data_4DOT # _entry.id 4DOT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4DOT RCSB RCSB070596 WWPDB D_1000070596 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4DOT _pdbx_database_status.recvd_initial_deposition_date 2012-02-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kiser, P.D.' 1 'Golczak, M.' 2 'Sears, A.E.' 3 'Lodowski, D.T.' 4 'Palczewski, K.' 5 # _citation.id primary _citation.title 'Structural Basis for the Acyltransferase Activity of Lecithin:Retinol Acyltransferase-like Proteins.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 23790 _citation.page_last 23807 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22605381 _citation.pdbx_database_id_DOI 10.1074/jbc.M112.361550 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Golczak, M.' 1 primary 'Kiser, P.D.' 2 primary 'Sears, A.E.' 3 primary 'Lodowski, D.T.' 4 primary 'Blaner, W.S.' 5 primary 'Palczewski, K.' 6 # _cell.entry_id 4DOT _cell.length_a 62.446 _cell.length_b 62.446 _cell.length_c 73.922 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4DOT _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Group XVI phospholipase A2' 15896.979 1 3.1.1.- ? 'HRASLS3 N-terminus, UNP residues 1-132' ? 2 water nat water 18.015 43 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Adipose-specific phospholipase A2, AdPLA, H-rev 107 protein homolog, HRAS-like suppressor 1, HRAS-like suppressor 3, HRSL3, HREV107-1, HREV107-3, Renal carcinoma antigen NY-REN-65 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKH DDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKH DDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 ALA n 1 4 PRO n 1 5 ILE n 1 6 PRO n 1 7 GLU n 1 8 PRO n 1 9 LYS n 1 10 PRO n 1 11 GLY n 1 12 ASP n 1 13 LEU n 1 14 ILE n 1 15 GLU n 1 16 ILE n 1 17 PHE n 1 18 ARG n 1 19 PRO n 1 20 PHE n 1 21 TYR n 1 22 ARG n 1 23 HIS n 1 24 TRP n 1 25 ALA n 1 26 ILE n 1 27 TYR n 1 28 VAL n 1 29 GLY n 1 30 ASP n 1 31 GLY n 1 32 TYR n 1 33 VAL n 1 34 VAL n 1 35 HIS n 1 36 LEU n 1 37 ALA n 1 38 PRO n 1 39 PRO n 1 40 SER n 1 41 GLU n 1 42 VAL n 1 43 ALA n 1 44 GLY n 1 45 ALA n 1 46 GLY n 1 47 ALA n 1 48 ALA n 1 49 SER n 1 50 VAL n 1 51 MET n 1 52 SER n 1 53 ALA n 1 54 LEU n 1 55 THR n 1 56 ASP n 1 57 LYS n 1 58 ALA n 1 59 ILE n 1 60 VAL n 1 61 LYS n 1 62 LYS n 1 63 GLU n 1 64 LEU n 1 65 LEU n 1 66 TYR n 1 67 ASP n 1 68 VAL n 1 69 ALA n 1 70 GLY n 1 71 SER n 1 72 ASP n 1 73 LYS n 1 74 TYR n 1 75 GLN n 1 76 VAL n 1 77 ASN n 1 78 ASN n 1 79 LYS n 1 80 HIS n 1 81 ASP n 1 82 ASP n 1 83 LYS n 1 84 TYR n 1 85 SER n 1 86 PRO n 1 87 LEU n 1 88 PRO n 1 89 CYS n 1 90 SER n 1 91 LYS n 1 92 ILE n 1 93 ILE n 1 94 GLN n 1 95 ARG n 1 96 ALA n 1 97 GLU n 1 98 GLU n 1 99 LEU n 1 100 VAL n 1 101 GLY n 1 102 GLN n 1 103 GLU n 1 104 VAL n 1 105 LEU n 1 106 TYR n 1 107 LYS n 1 108 LEU n 1 109 THR n 1 110 SER n 1 111 GLU n 1 112 ASN n 1 113 CYS n 1 114 GLU n 1 115 HIS n 1 116 PHE n 1 117 VAL n 1 118 ASN n 1 119 GLU n 1 120 LEU n 1 121 ARG n 1 122 TYR n 1 123 GLY n 1 124 VAL n 1 125 ALA n 1 126 ARG n 1 127 SER n 1 128 ASP n 1 129 GLN n 1 130 VAL n 1 131 ARG n 1 132 ASP n 1 133 LEU n 1 134 GLU n 1 135 HIS n 1 136 HIS n 1 137 HIS n 1 138 HIS n 1 139 HIS n 1 140 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PLA2G16, HRASLS3, HREV107' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PAG16_HUMAN _struct_ref.pdbx_db_accession P53816 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKH DDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4DOT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 132 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P53816 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 132 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4DOT LEU A 133 ? UNP P53816 ? ? 'EXPRESSION TAG' 133 1 1 4DOT GLU A 134 ? UNP P53816 ? ? 'EXPRESSION TAG' 134 2 1 4DOT HIS A 135 ? UNP P53816 ? ? 'EXPRESSION TAG' 135 3 1 4DOT HIS A 136 ? UNP P53816 ? ? 'EXPRESSION TAG' 136 4 1 4DOT HIS A 137 ? UNP P53816 ? ? 'EXPRESSION TAG' 137 5 1 4DOT HIS A 138 ? UNP P53816 ? ? 'EXPRESSION TAG' 138 6 1 4DOT HIS A 139 ? UNP P53816 ? ? 'EXPRESSION TAG' 139 7 1 4DOT HIS A 140 ? UNP P53816 ? ? 'EXPRESSION TAG' 140 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4DOT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.62 _exptl_crystal.density_percent_sol 53.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '0.1M BIS-TRIS, 28% PEG MME 2000, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2011-03-03 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97949 # _reflns.entry_id 4DOT _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.95 _reflns.number_obs 8365 _reflns.number_all 8365 _reflns.percent_possible_obs 68.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 5.3 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4DOT _refine.ls_number_reflns_obs 7900 _refine.ls_number_reflns_all 7900 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.51 _refine.ls_d_res_high 1.96 _refine.ls_percent_reflns_obs 67.36 _refine.ls_R_factor_obs 0.20386 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.20322 _refine.ls_R_factor_R_free 0.21634 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 393 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.948 _refine.correlation_coeff_Fo_to_Fc_free 0.941 _refine.B_iso_mean 52.789 _refine.aniso_B[1][1] 0.11 _refine.aniso_B[2][2] 0.11 _refine.aniso_B[3][3] -0.17 _refine.aniso_B[1][2] 0.06 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][3] -0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIR _refine.pdbx_isotropic_thermal_model isotropic _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.208 _refine.pdbx_overall_ESU_R_Free 0.165 _refine.overall_SU_ML 0.125 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 10.358 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 830 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 873 _refine_hist.d_res_high 1.96 _refine_hist.d_res_low 30.51 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.016 0.020 ? 866 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.001 0.020 ? 604 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.598 1.967 ? 1177 ? 'X-RAY DIFFRACTION' r_angle_other_deg 0.963 3.000 ? 1471 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 7.166 5.000 ? 104 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 27.853 23.953 ? 43 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 13.954 15.000 ? 145 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 8.893 15.000 ? 5 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.080 0.200 ? 124 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.006 0.021 ? 953 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.001 0.020 ? 176 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.965 _refine_ls_shell.d_res_low 2.015 _refine_ls_shell.number_reflns_R_work 29 _refine_ls_shell.R_factor_R_work 0.395 _refine_ls_shell.percent_reflns_obs 3.42 _refine_ls_shell.R_factor_R_free 0.248 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 2 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4DOT _struct.title 'Crystal structure of human HRASLS3.' _struct.pdbx_descriptor 'Group XVI phospholipase A2 (E.C.3.1.1.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4DOT _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'alpha/beta fold, phospholipase/acyltransferase, phosphatidylcholine, phosphatidylethanolamine, membrane, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 65 ? GLY A 70 ? LEU A 65 GLY A 70 1 ? 6 HELX_P HELX_P2 2 ASN A 78 ? LYS A 83 ? ASN A 78 LYS A 83 5 ? 6 HELX_P HELX_P3 3 PRO A 88 ? LEU A 99 ? PRO A 88 LEU A 99 1 ? 12 HELX_P HELX_P4 4 THR A 109 ? GLY A 123 ? THR A 109 GLY A 123 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 59 ? LEU A 64 ? ILE A 59 LEU A 64 A 2 TYR A 32 ? ALA A 37 ? TYR A 32 ALA A 37 A 3 TYR A 21 ? GLY A 29 ? TYR A 21 GLY A 29 A 4 LEU A 13 ? ARG A 18 ? LEU A 13 ARG A 18 A 5 LYS A 73 ? VAL A 76 ? LYS A 73 VAL A 76 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 63 ? O GLU A 63 N VAL A 33 ? N VAL A 33 A 2 3 O TYR A 32 ? O TYR A 32 N VAL A 28 ? N VAL A 28 A 3 4 O HIS A 23 ? O HIS A 23 N ILE A 16 ? N ILE A 16 A 4 5 N GLU A 15 ? N GLU A 15 O GLN A 75 ? O GLN A 75 # _database_PDB_matrix.entry_id 4DOT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4DOT _atom_sites.fract_transf_matrix[1][1] 0.016014 _atom_sites.fract_transf_matrix[1][2] 0.009246 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018491 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013528 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 ILE 5 5 ? ? ? A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 SER 40 40 ? ? ? A . n A 1 41 GLU 41 41 ? ? ? A . n A 1 42 VAL 42 42 ? ? ? A . n A 1 43 ALA 43 43 ? ? ? A . n A 1 44 GLY 44 44 ? ? ? A . n A 1 45 ALA 45 45 ? ? ? A . n A 1 46 GLY 46 46 ? ? ? A . n A 1 47 ALA 47 47 ? ? ? A . n A 1 48 ALA 48 48 ? ? ? A . n A 1 49 SER 49 49 ? ? ? A . n A 1 50 VAL 50 50 ? ? ? A . n A 1 51 MET 51 51 ? ? ? A . n A 1 52 SER 52 52 ? ? ? A . n A 1 53 ALA 53 53 ? ? ? A . n A 1 54 LEU 54 54 ? ? ? A . n A 1 55 THR 55 55 ? ? ? A . n A 1 56 ASP 56 56 ? ? ? A . n A 1 57 LYS 57 57 ? ? ? A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 CYS 113 113 113 CYS CYS A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ARG 126 126 ? ? ? A . n A 1 127 SER 127 127 ? ? ? A . n A 1 128 ASP 128 128 ? ? ? A . n A 1 129 GLN 129 129 ? ? ? A . n A 1 130 VAL 130 130 ? ? ? A . n A 1 131 ARG 131 131 ? ? ? A . n A 1 132 ASP 132 132 ? ? ? A . n A 1 133 LEU 133 133 ? ? ? A . n A 1 134 GLU 134 134 ? ? ? A . n A 1 135 HIS 135 135 ? ? ? A . n A 1 136 HIS 136 136 ? ? ? A . n A 1 137 HIS 137 137 ? ? ? A . n A 1 138 HIS 138 138 ? ? ? A . n A 1 139 HIS 139 139 ? ? ? A . n A 1 140 HIS 140 140 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-05-30 2 'Structure model' 1 1 2012-07-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 1.9151 35.8972 2.1063 0.1477 0.0569 0.1536 -0.0064 0.0205 -0.0226 4.7756 2.2776 13.9712 1.2203 0.9315 2.6453 0.1125 0.1165 -0.0816 0.1644 -0.1401 0.1528 -0.0158 -0.8189 0.0276 'X-RAY DIFFRACTION' 2 ? refined 10.7072 45.0925 1.4776 0.5326 0.0330 0.3177 -0.0608 -0.0253 0.0246 13.2058 3.5918 9.9921 -1.8714 -2.8445 1.2893 0.0607 0.3463 1.3410 -0.3725 0.0010 -0.1626 -1.4808 -0.1976 -0.0617 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 6 ? ? A 78 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 79 ? ? A 125 ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal XDS 'data scaling' . ? 1 SHARP phasing . ? 2 REFMAC refinement 5.6.0117 ? 3 XDS 'data reduction' . ? 4 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 HIS _pdbx_validate_rmsd_bond.auth_seq_id_1 115 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CD2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 HIS _pdbx_validate_rmsd_bond.auth_seq_id_2 115 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.414 _pdbx_validate_rmsd_bond.bond_target_value 1.354 _pdbx_validate_rmsd_bond.bond_deviation 0.060 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.009 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A ILE 5 ? A ILE 5 6 1 Y 1 A SER 40 ? A SER 40 7 1 Y 1 A GLU 41 ? A GLU 41 8 1 Y 1 A VAL 42 ? A VAL 42 9 1 Y 1 A ALA 43 ? A ALA 43 10 1 Y 1 A GLY 44 ? A GLY 44 11 1 Y 1 A ALA 45 ? A ALA 45 12 1 Y 1 A GLY 46 ? A GLY 46 13 1 Y 1 A ALA 47 ? A ALA 47 14 1 Y 1 A ALA 48 ? A ALA 48 15 1 Y 1 A SER 49 ? A SER 49 16 1 Y 1 A VAL 50 ? A VAL 50 17 1 Y 1 A MET 51 ? A MET 51 18 1 Y 1 A SER 52 ? A SER 52 19 1 Y 1 A ALA 53 ? A ALA 53 20 1 Y 1 A LEU 54 ? A LEU 54 21 1 Y 1 A THR 55 ? A THR 55 22 1 Y 1 A ASP 56 ? A ASP 56 23 1 Y 1 A LYS 57 ? A LYS 57 24 1 Y 1 A ARG 126 ? A ARG 126 25 1 Y 1 A SER 127 ? A SER 127 26 1 Y 1 A ASP 128 ? A ASP 128 27 1 Y 1 A GLN 129 ? A GLN 129 28 1 Y 1 A VAL 130 ? A VAL 130 29 1 Y 1 A ARG 131 ? A ARG 131 30 1 Y 1 A ASP 132 ? A ASP 132 31 1 Y 1 A LEU 133 ? A LEU 133 32 1 Y 1 A GLU 134 ? A GLU 134 33 1 Y 1 A HIS 135 ? A HIS 135 34 1 Y 1 A HIS 136 ? A HIS 136 35 1 Y 1 A HIS 137 ? A HIS 137 36 1 Y 1 A HIS 138 ? A HIS 138 37 1 Y 1 A HIS 139 ? A HIS 139 38 1 Y 1 A HIS 140 ? A HIS 140 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 1 HOH HOH A . B 2 HOH 2 202 2 HOH HOH A . B 2 HOH 3 203 3 HOH HOH A . B 2 HOH 4 204 4 HOH HOH A . B 2 HOH 5 205 5 HOH HOH A . B 2 HOH 6 206 6 HOH HOH A . B 2 HOH 7 207 7 HOH HOH A . B 2 HOH 8 208 8 HOH HOH A . B 2 HOH 9 209 9 HOH HOH A . B 2 HOH 10 210 10 HOH HOH A . B 2 HOH 11 211 11 HOH HOH A . B 2 HOH 12 212 12 HOH HOH A . B 2 HOH 13 213 13 HOH HOH A . B 2 HOH 14 214 14 HOH HOH A . B 2 HOH 15 215 15 HOH HOH A . B 2 HOH 16 216 16 HOH HOH A . B 2 HOH 17 217 17 HOH HOH A . B 2 HOH 18 218 19 HOH HOH A . B 2 HOH 19 219 20 HOH HOH A . B 2 HOH 20 220 21 HOH HOH A . B 2 HOH 21 221 22 HOH HOH A . B 2 HOH 22 222 23 HOH HOH A . B 2 HOH 23 223 24 HOH HOH A . B 2 HOH 24 224 25 HOH HOH A . B 2 HOH 25 225 26 HOH HOH A . B 2 HOH 26 226 27 HOH HOH A . B 2 HOH 27 227 31 HOH HOH A . B 2 HOH 28 228 32 HOH HOH A . B 2 HOH 29 229 33 HOH HOH A . B 2 HOH 30 230 36 HOH HOH A . B 2 HOH 31 231 37 HOH HOH A . B 2 HOH 32 232 38 HOH HOH A . B 2 HOH 33 233 39 HOH HOH A . B 2 HOH 34 234 40 HOH HOH A . B 2 HOH 35 235 41 HOH HOH A . B 2 HOH 36 236 42 HOH HOH A . B 2 HOH 37 237 43 HOH HOH A . B 2 HOH 38 238 45 HOH HOH A . B 2 HOH 39 239 47 HOH HOH A . B 2 HOH 40 240 49 HOH HOH A . B 2 HOH 41 241 50 HOH HOH A . B 2 HOH 42 242 51 HOH HOH A . B 2 HOH 43 243 52 HOH HOH A . #