data_4DIT # _entry.id 4DIT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4DIT RCSB RCSB070382 WWPDB D_1000070382 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4DIT _pdbx_database_status.recvd_initial_deposition_date 2012-01-31 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kim, H.T.' 1 'Lee, S.C.' 2 'Chang, H.J.' 3 # _citation.id primary _citation.title 'Crystal Structure of GSK3beta in complex with a Imidazolopyridine inhibitor' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kim, H.T.' 1 primary 'Lee, S.C.' 2 primary 'Chang, H.J.' 3 # _cell.entry_id 4DIT _cell.length_a 70.784 _cell.length_b 72.540 _cell.length_c 80.663 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4DIT _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Glycogen synthase kinase-3 beta' 43330.516 1 '2.7.11.26, 2.7.11.1' ? 'protein kinase domain, UNP residues 27-393' ? 2 non-polymer syn 'N-(pyridin-3-yl)-2-(thiophen-3-yl)-3H-imidazo[4,5-b]pyridine-7-carboxamide' 321.356 1 ? ? ? ? 3 water nat water 18.015 41 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GSK-3 beta, Serine/threonine-protein kinase GSK3B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MRGSKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMR KLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDI KPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVS(PTR)ICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFP GDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHS FFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMR KLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDI KPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSG VDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDE LRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNAAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 LYS n 1 6 VAL n 1 7 SER n 1 8 ARG n 1 9 ASP n 1 10 LYS n 1 11 ASP n 1 12 GLY n 1 13 SER n 1 14 LYS n 1 15 VAL n 1 16 THR n 1 17 THR n 1 18 VAL n 1 19 VAL n 1 20 ALA n 1 21 THR n 1 22 PRO n 1 23 GLY n 1 24 GLN n 1 25 GLY n 1 26 PRO n 1 27 ASP n 1 28 ARG n 1 29 PRO n 1 30 GLN n 1 31 GLU n 1 32 VAL n 1 33 SER n 1 34 TYR n 1 35 THR n 1 36 ASP n 1 37 THR n 1 38 LYS n 1 39 VAL n 1 40 ILE n 1 41 GLY n 1 42 ASN n 1 43 GLY n 1 44 SER n 1 45 PHE n 1 46 GLY n 1 47 VAL n 1 48 VAL n 1 49 TYR n 1 50 GLN n 1 51 ALA n 1 52 LYS n 1 53 LEU n 1 54 CYS n 1 55 ASP n 1 56 SER n 1 57 GLY n 1 58 GLU n 1 59 LEU n 1 60 VAL n 1 61 ALA n 1 62 ILE n 1 63 LYS n 1 64 LYS n 1 65 VAL n 1 66 LEU n 1 67 GLN n 1 68 ASP n 1 69 LYS n 1 70 ARG n 1 71 PHE n 1 72 LYS n 1 73 ASN n 1 74 ARG n 1 75 GLU n 1 76 LEU n 1 77 GLN n 1 78 ILE n 1 79 MET n 1 80 ARG n 1 81 LYS n 1 82 LEU n 1 83 ASP n 1 84 HIS n 1 85 CYS n 1 86 ASN n 1 87 ILE n 1 88 VAL n 1 89 ARG n 1 90 LEU n 1 91 ARG n 1 92 TYR n 1 93 PHE n 1 94 PHE n 1 95 TYR n 1 96 SER n 1 97 SER n 1 98 GLY n 1 99 GLU n 1 100 LYS n 1 101 LYS n 1 102 ASP n 1 103 GLU n 1 104 VAL n 1 105 TYR n 1 106 LEU n 1 107 ASN n 1 108 LEU n 1 109 VAL n 1 110 LEU n 1 111 ASP n 1 112 TYR n 1 113 VAL n 1 114 PRO n 1 115 GLU n 1 116 THR n 1 117 VAL n 1 118 TYR n 1 119 ARG n 1 120 VAL n 1 121 ALA n 1 122 ARG n 1 123 HIS n 1 124 TYR n 1 125 SER n 1 126 ARG n 1 127 ALA n 1 128 LYS n 1 129 GLN n 1 130 THR n 1 131 LEU n 1 132 PRO n 1 133 VAL n 1 134 ILE n 1 135 TYR n 1 136 VAL n 1 137 LYS n 1 138 LEU n 1 139 TYR n 1 140 MET n 1 141 TYR n 1 142 GLN n 1 143 LEU n 1 144 PHE n 1 145 ARG n 1 146 SER n 1 147 LEU n 1 148 ALA n 1 149 TYR n 1 150 ILE n 1 151 HIS n 1 152 SER n 1 153 PHE n 1 154 GLY n 1 155 ILE n 1 156 CYS n 1 157 HIS n 1 158 ARG n 1 159 ASP n 1 160 ILE n 1 161 LYS n 1 162 PRO n 1 163 GLN n 1 164 ASN n 1 165 LEU n 1 166 LEU n 1 167 LEU n 1 168 ASP n 1 169 PRO n 1 170 ASP n 1 171 THR n 1 172 ALA n 1 173 VAL n 1 174 LEU n 1 175 LYS n 1 176 LEU n 1 177 CYS n 1 178 ASP n 1 179 PHE n 1 180 GLY n 1 181 SER n 1 182 ALA n 1 183 LYS n 1 184 GLN n 1 185 LEU n 1 186 VAL n 1 187 ARG n 1 188 GLY n 1 189 GLU n 1 190 PRO n 1 191 ASN n 1 192 VAL n 1 193 SER n 1 194 PTR n 1 195 ILE n 1 196 CYS n 1 197 SER n 1 198 ARG n 1 199 TYR n 1 200 TYR n 1 201 ARG n 1 202 ALA n 1 203 PRO n 1 204 GLU n 1 205 LEU n 1 206 ILE n 1 207 PHE n 1 208 GLY n 1 209 ALA n 1 210 THR n 1 211 ASP n 1 212 TYR n 1 213 THR n 1 214 SER n 1 215 SER n 1 216 ILE n 1 217 ASP n 1 218 VAL n 1 219 TRP n 1 220 SER n 1 221 ALA n 1 222 GLY n 1 223 CYS n 1 224 VAL n 1 225 LEU n 1 226 ALA n 1 227 GLU n 1 228 LEU n 1 229 LEU n 1 230 LEU n 1 231 GLY n 1 232 GLN n 1 233 PRO n 1 234 ILE n 1 235 PHE n 1 236 PRO n 1 237 GLY n 1 238 ASP n 1 239 SER n 1 240 GLY n 1 241 VAL n 1 242 ASP n 1 243 GLN n 1 244 LEU n 1 245 VAL n 1 246 GLU n 1 247 ILE n 1 248 ILE n 1 249 LYS n 1 250 VAL n 1 251 LEU n 1 252 GLY n 1 253 THR n 1 254 PRO n 1 255 THR n 1 256 ARG n 1 257 GLU n 1 258 GLN n 1 259 ILE n 1 260 ARG n 1 261 GLU n 1 262 MET n 1 263 ASN n 1 264 PRO n 1 265 ASN n 1 266 TYR n 1 267 THR n 1 268 GLU n 1 269 PHE n 1 270 LYS n 1 271 PHE n 1 272 PRO n 1 273 GLN n 1 274 ILE n 1 275 LYS n 1 276 ALA n 1 277 HIS n 1 278 PRO n 1 279 TRP n 1 280 THR n 1 281 LYS n 1 282 VAL n 1 283 PHE n 1 284 ARG n 1 285 PRO n 1 286 ARG n 1 287 THR n 1 288 PRO n 1 289 PRO n 1 290 GLU n 1 291 ALA n 1 292 ILE n 1 293 ALA n 1 294 LEU n 1 295 CYS n 1 296 SER n 1 297 ARG n 1 298 LEU n 1 299 LEU n 1 300 GLU n 1 301 TYR n 1 302 THR n 1 303 PRO n 1 304 THR n 1 305 ALA n 1 306 ARG n 1 307 LEU n 1 308 THR n 1 309 PRO n 1 310 LEU n 1 311 GLU n 1 312 ALA n 1 313 CYS n 1 314 ALA n 1 315 HIS n 1 316 SER n 1 317 PHE n 1 318 PHE n 1 319 ASP n 1 320 GLU n 1 321 LEU n 1 322 ARG n 1 323 ASP n 1 324 PRO n 1 325 ASN n 1 326 VAL n 1 327 LYS n 1 328 LEU n 1 329 PRO n 1 330 ASN n 1 331 GLY n 1 332 ARG n 1 333 ASP n 1 334 THR n 1 335 PRO n 1 336 ALA n 1 337 LEU n 1 338 PHE n 1 339 ASN n 1 340 PHE n 1 341 THR n 1 342 THR n 1 343 GLN n 1 344 GLU n 1 345 LEU n 1 346 SER n 1 347 SER n 1 348 ASN n 1 349 PRO n 1 350 PRO n 1 351 LEU n 1 352 ALA n 1 353 THR n 1 354 ILE n 1 355 LEU n 1 356 ILE n 1 357 PRO n 1 358 PRO n 1 359 HIS n 1 360 ALA n 1 361 ARG n 1 362 ILE n 1 363 GLN n 1 364 ALA n 1 365 ALA n 1 366 ALA n 1 367 SER n 1 368 THR n 1 369 PRO n 1 370 THR n 1 371 ASN n 1 372 ALA n 1 373 ALA n 1 374 ALA n 1 375 LEU n 1 376 GLU n 1 377 HIS n 1 378 HIS n 1 379 HIS n 1 380 HIS n 1 381 HIS n 1 382 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GSK3B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GSK3B_HUMAN _struct_ref.pdbx_db_accession P49841 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDH CNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQN LLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQL VEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDP NVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTN ; _struct_ref.pdbx_align_begin 27 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4DIT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 371 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P49841 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 393 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 27 _struct_ref_seq.pdbx_auth_seq_align_end 393 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4DIT MET A 1 ? UNP P49841 ? ? 'EXPRESSION TAG' 23 1 1 4DIT ARG A 2 ? UNP P49841 ? ? 'EXPRESSION TAG' 24 2 1 4DIT GLY A 3 ? UNP P49841 ? ? 'EXPRESSION TAG' 25 3 1 4DIT SER A 4 ? UNP P49841 ? ? 'EXPRESSION TAG' 26 4 1 4DIT ALA A 372 ? UNP P49841 ? ? 'EXPRESSION TAG' 394 5 1 4DIT ALA A 373 ? UNP P49841 ? ? 'EXPRESSION TAG' 395 6 1 4DIT ALA A 374 ? UNP P49841 ? ? 'EXPRESSION TAG' 396 7 1 4DIT LEU A 375 ? UNP P49841 ? ? 'EXPRESSION TAG' 397 8 1 4DIT GLU A 376 ? UNP P49841 ? ? 'EXPRESSION TAG' 398 9 1 4DIT HIS A 377 ? UNP P49841 ? ? 'EXPRESSION TAG' 399 10 1 4DIT HIS A 378 ? UNP P49841 ? ? 'EXPRESSION TAG' 400 11 1 4DIT HIS A 379 ? UNP P49841 ? ? 'EXPRESSION TAG' 401 12 1 4DIT HIS A 380 ? UNP P49841 ? ? 'EXPRESSION TAG' 402 13 1 4DIT HIS A 381 ? UNP P49841 ? ? 'EXPRESSION TAG' 403 14 1 4DIT HIS A 382 ? UNP P49841 ? ? 'EXPRESSION TAG' 404 15 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0KD non-polymer . 'N-(pyridin-3-yl)-2-(thiophen-3-yl)-3H-imidazo[4,5-b]pyridine-7-carboxamide' ? 'C16 H11 N5 O S' 321.356 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4DIT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_percent_sol 48.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_details '0.1M Tris pH 8.0, 15% PEG 6000, VAPOR DIFFUSION, HANGING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.pdbx_collection_date 2005-10-04 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SAGITALLY FOCUSED Si (111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PAL/PLS BEAMLINE 6B' _diffrn_source.pdbx_synchrotron_site PAL/PLS _diffrn_source.pdbx_synchrotron_beamline 6B _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.1 # _reflns.entry_id 4DIT _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.6 _reflns.number_obs 12413 _reflns.number_all ? _reflns.percent_possible_obs 92 _reflns.pdbx_Rmerge_I_obs 0.045 _reflns.pdbx_Rsym_value 0.038 _reflns.pdbx_netI_over_sigmaI 38.84 _reflns.B_iso_Wilson_estimate 50.2 _reflns.pdbx_redundancy 5.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 91.3 _reflns_shell.Rmerge_I_obs 0.446 _reflns_shell.pdbx_Rsym_value 0.208 _reflns_shell.meanI_over_sigI_obs 3.29 _reflns_shell.pdbx_redundancy 4.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1182 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4DIT _refine.ls_number_reflns_obs 11724 _refine.ls_number_reflns_all 12413 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 389249.49 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40.33 _refine.ls_d_res_high 2.60 _refine.ls_percent_reflns_obs 88.3 _refine.ls_R_factor_obs 0.240 _refine.ls_R_factor_all 0.243 _refine.ls_R_factor_R_work 0.240 _refine.ls_R_factor_R_free 0.304 _refine.ls_R_factor_R_free_error 0.012 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 594 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 73.9 _refine.aniso_B[1][1] -10.17 _refine.aniso_B[2][2] 10.38 _refine.aniso_B[3][3] -0.21 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.332892 _refine.solvent_model_param_bsol 50.8953 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1I09' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 4DIT _refine_analyze.Luzzati_coordinate_error_obs 0.40 _refine_analyze.Luzzati_sigma_a_obs 0.49 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.56 _refine_analyze.Luzzati_sigma_a_free 0.62 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2628 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 2692 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 40.33 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id c_bond_d 0.008 ? ? ? ? 'X-RAY DIFFRACTION' c_angle_deg 1.2 ? ? ? ? 'X-RAY DIFFRACTION' c_dihedral_angle_d 23.3 ? ? ? ? 'X-RAY DIFFRACTION' c_improper_angle_d 0.86 ? ? ? ? 'X-RAY DIFFRACTION' c_mcbond_it 1.67 1.50 ? ? ? 'X-RAY DIFFRACTION' c_mcangle_it 2.94 2.00 ? ? ? 'X-RAY DIFFRACTION' c_scbond_it 3.56 2.00 ? ? ? 'X-RAY DIFFRACTION' c_scangle_it 4.58 2.50 ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.60 _refine_ls_shell.d_res_low 2.76 _refine_ls_shell.number_reflns_R_work 1684 _refine_ls_shell.R_factor_R_work 0.368 _refine_ls_shell.percent_reflns_obs 81.4 _refine_ls_shell.R_factor_R_free 0.454 _refine_ls_shell.R_factor_R_free_error 0.051 _refine_ls_shell.percent_reflns_R_free 4.5 _refine_ls_shell.number_reflns_R_free 79 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 protein_rep_kim2.param protein_kim3.top 'X-RAY DIFFRACTION' 2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 3 water_rep.param water.top 'X-RAY DIFFRACTION' 4 ion.param ion.top 'X-RAY DIFFRACTION' 5 296.param 296.top # _struct.entry_id 4DIT _struct.title 'Crystal Structure of GSK3beta in complex with a Imidazopyridine inhibitor' _struct.pdbx_descriptor 'Glycogen synthase kinase-3 beta (E.C.2.7.11.26, 2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4DIT _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' _struct_keywords.text 'kinase, Y216 Phosphorylation, PHOSPHOTRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 73 ? LYS A 81 ? ASN A 95 LYS A 103 1 ? 9 HELX_P HELX_P2 2 VAL A 117 ? ARG A 126 ? VAL A 139 ARG A 148 1 ? 10 HELX_P HELX_P3 3 PRO A 132 ? SER A 152 ? PRO A 154 SER A 174 1 ? 21 HELX_P HELX_P4 4 ALA A 202 ? PHE A 207 ? ALA A 224 PHE A 229 1 ? 6 HELX_P HELX_P5 5 SER A 215 ? GLY A 231 ? SER A 237 GLY A 253 1 ? 17 HELX_P HELX_P6 6 SER A 239 ? GLY A 252 ? SER A 261 GLY A 274 1 ? 14 HELX_P HELX_P7 7 THR A 255 ? MET A 262 ? THR A 277 MET A 284 1 ? 8 HELX_P HELX_P8 8 PRO A 288 ? ARG A 297 ? PRO A 310 ARG A 319 1 ? 10 HELX_P HELX_P9 9 THR A 302 ? ARG A 306 ? THR A 324 ARG A 328 5 ? 5 HELX_P HELX_P10 10 THR A 308 ? HIS A 315 ? THR A 330 HIS A 337 1 ? 8 HELX_P HELX_P11 11 SER A 316 ? ASP A 323 ? SER A 338 ASP A 345 5 ? 8 HELX_P HELX_P12 12 THR A 341 ? SER A 346 ? THR A 363 SER A 368 1 ? 6 HELX_P HELX_P13 13 ASN A 348 ? PRO A 350 ? ASN A 370 PRO A 372 5 ? 3 HELX_P HELX_P14 14 LEU A 351 ? ILE A 356 ? LEU A 373 ILE A 378 1 ? 6 HELX_P HELX_P15 15 PRO A 357 ? GLN A 363 ? PRO A 379 GLN A 385 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 193 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id PTR _struct_conn.ptnr2_label_seq_id 194 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 215 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PTR _struct_conn.ptnr2_auth_seq_id 216 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.334 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 3 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 16 ? PRO A 22 ? THR A 38 PRO A 44 A 2 GLN A 30 ? VAL A 39 ? GLN A 52 VAL A 61 A 3 VAL A 48 ? LEU A 53 ? VAL A 70 LEU A 75 A 4 LEU A 59 ? LEU A 66 ? LEU A 81 LEU A 88 A 5 TYR A 105 ? ASP A 111 ? TYR A 127 ASP A 133 A 6 LEU A 90 ? SER A 96 ? LEU A 112 SER A 118 A 7 THR A 16 ? PRO A 22 ? THR A 38 PRO A 44 B 1 GLU A 115 ? THR A 116 ? GLU A 137 THR A 138 B 2 LEU A 165 ? LEU A 167 ? LEU A 187 LEU A 189 B 3 LEU A 174 ? LEU A 176 ? LEU A 196 LEU A 198 C 1 ILE A 155 ? CYS A 156 ? ILE A 177 CYS A 178 C 2 LYS A 183 ? GLN A 184 ? LYS A 205 GLN A 206 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 18 ? N VAL A 40 O VAL A 32 ? O VAL A 54 A 2 3 N THR A 35 ? N THR A 57 O LYS A 52 ? O LYS A 74 A 3 4 N ALA A 51 ? N ALA A 73 O VAL A 60 ? O VAL A 82 A 4 5 N VAL A 65 ? N VAL A 87 O LEU A 106 ? O LEU A 128 A 5 6 O ASN A 107 ? O ASN A 129 N PHE A 94 ? N PHE A 116 A 6 7 O PHE A 93 ? O PHE A 115 N THR A 21 ? N THR A 43 B 1 2 N GLU A 115 ? N GLU A 137 O LEU A 167 ? O LEU A 189 B 2 3 N LEU A 166 ? N LEU A 188 O LYS A 175 ? O LYS A 197 C 1 2 N CYS A 156 ? N CYS A 178 O LYS A 183 ? O LYS A 205 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'BINDING SITE FOR RESIDUE 0KD A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 ALA A 61 ? ALA A 83 . ? 1_555 ? 2 AC1 11 LYS A 63 ? LYS A 85 . ? 1_555 ? 3 AC1 11 LEU A 110 ? LEU A 132 . ? 1_555 ? 4 AC1 11 ASP A 111 ? ASP A 133 . ? 1_555 ? 5 AC1 11 TYR A 112 ? TYR A 134 . ? 1_555 ? 6 AC1 11 VAL A 113 ? VAL A 135 . ? 1_555 ? 7 AC1 11 PRO A 114 ? PRO A 136 . ? 1_555 ? 8 AC1 11 ARG A 119 ? ARG A 141 . ? 1_555 ? 9 AC1 11 LEU A 166 ? LEU A 188 . ? 1_555 ? 10 AC1 11 ASP A 178 ? ASP A 200 . ? 1_555 ? 11 AC1 11 HOH C . ? HOH A 634 . ? 1_555 ? # _database_PDB_matrix.entry_id 4DIT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4DIT _atom_sites.fract_transf_matrix[1][1] 0.014127 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013785 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012397 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 23 ? ? ? A . n A 1 2 ARG 2 24 ? ? ? A . n A 1 3 GLY 3 25 ? ? ? A . n A 1 4 SER 4 26 ? ? ? A . n A 1 5 LYS 5 27 ? ? ? A . n A 1 6 VAL 6 28 ? ? ? A . n A 1 7 SER 7 29 ? ? ? A . n A 1 8 ARG 8 30 ? ? ? A . n A 1 9 ASP 9 31 ? ? ? A . n A 1 10 LYS 10 32 ? ? ? A . n A 1 11 ASP 11 33 ? ? ? A . n A 1 12 GLY 12 34 ? ? ? A . n A 1 13 SER 13 35 35 SER SER A . n A 1 14 LYS 14 36 36 LYS LYS A . n A 1 15 VAL 15 37 37 VAL VAL A . n A 1 16 THR 16 38 38 THR THR A . n A 1 17 THR 17 39 39 THR THR A . n A 1 18 VAL 18 40 40 VAL VAL A . n A 1 19 VAL 19 41 41 VAL VAL A . n A 1 20 ALA 20 42 42 ALA ALA A . n A 1 21 THR 21 43 43 THR THR A . n A 1 22 PRO 22 44 44 PRO PRO A . n A 1 23 GLY 23 45 45 GLY GLY A . n A 1 24 GLN 24 46 46 GLN GLN A . n A 1 25 GLY 25 47 47 GLY GLY A . n A 1 26 PRO 26 48 48 PRO PRO A . n A 1 27 ASP 27 49 49 ASP ASP A . n A 1 28 ARG 28 50 50 ARG ARG A . n A 1 29 PRO 29 51 51 PRO PRO A . n A 1 30 GLN 30 52 52 GLN GLN A . n A 1 31 GLU 31 53 53 GLU GLU A . n A 1 32 VAL 32 54 54 VAL VAL A . n A 1 33 SER 33 55 55 SER SER A . n A 1 34 TYR 34 56 56 TYR TYR A . n A 1 35 THR 35 57 57 THR THR A . n A 1 36 ASP 36 58 58 ASP ASP A . n A 1 37 THR 37 59 59 THR THR A . n A 1 38 LYS 38 60 60 LYS LYS A . n A 1 39 VAL 39 61 61 VAL VAL A . n A 1 40 ILE 40 62 62 ILE ILE A . n A 1 41 GLY 41 63 63 GLY GLY A . n A 1 42 ASN 42 64 64 ASN ASN A . n A 1 43 GLY 43 65 65 GLY GLY A . n A 1 44 SER 44 66 66 SER SER A . n A 1 45 PHE 45 67 67 PHE PHE A . n A 1 46 GLY 46 68 68 GLY GLY A . n A 1 47 VAL 47 69 69 VAL VAL A . n A 1 48 VAL 48 70 70 VAL VAL A . n A 1 49 TYR 49 71 71 TYR TYR A . n A 1 50 GLN 50 72 72 GLN GLN A . n A 1 51 ALA 51 73 73 ALA ALA A . n A 1 52 LYS 52 74 74 LYS LYS A . n A 1 53 LEU 53 75 75 LEU LEU A . n A 1 54 CYS 54 76 76 CYS CYS A . n A 1 55 ASP 55 77 77 ASP ASP A . n A 1 56 SER 56 78 78 SER SER A . n A 1 57 GLY 57 79 79 GLY GLY A . n A 1 58 GLU 58 80 80 GLU GLU A . n A 1 59 LEU 59 81 81 LEU LEU A . n A 1 60 VAL 60 82 82 VAL VAL A . n A 1 61 ALA 61 83 83 ALA ALA A . n A 1 62 ILE 62 84 84 ILE ILE A . n A 1 63 LYS 63 85 85 LYS LYS A . n A 1 64 LYS 64 86 86 LYS LYS A . n A 1 65 VAL 65 87 87 VAL VAL A . n A 1 66 LEU 66 88 88 LEU LEU A . n A 1 67 GLN 67 89 89 GLN GLN A . n A 1 68 ASP 68 90 90 ASP ASP A . n A 1 69 LYS 69 91 91 LYS LYS A . n A 1 70 ARG 70 92 92 ARG ARG A . n A 1 71 PHE 71 93 93 PHE PHE A . n A 1 72 LYS 72 94 94 LYS LYS A . n A 1 73 ASN 73 95 95 ASN ASN A . n A 1 74 ARG 74 96 96 ARG ARG A . n A 1 75 GLU 75 97 97 GLU GLU A . n A 1 76 LEU 76 98 98 LEU LEU A . n A 1 77 GLN 77 99 99 GLN GLN A . n A 1 78 ILE 78 100 100 ILE ILE A . n A 1 79 MET 79 101 101 MET MET A . n A 1 80 ARG 80 102 102 ARG ARG A . n A 1 81 LYS 81 103 103 LYS LYS A . n A 1 82 LEU 82 104 104 LEU LEU A . n A 1 83 ASP 83 105 105 ASP ASP A . n A 1 84 HIS 84 106 106 HIS HIS A . n A 1 85 CYS 85 107 107 CYS CYS A . n A 1 86 ASN 86 108 108 ASN ASN A . n A 1 87 ILE 87 109 109 ILE ILE A . n A 1 88 VAL 88 110 110 VAL VAL A . n A 1 89 ARG 89 111 111 ARG ARG A . n A 1 90 LEU 90 112 112 LEU LEU A . n A 1 91 ARG 91 113 113 ARG ARG A . n A 1 92 TYR 92 114 114 TYR TYR A . n A 1 93 PHE 93 115 115 PHE PHE A . n A 1 94 PHE 94 116 116 PHE PHE A . n A 1 95 TYR 95 117 117 TYR TYR A . n A 1 96 SER 96 118 118 SER SER A . n A 1 97 SER 97 119 119 SER SER A . n A 1 98 GLY 98 120 ? ? ? A . n A 1 99 GLU 99 121 ? ? ? A . n A 1 100 LYS 100 122 ? ? ? A . n A 1 101 LYS 101 123 ? ? ? A . n A 1 102 ASP 102 124 124 ASP ASP A . n A 1 103 GLU 103 125 125 GLU GLU A . n A 1 104 VAL 104 126 126 VAL VAL A . n A 1 105 TYR 105 127 127 TYR TYR A . n A 1 106 LEU 106 128 128 LEU LEU A . n A 1 107 ASN 107 129 129 ASN ASN A . n A 1 108 LEU 108 130 130 LEU LEU A . n A 1 109 VAL 109 131 131 VAL VAL A . n A 1 110 LEU 110 132 132 LEU LEU A . n A 1 111 ASP 111 133 133 ASP ASP A . n A 1 112 TYR 112 134 134 TYR TYR A . n A 1 113 VAL 113 135 135 VAL VAL A . n A 1 114 PRO 114 136 136 PRO PRO A . n A 1 115 GLU 115 137 137 GLU GLU A . n A 1 116 THR 116 138 138 THR THR A . n A 1 117 VAL 117 139 139 VAL VAL A . n A 1 118 TYR 118 140 140 TYR TYR A . n A 1 119 ARG 119 141 141 ARG ARG A . n A 1 120 VAL 120 142 142 VAL VAL A . n A 1 121 ALA 121 143 143 ALA ALA A . n A 1 122 ARG 122 144 144 ARG ARG A . n A 1 123 HIS 123 145 145 HIS HIS A . n A 1 124 TYR 124 146 146 TYR TYR A . n A 1 125 SER 125 147 147 SER SER A . n A 1 126 ARG 126 148 148 ARG ARG A . n A 1 127 ALA 127 149 149 ALA ALA A . n A 1 128 LYS 128 150 150 LYS LYS A . n A 1 129 GLN 129 151 151 GLN GLN A . n A 1 130 THR 130 152 152 THR THR A . n A 1 131 LEU 131 153 153 LEU LEU A . n A 1 132 PRO 132 154 154 PRO PRO A . n A 1 133 VAL 133 155 155 VAL VAL A . n A 1 134 ILE 134 156 156 ILE ILE A . n A 1 135 TYR 135 157 157 TYR TYR A . n A 1 136 VAL 136 158 158 VAL VAL A . n A 1 137 LYS 137 159 159 LYS LYS A . n A 1 138 LEU 138 160 160 LEU LEU A . n A 1 139 TYR 139 161 161 TYR TYR A . n A 1 140 MET 140 162 162 MET MET A . n A 1 141 TYR 141 163 163 TYR TYR A . n A 1 142 GLN 142 164 164 GLN GLN A . n A 1 143 LEU 143 165 165 LEU LEU A . n A 1 144 PHE 144 166 166 PHE PHE A . n A 1 145 ARG 145 167 167 ARG ARG A . n A 1 146 SER 146 168 168 SER SER A . n A 1 147 LEU 147 169 169 LEU LEU A . n A 1 148 ALA 148 170 170 ALA ALA A . n A 1 149 TYR 149 171 171 TYR TYR A . n A 1 150 ILE 150 172 172 ILE ILE A . n A 1 151 HIS 151 173 173 HIS HIS A . n A 1 152 SER 152 174 174 SER SER A . n A 1 153 PHE 153 175 175 PHE PHE A . n A 1 154 GLY 154 176 176 GLY GLY A . n A 1 155 ILE 155 177 177 ILE ILE A . n A 1 156 CYS 156 178 178 CYS CYS A . n A 1 157 HIS 157 179 179 HIS HIS A . n A 1 158 ARG 158 180 180 ARG ARG A . n A 1 159 ASP 159 181 181 ASP ASP A . n A 1 160 ILE 160 182 182 ILE ILE A . n A 1 161 LYS 161 183 183 LYS LYS A . n A 1 162 PRO 162 184 184 PRO PRO A . n A 1 163 GLN 163 185 185 GLN GLN A . n A 1 164 ASN 164 186 186 ASN ASN A . n A 1 165 LEU 165 187 187 LEU LEU A . n A 1 166 LEU 166 188 188 LEU LEU A . n A 1 167 LEU 167 189 189 LEU LEU A . n A 1 168 ASP 168 190 190 ASP ASP A . n A 1 169 PRO 169 191 191 PRO PRO A . n A 1 170 ASP 170 192 192 ASP ASP A . n A 1 171 THR 171 193 193 THR THR A . n A 1 172 ALA 172 194 194 ALA ALA A . n A 1 173 VAL 173 195 195 VAL VAL A . n A 1 174 LEU 174 196 196 LEU LEU A . n A 1 175 LYS 175 197 197 LYS LYS A . n A 1 176 LEU 176 198 198 LEU LEU A . n A 1 177 CYS 177 199 199 CYS CYS A . n A 1 178 ASP 178 200 200 ASP ASP A . n A 1 179 PHE 179 201 201 PHE PHE A . n A 1 180 GLY 180 202 202 GLY GLY A . n A 1 181 SER 181 203 203 SER SER A . n A 1 182 ALA 182 204 204 ALA ALA A . n A 1 183 LYS 183 205 205 LYS LYS A . n A 1 184 GLN 184 206 206 GLN GLN A . n A 1 185 LEU 185 207 207 LEU LEU A . n A 1 186 VAL 186 208 208 VAL VAL A . n A 1 187 ARG 187 209 209 ARG ARG A . n A 1 188 GLY 188 210 210 GLY GLY A . n A 1 189 GLU 189 211 211 GLU GLU A . n A 1 190 PRO 190 212 212 PRO PRO A . n A 1 191 ASN 191 213 213 ASN ASN A . n A 1 192 VAL 192 214 214 VAL VAL A . n A 1 193 SER 193 215 215 SER SER A . n A 1 194 PTR 194 216 216 PTR PTR A . n A 1 195 ILE 195 217 ? ? ? A . n A 1 196 CYS 196 218 ? ? ? A . n A 1 197 SER 197 219 ? ? ? A . n A 1 198 ARG 198 220 ? ? ? A . n A 1 199 TYR 199 221 221 TYR TYR A . n A 1 200 TYR 200 222 222 TYR TYR A . n A 1 201 ARG 201 223 223 ARG ARG A . n A 1 202 ALA 202 224 224 ALA ALA A . n A 1 203 PRO 203 225 225 PRO PRO A . n A 1 204 GLU 204 226 226 GLU GLU A . n A 1 205 LEU 205 227 227 LEU LEU A . n A 1 206 ILE 206 228 228 ILE ILE A . n A 1 207 PHE 207 229 229 PHE PHE A . n A 1 208 GLY 208 230 230 GLY GLY A . n A 1 209 ALA 209 231 231 ALA ALA A . n A 1 210 THR 210 232 232 THR THR A . n A 1 211 ASP 211 233 233 ASP ASP A . n A 1 212 TYR 212 234 234 TYR TYR A . n A 1 213 THR 213 235 235 THR THR A . n A 1 214 SER 214 236 236 SER SER A . n A 1 215 SER 215 237 237 SER SER A . n A 1 216 ILE 216 238 238 ILE ILE A . n A 1 217 ASP 217 239 239 ASP ASP A . n A 1 218 VAL 218 240 240 VAL VAL A . n A 1 219 TRP 219 241 241 TRP TRP A . n A 1 220 SER 220 242 242 SER SER A . n A 1 221 ALA 221 243 243 ALA ALA A . n A 1 222 GLY 222 244 244 GLY GLY A . n A 1 223 CYS 223 245 245 CYS CYS A . n A 1 224 VAL 224 246 246 VAL VAL A . n A 1 225 LEU 225 247 247 LEU LEU A . n A 1 226 ALA 226 248 248 ALA ALA A . n A 1 227 GLU 227 249 249 GLU GLU A . n A 1 228 LEU 228 250 250 LEU LEU A . n A 1 229 LEU 229 251 251 LEU LEU A . n A 1 230 LEU 230 252 252 LEU LEU A . n A 1 231 GLY 231 253 253 GLY GLY A . n A 1 232 GLN 232 254 254 GLN GLN A . n A 1 233 PRO 233 255 255 PRO PRO A . n A 1 234 ILE 234 256 256 ILE ILE A . n A 1 235 PHE 235 257 257 PHE PHE A . n A 1 236 PRO 236 258 258 PRO PRO A . n A 1 237 GLY 237 259 259 GLY GLY A . n A 1 238 ASP 238 260 260 ASP ASP A . n A 1 239 SER 239 261 261 SER SER A . n A 1 240 GLY 240 262 262 GLY GLY A . n A 1 241 VAL 241 263 263 VAL VAL A . n A 1 242 ASP 242 264 264 ASP ASP A . n A 1 243 GLN 243 265 265 GLN GLN A . n A 1 244 LEU 244 266 266 LEU LEU A . n A 1 245 VAL 245 267 267 VAL VAL A . n A 1 246 GLU 246 268 268 GLU GLU A . n A 1 247 ILE 247 269 269 ILE ILE A . n A 1 248 ILE 248 270 270 ILE ILE A . n A 1 249 LYS 249 271 271 LYS LYS A . n A 1 250 VAL 250 272 272 VAL VAL A . n A 1 251 LEU 251 273 273 LEU LEU A . n A 1 252 GLY 252 274 274 GLY GLY A . n A 1 253 THR 253 275 275 THR THR A . n A 1 254 PRO 254 276 276 PRO PRO A . n A 1 255 THR 255 277 277 THR THR A . n A 1 256 ARG 256 278 278 ARG ARG A . n A 1 257 GLU 257 279 279 GLU GLU A . n A 1 258 GLN 258 280 280 GLN GLN A . n A 1 259 ILE 259 281 281 ILE ILE A . n A 1 260 ARG 260 282 282 ARG ARG A . n A 1 261 GLU 261 283 283 GLU GLU A . n A 1 262 MET 262 284 284 MET MET A . n A 1 263 ASN 263 285 ? ? ? A . n A 1 264 PRO 264 286 ? ? ? A . n A 1 265 ASN 265 287 ? ? ? A . n A 1 266 TYR 266 288 ? ? ? A . n A 1 267 THR 267 289 ? ? ? A . n A 1 268 GLU 268 290 ? ? ? A . n A 1 269 PHE 269 291 ? ? ? A . n A 1 270 LYS 270 292 ? ? ? A . n A 1 271 PHE 271 293 ? ? ? A . n A 1 272 PRO 272 294 ? ? ? A . n A 1 273 GLN 273 295 ? ? ? A . n A 1 274 ILE 274 296 ? ? ? A . n A 1 275 LYS 275 297 ? ? ? A . n A 1 276 ALA 276 298 ? ? ? A . n A 1 277 HIS 277 299 ? ? ? A . n A 1 278 PRO 278 300 ? ? ? A . n A 1 279 TRP 279 301 301 TRP TRP A . n A 1 280 THR 280 302 302 THR THR A . n A 1 281 LYS 281 303 303 LYS LYS A . n A 1 282 VAL 282 304 304 VAL VAL A . n A 1 283 PHE 283 305 305 PHE PHE A . n A 1 284 ARG 284 306 306 ARG ARG A . n A 1 285 PRO 285 307 307 PRO PRO A . n A 1 286 ARG 286 308 308 ARG ARG A . n A 1 287 THR 287 309 309 THR THR A . n A 1 288 PRO 288 310 310 PRO PRO A . n A 1 289 PRO 289 311 311 PRO PRO A . n A 1 290 GLU 290 312 312 GLU GLU A . n A 1 291 ALA 291 313 313 ALA ALA A . n A 1 292 ILE 292 314 314 ILE ILE A . n A 1 293 ALA 293 315 315 ALA ALA A . n A 1 294 LEU 294 316 316 LEU LEU A . n A 1 295 CYS 295 317 317 CYS CYS A . n A 1 296 SER 296 318 318 SER SER A . n A 1 297 ARG 297 319 319 ARG ARG A . n A 1 298 LEU 298 320 320 LEU LEU A . n A 1 299 LEU 299 321 321 LEU LEU A . n A 1 300 GLU 300 322 322 GLU GLU A . n A 1 301 TYR 301 323 323 TYR TYR A . n A 1 302 THR 302 324 324 THR THR A . n A 1 303 PRO 303 325 325 PRO PRO A . n A 1 304 THR 304 326 326 THR THR A . n A 1 305 ALA 305 327 327 ALA ALA A . n A 1 306 ARG 306 328 328 ARG ARG A . n A 1 307 LEU 307 329 329 LEU LEU A . n A 1 308 THR 308 330 330 THR THR A . n A 1 309 PRO 309 331 331 PRO PRO A . n A 1 310 LEU 310 332 332 LEU LEU A . n A 1 311 GLU 311 333 333 GLU GLU A . n A 1 312 ALA 312 334 334 ALA ALA A . n A 1 313 CYS 313 335 335 CYS CYS A . n A 1 314 ALA 314 336 336 ALA ALA A . n A 1 315 HIS 315 337 337 HIS HIS A . n A 1 316 SER 316 338 338 SER SER A . n A 1 317 PHE 317 339 339 PHE PHE A . n A 1 318 PHE 318 340 340 PHE PHE A . n A 1 319 ASP 319 341 341 ASP ASP A . n A 1 320 GLU 320 342 342 GLU GLU A . n A 1 321 LEU 321 343 343 LEU LEU A . n A 1 322 ARG 322 344 344 ARG ARG A . n A 1 323 ASP 323 345 345 ASP ASP A . n A 1 324 PRO 324 346 346 PRO PRO A . n A 1 325 ASN 325 347 347 ASN ASN A . n A 1 326 VAL 326 348 348 VAL VAL A . n A 1 327 LYS 327 349 349 LYS LYS A . n A 1 328 LEU 328 350 350 LEU LEU A . n A 1 329 PRO 329 351 351 PRO PRO A . n A 1 330 ASN 330 352 352 ASN ASN A . n A 1 331 GLY 331 353 353 GLY GLY A . n A 1 332 ARG 332 354 354 ARG ARG A . n A 1 333 ASP 333 355 355 ASP ASP A . n A 1 334 THR 334 356 356 THR THR A . n A 1 335 PRO 335 357 357 PRO PRO A . n A 1 336 ALA 336 358 358 ALA ALA A . n A 1 337 LEU 337 359 359 LEU LEU A . n A 1 338 PHE 338 360 360 PHE PHE A . n A 1 339 ASN 339 361 361 ASN ASN A . n A 1 340 PHE 340 362 362 PHE PHE A . n A 1 341 THR 341 363 363 THR THR A . n A 1 342 THR 342 364 364 THR THR A . n A 1 343 GLN 343 365 365 GLN GLN A . n A 1 344 GLU 344 366 366 GLU GLU A . n A 1 345 LEU 345 367 367 LEU LEU A . n A 1 346 SER 346 368 368 SER SER A . n A 1 347 SER 347 369 369 SER SER A . n A 1 348 ASN 348 370 370 ASN ASN A . n A 1 349 PRO 349 371 371 PRO PRO A . n A 1 350 PRO 350 372 372 PRO PRO A . n A 1 351 LEU 351 373 373 LEU LEU A . n A 1 352 ALA 352 374 374 ALA ALA A . n A 1 353 THR 353 375 375 THR THR A . n A 1 354 ILE 354 376 376 ILE ILE A . n A 1 355 LEU 355 377 377 LEU LEU A . n A 1 356 ILE 356 378 378 ILE ILE A . n A 1 357 PRO 357 379 379 PRO PRO A . n A 1 358 PRO 358 380 380 PRO PRO A . n A 1 359 HIS 359 381 381 HIS HIS A . n A 1 360 ALA 360 382 382 ALA ALA A . n A 1 361 ARG 361 383 383 ARG ARG A . n A 1 362 ILE 362 384 384 ILE ILE A . n A 1 363 GLN 363 385 385 GLN GLN A . n A 1 364 ALA 364 386 386 ALA ALA A . n A 1 365 ALA 365 387 387 ALA ALA A . n A 1 366 ALA 366 388 ? ? ? A . n A 1 367 SER 367 389 ? ? ? A . n A 1 368 THR 368 390 ? ? ? A . n A 1 369 PRO 369 391 ? ? ? A . n A 1 370 THR 370 392 ? ? ? A . n A 1 371 ASN 371 393 ? ? ? A . n A 1 372 ALA 372 394 ? ? ? A . n A 1 373 ALA 373 395 ? ? ? A . n A 1 374 ALA 374 396 ? ? ? A . n A 1 375 LEU 375 397 ? ? ? A . n A 1 376 GLU 376 398 ? ? ? A . n A 1 377 HIS 377 399 ? ? ? A . n A 1 378 HIS 378 400 ? ? ? A . n A 1 379 HIS 379 401 ? ? ? A . n A 1 380 HIS 380 402 ? ? ? A . n A 1 381 HIS 381 403 ? ? ? A . n A 1 382 HIS 382 404 ? ? ? A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 194 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 216 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details O-PHOSPHOTYROSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-02-15 2 'Structure model' 1 1 2012-02-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Structure summary' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 MOLREP phasing . ? 2 CNS refinement 1.1 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 36 ? ? -164.63 96.43 2 1 ARG A 50 ? ? -152.57 75.28 3 1 ILE A 62 ? ? -144.98 -4.04 4 1 VAL A 69 ? ? 177.46 136.24 5 1 ASP A 105 ? ? -169.27 89.55 6 1 LYS A 150 ? ? 59.10 10.94 7 1 ASP A 181 ? ? -156.94 56.13 8 1 ALA A 194 ? ? 70.61 39.01 9 1 ASP A 200 ? ? 65.92 81.37 10 1 TYR A 234 ? ? -47.52 151.48 11 1 SER A 236 ? ? -69.70 6.08 12 1 PHE A 257 ? ? -114.45 68.49 13 1 LYS A 271 ? ? -63.41 0.38 14 1 VAL A 272 ? ? -135.76 -42.60 15 1 PRO A 351 ? ? -49.06 -15.43 16 1 ARG A 354 ? ? -45.95 165.18 17 1 ALA A 358 ? ? -54.75 90.37 18 1 ASN A 361 ? ? -74.26 35.97 19 1 ASN A 370 ? ? 172.78 79.29 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 23 ? A MET 1 2 1 Y 1 A ARG 24 ? A ARG 2 3 1 Y 1 A GLY 25 ? A GLY 3 4 1 Y 1 A SER 26 ? A SER 4 5 1 Y 1 A LYS 27 ? A LYS 5 6 1 Y 1 A VAL 28 ? A VAL 6 7 1 Y 1 A SER 29 ? A SER 7 8 1 Y 1 A ARG 30 ? A ARG 8 9 1 Y 1 A ASP 31 ? A ASP 9 10 1 Y 1 A LYS 32 ? A LYS 10 11 1 Y 1 A ASP 33 ? A ASP 11 12 1 Y 1 A GLY 34 ? A GLY 12 13 1 Y 1 A GLY 120 ? A GLY 98 14 1 Y 1 A GLU 121 ? A GLU 99 15 1 Y 1 A LYS 122 ? A LYS 100 16 1 Y 1 A LYS 123 ? A LYS 101 17 1 Y 1 A ILE 217 ? A ILE 195 18 1 Y 1 A CYS 218 ? A CYS 196 19 1 Y 1 A SER 219 ? A SER 197 20 1 Y 1 A ARG 220 ? A ARG 198 21 1 Y 1 A ASN 285 ? A ASN 263 22 1 Y 1 A PRO 286 ? A PRO 264 23 1 Y 1 A ASN 287 ? A ASN 265 24 1 Y 1 A TYR 288 ? A TYR 266 25 1 Y 1 A THR 289 ? A THR 267 26 1 Y 1 A GLU 290 ? A GLU 268 27 1 Y 1 A PHE 291 ? A PHE 269 28 1 Y 1 A LYS 292 ? A LYS 270 29 1 Y 1 A PHE 293 ? A PHE 271 30 1 Y 1 A PRO 294 ? A PRO 272 31 1 Y 1 A GLN 295 ? A GLN 273 32 1 Y 1 A ILE 296 ? A ILE 274 33 1 Y 1 A LYS 297 ? A LYS 275 34 1 Y 1 A ALA 298 ? A ALA 276 35 1 Y 1 A HIS 299 ? A HIS 277 36 1 Y 1 A PRO 300 ? A PRO 278 37 1 Y 1 A ALA 388 ? A ALA 366 38 1 Y 1 A SER 389 ? A SER 367 39 1 Y 1 A THR 390 ? A THR 368 40 1 Y 1 A PRO 391 ? A PRO 369 41 1 Y 1 A THR 392 ? A THR 370 42 1 Y 1 A ASN 393 ? A ASN 371 43 1 Y 1 A ALA 394 ? A ALA 372 44 1 Y 1 A ALA 395 ? A ALA 373 45 1 Y 1 A ALA 396 ? A ALA 374 46 1 Y 1 A LEU 397 ? A LEU 375 47 1 Y 1 A GLU 398 ? A GLU 376 48 1 Y 1 A HIS 399 ? A HIS 377 49 1 Y 1 A HIS 400 ? A HIS 378 50 1 Y 1 A HIS 401 ? A HIS 379 51 1 Y 1 A HIS 402 ? A HIS 380 52 1 Y 1 A HIS 403 ? A HIS 381 53 1 Y 1 A HIS 404 ? A HIS 382 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-(pyridin-3-yl)-2-(thiophen-3-yl)-3H-imidazo[4,5-b]pyridine-7-carboxamide' 0KD 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 0KD 1 501 0 0KD 296 A . C 3 HOH 1 601 1 HOH HOH A . C 3 HOH 2 602 3 HOH HOH A . C 3 HOH 3 603 4 HOH HOH A . C 3 HOH 4 604 5 HOH HOH A . C 3 HOH 5 605 6 HOH HOH A . C 3 HOH 6 606 7 HOH HOH A . C 3 HOH 7 607 9 HOH HOH A . C 3 HOH 8 608 10 HOH HOH A . C 3 HOH 9 609 11 HOH HOH A . C 3 HOH 10 610 12 HOH HOH A . C 3 HOH 11 611 13 HOH HOH A . C 3 HOH 12 612 14 HOH HOH A . C 3 HOH 13 613 15 HOH HOH A . C 3 HOH 14 614 16 HOH HOH A . C 3 HOH 15 615 17 HOH HOH A . C 3 HOH 16 616 18 HOH HOH A . C 3 HOH 17 617 20 HOH HOH A . C 3 HOH 18 618 21 HOH HOH A . C 3 HOH 19 619 22 HOH HOH A . C 3 HOH 20 620 23 HOH HOH A . C 3 HOH 21 621 24 HOH HOH A . C 3 HOH 22 622 25 HOH HOH A . C 3 HOH 23 623 26 HOH HOH A . C 3 HOH 24 624 27 HOH HOH A . C 3 HOH 25 625 28 HOH HOH A . C 3 HOH 26 626 30 HOH HOH A . C 3 HOH 27 627 31 HOH HOH A . C 3 HOH 28 628 32 HOH HOH A . C 3 HOH 29 629 33 HOH HOH A . C 3 HOH 30 630 34 HOH HOH A . C 3 HOH 31 631 35 HOH HOH A . C 3 HOH 32 632 36 HOH HOH A . C 3 HOH 33 633 37 HOH HOH A . C 3 HOH 34 634 38 HOH HOH A . C 3 HOH 35 635 39 HOH HOH A . C 3 HOH 36 636 40 HOH HOH A . C 3 HOH 37 637 41 HOH HOH A . C 3 HOH 38 638 42 HOH HOH A . C 3 HOH 39 639 43 HOH HOH A . C 3 HOH 40 640 44 HOH HOH A . C 3 HOH 41 641 45 HOH HOH A . #