data_4CYK # _entry.id 4CYK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.344 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4CYK PDBE EBI-60303 WWPDB D_1290060303 BMRB 19959 # _pdbx_database_related.db_id 19959 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4CYK _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2014-04-11 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wolf, J.' 1 'Valkov, E.' 2 'Allen, M.D.' 3 'Meineke, B.' 4 'Gordiyenko, Y.' 5 'McLaughlin, S.H.' 6 'Olsen, T.M.' 7 'Robinson, C.V.' 8 'Bycroft, M.' 9 'Stewart, M.' 10 'Passmore, L.A.' 11 # _citation.id primary _citation.title 'Structural Basis for Pan3 Binding to Pan2 and its Function in Mrna Recruitment and Deadenylation.' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 33 _citation.page_first 1514 _citation.page_last ? _citation.year 2014 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24872509 _citation.pdbx_database_id_DOI 10.15252/EMBJ.201488373 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wolf, J.' 1 ? primary 'Valkov, E.' 2 ? primary 'Allen, M.D.' 3 ? primary 'Meineke, B.' 4 ? primary 'Gordiyenko, Y.' 5 ? primary 'Mclaughlin, S.H.' 6 ? primary 'Olsen, T.M.' 7 ? primary 'Robinson, C.V.' 8 ? primary 'Bycroft, M.' 9 ? primary 'Stewart, M.' 10 ? primary 'Passmore, L.A.' 11 ? # _cell.entry_id 4CYK _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4CYK _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3' 4741.405 1 ? ? 'RESIDUES 1-41' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PAB1P-DEPENDENT POLY(A)-NUCLEASE, PAN3P' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTAT _entity_poly.pdbx_seq_one_letter_code_can MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTAT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LYS n 1 4 ILE n 1 5 ASN n 1 6 PRO n 1 7 ASP n 1 8 TRP n 1 9 ALA n 1 10 LYS n 1 11 ASP n 1 12 ILE n 1 13 PRO n 1 14 CYS n 1 15 ARG n 1 16 ASN n 1 17 ILE n 1 18 THR n 1 19 ILE n 1 20 TYR n 1 21 GLY n 1 22 TYR n 1 23 CYS n 1 24 LYS n 1 25 LYS n 1 26 GLU n 1 27 LYS n 1 28 GLU n 1 29 GLY n 1 30 CYS n 1 31 PRO n 1 32 PHE n 1 33 LYS n 1 34 HIS n 1 35 SER n 1 36 ASP n 1 37 ASN n 1 38 THR n 1 39 THR n 1 40 ALA n 1 41 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;BAKER'S YEAST ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'SACCHAROMYCES CEREVISIAE' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI B41' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 869694 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PRSETA _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PHLTV _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PAN3_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P36102 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4CYK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 41 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P36102 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 41 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 41 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label conditions_1 # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% WATER / 10% D2O' _pdbx_nmr_sample_details.solvent_system ? _pdbx_nmr_sample_details.label ? _pdbx_nmr_sample_details.type ? _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 'AVANCE DRX' Bruker 600 ? 2 'AVANCE DRX' Bruker 800 ? # _pdbx_nmr_refine.entry_id 4CYK _pdbx_nmr_refine.method 'CNS 1.2' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 4CYK _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING HOMONUCLEAR AND TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C, 15N-LABELED PROTEIN' # _pdbx_nmr_ensemble.entry_id 4CYK _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'NO VIOLATIONS' # _pdbx_nmr_representative.entry_id 4CYK _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS 1.2 'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' CNS ? ? 2 # _exptl.entry_id 4CYK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 4CYK _struct.title 'Structural basis for binding of Pan3 to Pan2 and its function in mRNA recruitment and deadenylation' _struct.pdbx_descriptor 'PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4CYK _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'TRANSCRIPTION, PAN3P, PAN2P, POLYA, RNA, DEADENYLATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 5 ? LYS A 10 ? ASN A 5 LYS A 10 1 ? 6 HELX_P HELX_P2 2 CYS A 14 ? TYR A 20 ? CYS A 14 TYR A 20 1 ? 7 HELX_P HELX_P3 3 CYS A 23 ? GLU A 28 ? CYS A 23 GLU A 28 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 14 A ZN 42 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc2 metalc ? ? A CYS 23 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 23 A ZN 42 1_555 ? ? ? ? ? ? ? 2.292 ? ? metalc3 metalc ? ? A CYS 30 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 30 A ZN 42 1_555 ? ? ? ? ? ? ? 2.279 ? ? metalc4 metalc ? ? A HIS 34 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 34 A ZN 42 1_555 ? ? ? ? ? ? ? 2.034 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 42 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 42' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 14 ? CYS A 14 . ? 1_555 ? 2 AC1 4 CYS A 23 ? CYS A 23 . ? 1_555 ? 3 AC1 4 CYS A 30 ? CYS A 30 . ? 1_555 ? 4 AC1 4 HIS A 34 ? HIS A 34 . ? 1_555 ? # _database_PDB_matrix.entry_id 4CYK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4CYK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 THR 41 41 41 THR THR A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 42 _pdbx_nonpoly_scheme.auth_seq_num 42 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 42 ? 1_555 SG ? A CYS 23 ? A CYS 23 ? 1_555 117.7 ? 2 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 42 ? 1_555 SG ? A CYS 30 ? A CYS 30 ? 1_555 115.3 ? 3 SG ? A CYS 23 ? A CYS 23 ? 1_555 ZN ? B ZN . ? A ZN 42 ? 1_555 SG ? A CYS 30 ? A CYS 30 ? 1_555 109.5 ? 4 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 42 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 94.4 ? 5 SG ? A CYS 23 ? A CYS 23 ? 1_555 ZN ? B ZN . ? A ZN 42 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 101.7 ? 6 SG ? A CYS 30 ? A CYS 30 ? 1_555 ZN ? B ZN . ? A ZN 42 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 117.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-05-21 2 'Structure model' 1 1 2014-05-28 3 'Structure model' 1 2 2014-06-04 4 'Structure model' 1 3 2014-06-11 5 'Structure model' 1 4 2014-07-30 6 'Structure model' 1 5 2016-04-27 7 'Structure model' 1 6 2021-06-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 3 'Structure model' 'Atomic model' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' 5 6 'Structure model' 'Atomic model' 6 6 'Structure model' 'Derived calculations' 7 6 'Structure model' Other 8 7 'Structure model' 'Data collection' 9 7 'Structure model' 'Derived calculations' 10 7 'Structure model' 'Experimental preparation' 11 7 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 7 'Structure model' pdbx_database_status 2 7 'Structure model' pdbx_nmr_exptl_sample_conditions 3 7 'Structure model' pdbx_nmr_representative 4 7 'Structure model' pdbx_nmr_spectrometer 5 7 'Structure model' struct_conn 6 7 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 7 'Structure model' '_pdbx_database_status.status_code_cs' 2 7 'Structure model' '_pdbx_database_status.status_code_mr' 3 7 'Structure model' '_pdbx_nmr_exptl_sample_conditions.label' 4 7 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pressure' 5 7 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pressure_units' 6 7 'Structure model' '_pdbx_nmr_exptl_sample_conditions.temperature' 7 7 'Structure model' '_pdbx_nmr_representative.selection_criteria' 8 7 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 9 7 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 10 7 'Structure model' '_struct_conn.ptnr1_label_asym_id' 11 7 'Structure model' '_struct_conn.ptnr1_label_atom_id' 12 7 'Structure model' '_struct_conn.ptnr1_label_comp_id' 13 7 'Structure model' '_struct_conn.ptnr1_label_seq_id' 14 7 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 15 7 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 16 7 'Structure model' '_struct_conn.ptnr2_label_asym_id' 17 7 'Structure model' '_struct_conn.ptnr2_label_atom_id' 18 7 'Structure model' '_struct_conn.ptnr2_label_comp_id' 19 7 'Structure model' '_struct_conn.ptnr2_label_seq_id' 20 7 'Structure model' '_struct_site.pdbx_auth_asym_id' 21 7 'Structure model' '_struct_site.pdbx_auth_comp_id' 22 7 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 O A ASN 5 ? ? H A TRP 8 ? ? 1.58 2 6 O A ASN 5 ? ? H A TRP 8 ? ? 1.59 3 10 O A ASN 5 ? ? H A TRP 8 ? ? 1.58 4 14 O A ARG 15 ? ? H A ILE 19 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 32 ? ? 107.50 154.06 2 2 ASP A 2 ? ? -124.40 -70.68 3 2 PHE A 32 ? ? 107.38 155.13 4 2 THR A 38 ? ? 61.21 153.45 5 2 THR A 39 ? ? 61.09 102.98 6 3 ASP A 2 ? ? -104.22 41.56 7 3 LYS A 3 ? ? -59.14 90.55 8 3 PHE A 32 ? ? 108.53 154.65 9 3 ASP A 36 ? ? 59.49 176.14 10 3 ASN A 37 ? ? -143.64 -48.00 11 4 PHE A 32 ? ? 105.68 154.28 12 4 ASP A 36 ? ? -98.12 33.28 13 5 PHE A 32 ? ? 107.81 155.61 14 5 ASP A 36 ? ? 59.98 161.80 15 5 THR A 38 ? ? -98.21 32.49 16 6 ASP A 2 ? ? -165.96 -43.89 17 6 PHE A 32 ? ? 108.33 153.80 18 7 PHE A 32 ? ? 106.56 157.20 19 7 HIS A 34 ? ? -105.13 79.08 20 8 ASP A 2 ? ? -175.56 -40.07 21 8 PHE A 32 ? ? 106.89 153.73 22 8 ASN A 37 ? ? -56.98 101.49 23 8 THR A 38 ? ? -163.88 78.94 24 8 ALA A 40 ? ? 59.78 81.90 25 9 PHE A 32 ? ? 109.06 154.37 26 9 ASP A 36 ? ? -62.08 -175.77 27 9 ALA A 40 ? ? -153.24 31.19 28 10 ASP A 2 ? ? -80.40 -77.98 29 10 PHE A 32 ? ? 107.51 156.10 30 10 THR A 39 ? ? -140.93 -67.69 31 11 PHE A 32 ? ? 107.48 154.08 32 11 ASP A 36 ? ? -130.66 -48.85 33 12 PHE A 32 ? ? 108.97 154.60 34 12 THR A 39 ? ? -97.89 37.59 35 13 PHE A 32 ? ? 106.55 154.29 36 13 THR A 38 ? ? -65.11 86.28 37 13 ALA A 40 ? ? -158.92 -70.90 38 14 ASP A 2 ? ? -142.19 -46.88 39 14 PHE A 32 ? ? 108.01 156.90 40 14 HIS A 34 ? ? -101.63 78.81 41 14 ASN A 37 ? ? 62.39 121.17 42 15 PHE A 32 ? ? 107.77 154.53 43 15 ALA A 40 ? ? 67.84 95.22 44 16 ASP A 2 ? ? -137.81 -47.58 45 16 PHE A 32 ? ? 109.45 153.02 46 16 ASN A 37 ? ? -152.30 58.98 47 17 PHE A 32 ? ? 107.31 153.80 48 17 ASP A 36 ? ? 61.43 162.18 49 17 ASN A 37 ? ? 61.39 154.14 50 17 THR A 38 ? ? -158.33 -67.18 51 18 ASP A 2 ? ? -176.72 -39.77 52 18 PHE A 32 ? ? 107.99 155.18 53 18 ASP A 36 ? ? -111.04 74.54 54 18 ASN A 37 ? ? -173.25 147.13 55 19 ASP A 2 ? ? -141.54 -47.32 56 19 PHE A 32 ? ? 108.46 154.82 57 19 ASP A 36 ? ? 61.03 159.40 58 19 ASN A 37 ? ? -126.04 -56.31 59 20 PHE A 32 ? ? 109.16 154.77 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #