data_4D7X # _entry.id 4D7X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4D7X PDBE EBI-62416 WWPDB D_1290062416 BMRB 25372 # _pdbx_database_related.db_id 25372 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4D7X _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2014-11-30 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Boeszoermenyi, A.' 1 'Wagner, G.' 2 'Naar, A.M.' 3 'Arthanari, H.' 4 # _citation.id primary _citation.title 'Inhibiting Fungal Multidrug Resistance by Disrupting an Activator-Mediator Interaction.' _citation.journal_abbrev Nature _citation.journal_volume 530 _citation.page_first 485 _citation.page_last ? _citation.year 2016 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26886795 _citation.pdbx_database_id_DOI 10.1038/NATURE16963 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nishikawa, J.L.' 1 ? primary 'Boeszoermenyi, A.' 2 ? primary 'Vale-Silva, L.A.' 3 ? primary 'Torelli, R.' 4 ? primary 'Posteraro, B.' 5 ? primary 'Sohn, Y.' 6 ? primary 'Ji, F.' 7 ? primary 'Gelev, V.' 8 ? primary 'Sanglard, D.' 9 ? primary 'Sanguinetti, M.' 10 ? primary 'Sadreyev, R.I.' 11 ? primary 'Mukherjee, G.' 12 ? primary 'Bhyravabhotla, J.' 13 ? primary 'Buhrlage, S.J.' 14 ? primary 'Gray, N.S.' 15 ? primary 'Wagner, G.' 16 ? primary 'Naar, A.M.' 17 ? primary 'Arthanari, H.' 18 ? # _cell.entry_id 4D7X _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4D7X _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'MEDIATOR OF RNA POLYMERASE II TRANSCRIPTION SUBUNIT 15' _entity.formula_weight 9743.164 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'KIX DOMAIN, RESIDUES 1-86' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MEDIATOR COMPLEX SUBUNIT 15, TRANSCRIPTION REGULATORY PROTE IN GAL11, C. GLABRATA GAL11A KIX DOMAIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSSKETIPMHQRSQNVAELLTVLMDINKINGGDSTTAEKMKVHAKSFEAALFEKSSSKEEYQKTMKSKIDAMRSTRDKRK RESVGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MSSKETIPMHQRSQNVAELLTVLMDINKINGGDSTTAEKMKVHAKSFEAALFEKSSSKEEYQKTMKSKIDAMRSTRDKRK RESVGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 SER n 1 4 LYS n 1 5 GLU n 1 6 THR n 1 7 ILE n 1 8 PRO n 1 9 MET n 1 10 HIS n 1 11 GLN n 1 12 ARG n 1 13 SER n 1 14 GLN n 1 15 ASN n 1 16 VAL n 1 17 ALA n 1 18 GLU n 1 19 LEU n 1 20 LEU n 1 21 THR n 1 22 VAL n 1 23 LEU n 1 24 MET n 1 25 ASP n 1 26 ILE n 1 27 ASN n 1 28 LYS n 1 29 ILE n 1 30 ASN n 1 31 GLY n 1 32 GLY n 1 33 ASP n 1 34 SER n 1 35 THR n 1 36 THR n 1 37 ALA n 1 38 GLU n 1 39 LYS n 1 40 MET n 1 41 LYS n 1 42 VAL n 1 43 HIS n 1 44 ALA n 1 45 LYS n 1 46 SER n 1 47 PHE n 1 48 GLU n 1 49 ALA n 1 50 ALA n 1 51 LEU n 1 52 PHE n 1 53 GLU n 1 54 LYS n 1 55 SER n 1 56 SER n 1 57 SER n 1 58 LYS n 1 59 GLU n 1 60 GLU n 1 61 TYR n 1 62 GLN n 1 63 LYS n 1 64 THR n 1 65 MET n 1 66 LYS n 1 67 SER n 1 68 LYS n 1 69 ILE n 1 70 ASP n 1 71 ALA n 1 72 MET n 1 73 ARG n 1 74 SER n 1 75 THR n 1 76 ARG n 1 77 ASP n 1 78 LYS n 1 79 ARG n 1 80 LYS n 1 81 ARG n 1 82 GLU n 1 83 SER n 1 84 VAL n 1 85 GLY n 1 86 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'CANDIDA GLABRATA' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5478 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 2001 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET24B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MED15_CANGA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q6FRS9 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4D7X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6FRS9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 86 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 CG_15NHSQC 1 2 2 15NNOESY 1 3 3 '13CHSQC_ ANOESY' 1 4 4 13CNOESY 1 5 5 BRUKER_ILV_HSQC 1 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298.15 atm 1.0 6.5 150.0 ? pH K 2 298.15 atm 1.0 6.5 150.0 ? pH K 3 298.15 atm 1.0 6.5 150.0 ? pH K 4 298.15 atm 1.0 6.5 150.0 ? pH K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents 1 '93% H2O/7% D2O' 2 '93% H2O/7% D2O' 3 '93% H2O/7% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 AVANCE Bruker 600 2 INOVA Varian 900 3 ? ? 700 4 ? ? 800 # _pdbx_nmr_refine.entry_id 4D7X _pdbx_nmr_refine.method 'CYANA AND AMBER' _pdbx_nmr_refine.details ;STRUCTURE REFINEMENT WAS PERFORMED THROUGH THE WENMR WEB-INTERACE WITH AMBER. BERTINI, I., CASE, D. A., FERELLA, L., GIACHETTI, A. & ROSATO, A., 2011, A GRID-ENABLED WEB PORTAL FOR NMR STRUCTURE REFINEMENT WITH AMBER. BIOINFORMATICS 27, 2384- -2390 ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 4D7X _pdbx_nmr_details.text ;BACKBONE AND SIDE-CHAIN RESONANCES WERE ASSIGNED USING TRIPLE-RESONANCE MNR SPECTROSCOPY. THE STRUCTURE WAS CALCULATED FROM NOES FROM 15N - AND 13C - FILTERED NOESY EXPERIMENTS. ; # _pdbx_nmr_ensemble.entry_id 4D7X _pdbx_nmr_ensemble.conformers_calculated_total_number 10 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY' # _pdbx_nmr_representative.entry_id 4D7X _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Amber ? 'I. BERTINI, D.A. CASE, L. FERELLA, A. GIACHETTI, A. ROSATO' 1 'structure solution' 'CcpNmr Analysis' 2.1 ? 2 'structure solution' NMRPipe ANY ? 3 'structure solution' NMRDraw ANY ? 4 'structure solution' 'CcpNmr Analysis' 2.4 ? 5 'structure solution' TALOS+ 2009.0605.17 ? 6 'structure solution' CYANA 3.0 ? 7 # _exptl.entry_id 4D7X _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 4D7X _struct.title 'Solution Structure of the Mediator Gall11 KIX Domain of C. Glabrata' _struct.pdbx_descriptor 'MEDIATOR OF RNA POLYMERASE II TRANSCRIPTION SUBUNIT 15' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4D7X _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text TRANSCRIPTION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 1 ? THR A 6 ? MET A 1 THR A 6 5 ? 6 HELX_P HELX_P2 2 PRO A 8 ? ASN A 30 ? PRO A 8 ASN A 30 1 ? 23 HELX_P HELX_P3 3 ASP A 33 ? GLU A 53 ? ASP A 33 GLU A 53 1 ? 21 HELX_P HELX_P4 4 SER A 57 ? GLY A 85 ? SER A 57 GLY A 85 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 4D7X _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4D7X _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 SER 86 86 86 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-09 2 'Structure model' 1 1 2016-02-17 3 'Structure model' 1 2 2016-03-02 4 'Structure model' 2 0 2019-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.Cartn_x' 2 4 'Structure model' '_atom_site.Cartn_y' 3 4 'Structure model' '_atom_site.Cartn_z' 4 4 'Structure model' '_pdbx_database_status.status_code_cs' 5 4 'Structure model' '_pdbx_database_status.status_code_mr' 6 4 'Structure model' '_pdbx_nmr_software.name' 7 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.28 120.30 3.98 0.50 N 2 1 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.71 120.30 4.41 0.50 N 3 1 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.53 120.30 3.23 0.50 N 4 1 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH1 A ARG 79 ? ? 123.87 120.30 3.57 0.50 N 5 2 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.76 120.30 3.46 0.50 N 6 2 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 124.98 120.30 4.68 0.50 N 7 2 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH1 A ARG 79 ? ? 124.18 120.30 3.88 0.50 N 8 2 NE A ARG 81 ? ? CZ A ARG 81 ? ? NH1 A ARG 81 ? ? 123.34 120.30 3.04 0.50 N 9 3 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.80 120.30 3.50 0.50 N 10 3 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.81 120.30 4.51 0.50 N 11 3 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH1 A ARG 79 ? ? 123.35 120.30 3.05 0.50 N 12 4 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.79 120.30 3.49 0.50 N 13 4 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.03 120.30 3.73 0.50 N 14 4 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.71 120.30 3.41 0.50 N 15 4 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH1 A ARG 79 ? ? 123.52 120.30 3.22 0.50 N 16 4 NE A ARG 81 ? ? CZ A ARG 81 ? ? NH1 A ARG 81 ? ? 123.69 120.30 3.39 0.50 N 17 5 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 125.20 120.30 4.90 0.50 N 18 5 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.57 120.30 4.27 0.50 N 19 5 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.65 120.30 3.35 0.50 N 20 5 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH1 A ARG 79 ? ? 124.09 120.30 3.79 0.50 N 21 5 NE A ARG 81 ? ? CZ A ARG 81 ? ? NH1 A ARG 81 ? ? 123.67 120.30 3.37 0.50 N 22 6 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.03 120.30 3.73 0.50 N 23 6 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.97 120.30 3.67 0.50 N 24 7 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.57 120.30 4.27 0.50 N 25 7 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 123.80 120.30 3.50 0.50 N 26 8 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.23 120.30 3.93 0.50 N 27 8 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH1 A ARG 79 ? ? 124.62 120.30 4.32 0.50 N 28 9 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 125.19 120.30 4.89 0.50 N 29 9 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 124.57 120.30 4.27 0.50 N 30 9 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH1 A ARG 79 ? ? 123.56 120.30 3.26 0.50 N 31 9 NE A ARG 81 ? ? CZ A ARG 81 ? ? NH1 A ARG 81 ? ? 123.31 120.30 3.01 0.50 N 32 10 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.74 120.30 3.44 0.50 N 33 10 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 123.77 120.30 3.47 0.50 N 34 10 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.93 120.30 3.63 0.50 N 35 10 NE A ARG 81 ? ? CZ A ARG 81 ? ? NH1 A ARG 81 ? ? 123.32 120.30 3.02 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 55 ? ? -53.03 18.22 2 2 SER A 55 ? ? -64.15 20.53 3 3 SER A 2 ? ? -67.06 3.92 4 3 SER A 55 ? ? -66.38 21.10 5 4 SER A 2 ? ? 66.18 -2.47 6 4 SER A 55 ? ? -66.41 22.20 7 5 SER A 55 ? ? -62.32 23.60 8 6 SER A 55 ? ? -69.06 21.83 9 6 SER A 56 ? ? -68.41 1.21 10 7 SER A 2 ? ? -77.18 25.41 11 7 SER A 55 ? ? -66.62 22.48 12 7 VAL A 84 ? ? 55.99 87.06 13 8 SER A 55 ? ? -59.78 26.61 14 8 SER A 56 ? ? -57.66 -1.07 15 9 SER A 55 ? ? -67.34 23.55 16 10 SER A 55 ? ? -69.30 19.26 17 10 VAL A 84 ? ? 65.22 -21.87 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 7 _pdbx_validate_peptide_omega.auth_comp_id_1 SER _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 56 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 SER _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 57 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 143.69 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 5 ARG A 76 ? ? 0.082 'SIDE CHAIN' 2 8 ARG A 12 ? ? 0.097 'SIDE CHAIN' #