8951 1.0187 -0.2980 -0.3294 -0.3719 0.9189 0.0026 0.2408 0.3713 0.0019 0.3063 'X-RAY DIFFRACTION' 19 ? refined 27.2243 20.7729 33.5863 0.5648 0.3303 0.2710 0.1217 -0.0692 0.0099 7.3775 6.7995 4.6886 0.9350 1.6224 -4.7865 0.1544 -0.1645 -0.6502 1.8910 0.2371 -0.4276 0.7722 1.0419 -0.1655 'X-RAY DIFFRACTION' 20 ? refined 29.3472 15.6284 31.7260 0.7479 0.4722 0.4878 0.2564 0.0149 -0.0419 2.6405 5.7804 2.6468 3.8115 0.0362 -0.6806 -0.3472 -0.9397 -0.9159 1.2543 0.7286 -0.3107 0.8458 1.6357 -0.4624 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1856:1859)' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1860:1864)' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1865:1868)' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1869:1873)' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1874:1877)' 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1878:1881)' 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1882:1885)' 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1886:1892)' 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1893:1896)' 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1897:1904)' 'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1905:1908)' 'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1909:1918)' 'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1919:1924)' 'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1925:1928)' 'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1929:1932)' 'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1933:1944)' 'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1945:1956)' 'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1957:1961)' 'X-RAY DIFFRACTION' 19 19 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1962:1966)' 'X-RAY DIFFRACTION' 20 20 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1967:1970)' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(PHENIX.REFINE)' ? 1 XDS 'data reduction' . ? 2 Aimless 'data scaling' . ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 2025 ? ? O A HOH 2026 ? ? 2.16 2 1 O A HOH 2021 ? ? O A HOH 2025 ? ? 2.17 3 1 O A HOH 2031 ? ? O A HOH 2137 ? ? 2.18 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 2005 ? 5.81 . 2 1 O ? A HOH 2035 ? 6.93 . 3 1 O ? A HOH 2036 ? 5.90 . 4 1 O ? A HOH 2038 ? 6.92 . 5 1 O ? A HOH 2146 ? 6.81 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 1863 ? CG ? A LYS 8 CG 2 1 Y 1 A LYS 1863 ? CD ? A LYS 8 CD 3 1 Y 1 A LYS 1863 ? CE ? A LYS 8 CE 4 1 Y 1 A LYS 1863 ? NZ ? A LYS 8 NZ 5 1 Y 1 A LYS 1868 ? CE ? A LYS 13 CE 6 1 Y 1 A LYS 1868 ? NZ ? A LYS 13 NZ 7 1 Y 1 A GLU 1927 ? CD ? A GLU 72 CD 8 1 Y 1 A GLU 1927 ? OE1 ? A GLU 72 OE1 9 1 Y 1 A GLU 1927 ? OE2 ? A GLU 72 OE2 10 1 Y 1 A LYS 1959 ? CE ? A LYS 104 CE 11 1 Y 1 A LYS 1959 ? NZ ? A LYS 104 NZ 12 1 Y 1 A LYS 1964 ? NZ ? A LYS 109 NZ 13 1 Y 1 A LYS 1970 ? CG ? A LYS 115 CG 14 1 Y 1 A LYS 1970 ? CD ? A LYS 115 CD 15 1 Y 1 A LYS 1970 ? CE ? A LYS 115 CE 16 1 Y 1 A LYS 1970 ? NZ ? A LYS 115 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 1971 ? A VAL 116 2 1 Y 1 A SER 1972 ? A SER 117 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 4-Fluorobenzamidoxime ZYB 3 METHANOL MOH 4 water HOH #