data_4E72 # _entry.id 4E72 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4E72 pdb_00004e72 10.2210/pdb4e72/pdb RCSB RCSB071250 ? ? WWPDB D_1000071250 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-04-25 2 'Structure model' 1 1 2012-05-23 3 'Structure model' 1 2 2014-12-24 4 'Structure model' 1 3 2017-11-15 5 'Structure model' 1 4 2018-01-24 6 'Structure model' 1 5 2023-02-01 7 'Structure model' 1 6 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' 'Database references' 5 6 'Structure model' 'Database references' 6 6 'Structure model' 'Derived calculations' 7 7 'Structure model' 'Data collection' 8 7 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' citation_author 3 6 'Structure model' database_2 4 6 'Structure model' struct_conn 5 6 'Structure model' struct_ref_seq_dif 6 7 'Structure model' chem_comp_atom 7 7 'Structure model' chem_comp_bond 8 7 'Structure model' pdbx_entry_details 9 7 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.name' 3 5 'Structure model' '_citation_author.name' 4 6 'Structure model' '_database_2.pdbx_DOI' 5 6 'Structure model' '_database_2.pdbx_database_accession' 6 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 6 'Structure model' '_struct_ref_seq_dif.details' 8 7 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.SG_entry Y _pdbx_database_status.entry_id 4E72 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-03-16 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.db_id JCSG-417344 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _audit_author.name 'Joint Center for Structural Genomics (JCSG)' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Crystal structure of a hypothetical protein (PA4972) from Pseudomonas aeruginosa PAO1 at 2.15 A resolution' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Joint Center for Structural Genomics (JCSG)' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'uncharacterized protein' 25618.541 1 ? ? ? ? 2 water nat water 18.015 50 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GKPGLDDPLPTERLASEHLKPGCQGEQCPLVNIDTLKFPDEPQLDPIVERALLE(MSE)TRENNETPLPASLAAYERQFL DSAEPGWSSYLQAKVREQHDGLVIIELSSYLFTGGAHG(MSE)PGRGFINYDRRQHKVLSLQD(MSE)LVPGQEEAFWKQ AELAHKAWLLANKLDQDADFQKTWPFQRTPHVALTFGAVTLKYDAYSIAPYSYAHPELKIPYPRLNGIVKPNLFPGRG ; _entity_poly.pdbx_seq_one_letter_code_can ;GKPGLDDPLPTERLASEHLKPGCQGEQCPLVNIDTLKFPDEPQLDPIVERALLEMTRENNETPLPASLAAYERQFLDSAE PGWSSYLQAKVREQHDGLVIIELSSYLFTGGAHGMPGRGFINYDRRQHKVLSLQDMLVPGQEEAFWKQAELAHKAWLLAN KLDQDADFQKTWPFQRTPHVALTFGAVTLKYDAYSIAPYSYAHPELKIPYPRLNGIVKPNLFPGRG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier JCSG-417344 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LYS n 1 3 PRO n 1 4 GLY n 1 5 LEU n 1 6 ASP n 1 7 ASP n 1 8 PRO n 1 9 LEU n 1 10 PRO n 1 11 THR n 1 12 GLU n 1 13 ARG n 1 14 LEU n 1 15 ALA n 1 16 SER n 1 17 GLU n 1 18 HIS n 1 19 LEU n 1 20 LYS n 1 21 PRO n 1 22 GLY n 1 23 CYS n 1 24 GLN n 1 25 GLY n 1 26 GLU n 1 27 GLN n 1 28 CYS n 1 29 PRO n 1 30 LEU n 1 31 VAL n 1 32 ASN n 1 33 ILE n 1 34 ASP n 1 35 THR n 1 36 LEU n 1 37 LYS n 1 38 PHE n 1 39 PRO n 1 40 ASP n 1 41 GLU n 1 42 PRO n 1 43 GLN n 1 44 LEU n 1 45 ASP n 1 46 PRO n 1 47 ILE n 1 48 VAL n 1 49 GLU n 1 50 ARG n 1 51 ALA n 1 52 LEU n 1 53 LEU n 1 54 GLU n 1 55 MSE n 1 56 THR n 1 57 ARG n 1 58 GLU n 1 59 ASN n 1 60 ASN n 1 61 GLU n 1 62 THR n 1 63 PRO n 1 64 LEU n 1 65 PRO n 1 66 ALA n 1 67 SER n 1 68 LEU n 1 69 ALA n 1 70 ALA n 1 71 TYR n 1 72 GLU n 1 73 ARG n 1 74 GLN n 1 75 PHE n 1 76 LEU n 1 77 ASP n 1 78 SER n 1 79 ALA n 1 80 GLU n 1 81 PRO n 1 82 GLY n 1 83 TRP n 1 84 SER n 1 85 SER n 1 86 TYR n 1 87 LEU n 1 88 GLN n 1 89 ALA n 1 90 LYS n 1 91 VAL n 1 92 ARG n 1 93 GLU n 1 94 GLN n 1 95 HIS n 1 96 ASP n 1 97 GLY n 1 98 LEU n 1 99 VAL n 1 100 ILE n 1 101 ILE n 1 102 GLU n 1 103 LEU n 1 104 SER n 1 105 SER n 1 106 TYR n 1 107 LEU n 1 108 PHE n 1 109 THR n 1 110 GLY n 1 111 GLY n 1 112 ALA n 1 113 HIS n 1 114 GLY n 1 115 MSE n 1 116 PRO n 1 117 GLY n 1 118 ARG n 1 119 GLY n 1 120 PHE n 1 121 ILE n 1 122 ASN n 1 123 TYR n 1 124 ASP n 1 125 ARG n 1 126 ARG n 1 127 GLN n 1 128 HIS n 1 129 LYS n 1 130 VAL n 1 131 LEU n 1 132 SER n 1 133 LEU n 1 134 GLN n 1 135 ASP n 1 136 MSE n 1 137 LEU n 1 138 VAL n 1 139 PRO n 1 140 GLY n 1 141 GLN n 1 142 GLU n 1 143 GLU n 1 144 ALA n 1 145 PHE n 1 146 TRP n 1 147 LYS n 1 148 GLN n 1 149 ALA n 1 150 GLU n 1 151 LEU n 1 152 ALA n 1 153 HIS n 1 154 LYS n 1 155 ALA n 1 156 TRP n 1 157 LEU n 1 158 LEU n 1 159 ALA n 1 160 ASN n 1 161 LYS n 1 162 LEU n 1 163 ASP n 1 164 GLN n 1 165 ASP n 1 166 ALA n 1 167 ASP n 1 168 PHE n 1 169 GLN n 1 170 LYS n 1 171 THR n 1 172 TRP n 1 173 PRO n 1 174 PHE n 1 175 GLN n 1 176 ARG n 1 177 THR n 1 178 PRO n 1 179 HIS n 1 180 VAL n 1 181 ALA n 1 182 LEU n 1 183 THR n 1 184 PHE n 1 185 GLY n 1 186 ALA n 1 187 VAL n 1 188 THR n 1 189 LEU n 1 190 LYS n 1 191 TYR n 1 192 ASP n 1 193 ALA n 1 194 TYR n 1 195 SER n 1 196 ILE n 1 197 ALA n 1 198 PRO n 1 199 TYR n 1 200 SER n 1 201 TYR n 1 202 ALA n 1 203 HIS n 1 204 PRO n 1 205 GLU n 1 206 LEU n 1 207 LYS n 1 208 ILE n 1 209 PRO n 1 210 TYR n 1 211 PRO n 1 212 ARG n 1 213 LEU n 1 214 ASN n 1 215 GLY n 1 216 ILE n 1 217 VAL n 1 218 LYS n 1 219 PRO n 1 220 ASN n 1 221 LEU n 1 222 PHE n 1 223 PRO n 1 224 GLY n 1 225 ARG n 1 226 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PA4972 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain PAO1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia Coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain PB1 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name SpeedET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 LYS 2 24 ? ? ? A . n A 1 3 PRO 3 25 ? ? ? A . n A 1 4 GLY 4 26 26 GLY GLY A . n A 1 5 LEU 5 27 27 LEU LEU A . n A 1 6 ASP 6 28 28 ASP ASP A . n A 1 7 ASP 7 29 29 ASP ASP A . n A 1 8 PRO 8 30 30 PRO PRO A . n A 1 9 LEU 9 31 31 LEU LEU A . n A 1 10 PRO 10 32 32 PRO PRO A . n A 1 11 THR 11 33 33 THR THR A . n A 1 12 GLU 12 34 34 GLU GLU A . n A 1 13 ARG 13 35 35 ARG ARG A . n A 1 14 LEU 14 36 36 LEU LEU A . n A 1 15 ALA 15 37 37 ALA ALA A . n A 1 16 SER 16 38 38 SER SER A . n A 1 17 GLU 17 39 39 GLU GLU A . n A 1 18 HIS 18 40 40 HIS HIS A . n A 1 19 LEU 19 41 41 LEU LEU A . n A 1 20 LYS 20 42 42 LYS LYS A . n A 1 21 PRO 21 43 43 PRO PRO A . n A 1 22 GLY 22 44 44 GLY GLY A . n A 1 23 CYS 23 45 45 CYS CYS A . n A 1 24 GLN 24 46 46 GLN GLN A . n A 1 25 GLY 25 47 47 GLY GLY A . n A 1 26 GLU 26 48 48 GLU GLU A . n A 1 27 GLN 27 49 49 GLN GLN A . n A 1 28 CYS 28 50 50 CYS CYS A . n A 1 29 PRO 29 51 51 PRO PRO A . n A 1 30 LEU 30 52 52 LEU LEU A . n A 1 31 VAL 31 53 53 VAL VAL A . n A 1 32 ASN 32 54 54 ASN ASN A . n A 1 33 ILE 33 55 55 ILE ILE A . n A 1 34 ASP 34 56 56 ASP ASP A . n A 1 35 THR 35 57 57 THR THR A . n A 1 36 LEU 36 58 58 LEU LEU A . n A 1 37 LYS 37 59 59 LYS LYS A . n A 1 38 PHE 38 60 60 PHE PHE A . n A 1 39 PRO 39 61 61 PRO PRO A . n A 1 40 ASP 40 62 62 ASP ASP A . n A 1 41 GLU 41 63 63 GLU GLU A . n A 1 42 PRO 42 64 64 PRO PRO A . n A 1 43 GLN 43 65 65 GLN GLN A . n A 1 44 LEU 44 66 66 LEU LEU A . n A 1 45 ASP 45 67 67 ASP ASP A . n A 1 46 PRO 46 68 68 PRO PRO A . n A 1 47 ILE 47 69 69 ILE ILE A . n A 1 48 VAL 48 70 70 VAL VAL A . n A 1 49 GLU 49 71 71 GLU GLU A . n A 1 50 ARG 50 72 72 ARG ARG A . n A 1 51 ALA 51 73 73 ALA ALA A . n A 1 52 LEU 52 74 74 LEU LEU A . n A 1 53 LEU 53 75 75 LEU LEU A . n A 1 54 GLU 54 76 76 GLU GLU A . n A 1 55 MSE 55 77 77 MSE MSE A . n A 1 56 THR 56 78 78 THR THR A . n A 1 57 ARG 57 79 79 ARG ARG A . n A 1 58 GLU 58 80 ? ? ? A . n A 1 59 ASN 59 81 ? ? ? A . n A 1 60 ASN 60 82 ? ? ? A . n A 1 61 GLU 61 83 ? ? ? A . n A 1 62 THR 62 84 84 THR THR A . n A 1 63 PRO 63 85 85 PRO PRO A . n A 1 64 LEU 64 86 86 LEU LEU A . n A 1 65 PRO 65 87 87 PRO PRO A . n A 1 66 ALA 66 88 88 ALA ALA A . n A 1 67 SER 67 89 89 SER SER A . n A 1 68 LEU 68 90 90 LEU LEU A . n A 1 69 ALA 69 91 91 ALA ALA A . n A 1 70 ALA 70 92 92 ALA ALA A . n A 1 71 TYR 71 93 93 TYR TYR A . n A 1 72 GLU 72 94 94 GLU GLU A . n A 1 73 ARG 73 95 95 ARG ARG A . n A 1 74 GLN 74 96 96 GLN GLN A . n A 1 75 PHE 75 97 97 PHE PHE A . n A 1 76 LEU 76 98 98 LEU LEU A . n A 1 77 ASP 77 99 99 ASP ASP A . n A 1 78 SER 78 100 100 SER SER A . n A 1 79 ALA 79 101 101 ALA ALA A . n A 1 80 GLU 80 102 102 GLU GLU A . n A 1 81 PRO 81 103 103 PRO PRO A . n A 1 82 GLY 82 104 104 GLY GLY A . n A 1 83 TRP 83 105 105 TRP TRP A . n A 1 84 SER 84 106 106 SER SER A . n A 1 85 SER 85 107 107 SER SER A . n A 1 86 TYR 86 108 108 TYR TYR A . n A 1 87 LEU 87 109 109 LEU LEU A . n A 1 88 GLN 88 110 110 GLN GLN A . n A 1 89 ALA 89 111 111 ALA ALA A . n A 1 90 LYS 90 112 112 LYS LYS A . n A 1 91 VAL 91 113 113 VAL VAL A . n A 1 92 ARG 92 114 114 ARG ARG A . n A 1 93 GLU 93 115 115 GLU GLU A . n A 1 94 GLN 94 116 116 GLN GLN A . n A 1 95 HIS 95 117 117 HIS HIS A . n A 1 96 ASP 96 118 118 ASP ASP A . n A 1 97 GLY 97 119 119 GLY GLY A . n A 1 98 LEU 98 120 120 LEU LEU A . n A 1 99 VAL 99 121 121 VAL VAL A . n A 1 100 ILE 100 122 122 ILE ILE A . n A 1 101 ILE 101 123 123 ILE ILE A . n A 1 102 GLU 102 124 124 GLU GLU A . n A 1 103 LEU 103 125 125 LEU LEU A . n A 1 104 SER 104 126 126 SER SER A . n A 1 105 SER 105 127 127 SER SER A . n A 1 106 TYR 106 128 128 TYR TYR A . n A 1 107 LEU 107 129 129 LEU LEU A . n A 1 108 PHE 108 130 130 PHE PHE A . n A 1 109 THR 109 131 131 THR THR A . n A 1 110 GLY 110 132 132 GLY GLY A . n A 1 111 GLY 111 133 133 GLY GLY A . n A 1 112 ALA 112 134 134 ALA ALA A . n A 1 113 HIS 113 135 135 HIS HIS A . n A 1 114 GLY 114 136 136 GLY GLY A . n A 1 115 MSE 115 137 137 MSE MSE A . n A 1 116 PRO 116 138 138 PRO PRO A . n A 1 117 GLY 117 139 139 GLY GLY A . n A 1 118 ARG 118 140 140 ARG ARG A . n A 1 119 GLY 119 141 141 GLY GLY A . n A 1 120 PHE 120 142 142 PHE PHE A . n A 1 121 ILE 121 143 143 ILE ILE A . n A 1 122 ASN 122 144 144 ASN ASN A . n A 1 123 TYR 123 145 145 TYR TYR A . n A 1 124 ASP 124 146 146 ASP ASP A . n A 1 125 ARG 125 147 147 ARG ARG A . n A 1 126 ARG 126 148 148 ARG ARG A . n A 1 127 GLN 127 149 149 GLN GLN A . n A 1 128 HIS 128 150 150 HIS HIS A . n A 1 129 LYS 129 151 151 LYS LYS A . n A 1 130 VAL 130 152 152 VAL VAL A . n A 1 131 LEU 131 153 153 LEU LEU A . n A 1 132 SER 132 154 154 SER SER A . n A 1 133 LEU 133 155 155 LEU LEU A . n A 1 134 GLN 134 156 156 GLN GLN A . n A 1 135 ASP 135 157 157 ASP ASP A . n A 1 136 MSE 136 158 158 MSE MSE A . n A 1 137 LEU 137 159 159 LEU LEU A . n A 1 138 VAL 138 160 160 VAL VAL A . n A 1 139 PRO 139 161 161 PRO PRO A . n A 1 140 GLY 140 162 162 GLY GLY A . n A 1 141 GLN 141 163 163 GLN GLN A . n A 1 142 GLU 142 164 164 GLU GLU A . n A 1 143 GLU 143 165 165 GLU GLU A . n A 1 144 ALA 144 166 166 ALA ALA A . n A 1 145 PHE 145 167 167 PHE PHE A . n A 1 146 TRP 146 168 168 TRP TRP A . n A 1 147 LYS 147 169 169 LYS LYS A . n A 1 148 GLN 148 170 170 GLN GLN A . n A 1 149 ALA 149 171 171 ALA ALA A . n A 1 150 GLU 150 172 172 GLU GLU A . n A 1 151 LEU 151 173 173 LEU LEU A . n A 1 152 ALA 152 174 174 ALA ALA A . n A 1 153 HIS 153 175 175 HIS HIS A . n A 1 154 LYS 154 176 176 LYS LYS A . n A 1 155 ALA 155 177 177 ALA ALA A . n A 1 156 TRP 156 178 178 TRP TRP A . n A 1 157 LEU 157 179 179 LEU LEU A . n A 1 158 LEU 158 180 180 LEU LEU A . n A 1 159 ALA 159 181 181 ALA ALA A . n A 1 160 ASN 160 182 182 ASN ASN A . n A 1 161 LYS 161 183 183 LYS LYS A . n A 1 162 LEU 162 184 184 LEU LEU A . n A 1 163 ASP 163 185 185 ASP ASP A . n A 1 164 GLN 164 186 186 GLN GLN A . n A 1 165 ASP 165 187 187 ASP ASP A . n A 1 166 ALA 166 188 188 ALA ALA A . n A 1 167 ASP 167 189 189 ASP ASP A . n A 1 168 PHE 168 190 190 PHE PHE A . n A 1 169 GLN 169 191 191 GLN GLN A . n A 1 170 LYS 170 192 192 LYS LYS A . n A 1 171 THR 171 193 193 THR THR A . n A 1 172 TRP 172 194 194 TRP TRP A . n A 1 173 PRO 173 195 195 PRO PRO A . n A 1 174 PHE 174 196 196 PHE PHE A . n A 1 175 GLN 175 197 197 GLN GLN A . n A 1 176 ARG 176 198 198 ARG ARG A . n A 1 177 THR 177 199 199 THR THR A . n A 1 178 PRO 178 200 200 PRO PRO A . n A 1 179 HIS 179 201 201 HIS HIS A . n A 1 180 VAL 180 202 202 VAL VAL A . n A 1 181 ALA 181 203 203 ALA ALA A . n A 1 182 LEU 182 204 204 LEU LEU A . n A 1 183 THR 183 205 205 THR THR A . n A 1 184 PHE 184 206 206 PHE PHE A . n A 1 185 GLY 185 207 207 GLY GLY A . n A 1 186 ALA 186 208 208 ALA ALA A . n A 1 187 VAL 187 209 209 VAL VAL A . n A 1 188 THR 188 210 210 THR THR A . n A 1 189 LEU 189 211 211 LEU LEU A . n A 1 190 LYS 190 212 212 LYS LYS A . n A 1 191 TYR 191 213 213 TYR TYR A . n A 1 192 ASP 192 214 214 ASP ASP A . n A 1 193 ALA 193 215 215 ALA ALA A . n A 1 194 TYR 194 216 216 TYR TYR A . n A 1 195 SER 195 217 217 SER SER A . n A 1 196 ILE 196 218 218 ILE ILE A . n A 1 197 ALA 197 219 219 ALA ALA A . n A 1 198 PRO 198 220 220 PRO PRO A . n A 1 199 TYR 199 221 221 TYR TYR A . n A 1 200 SER 200 222 222 SER SER A . n A 1 201 TYR 201 223 223 TYR TYR A . n A 1 202 ALA 202 224 224 ALA ALA A . n A 1 203 HIS 203 225 225 HIS HIS A . n A 1 204 PRO 204 226 226 PRO PRO A . n A 1 205 GLU 205 227 227 GLU GLU A . n A 1 206 LEU 206 228 228 LEU LEU A . n A 1 207 LYS 207 229 229 LYS LYS A . n A 1 208 ILE 208 230 230 ILE ILE A . n A 1 209 PRO 209 231 231 PRO PRO A . n A 1 210 TYR 210 232 232 TYR TYR A . n A 1 211 PRO 211 233 233 PRO PRO A . n A 1 212 ARG 212 234 234 ARG ARG A . n A 1 213 LEU 213 235 235 LEU LEU A . n A 1 214 ASN 214 236 236 ASN ASN A . n A 1 215 GLY 215 237 237 GLY GLY A . n A 1 216 ILE 216 238 238 ILE ILE A . n A 1 217 VAL 217 239 239 VAL VAL A . n A 1 218 LYS 218 240 240 LYS LYS A . n A 1 219 PRO 219 241 241 PRO PRO A . n A 1 220 ASN 220 242 242 ASN ASN A . n A 1 221 LEU 221 243 243 LEU LEU A . n A 1 222 PHE 222 244 244 PHE PHE A . n A 1 223 PRO 223 245 245 PRO PRO A . n A 1 224 GLY 224 246 246 GLY GLY A . n A 1 225 ARG 225 247 247 ARG ARG A . n A 1 226 GLY 226 248 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 251 HOH HOH A . B 2 HOH 2 302 252 HOH HOH A . B 2 HOH 3 303 253 HOH HOH A . B 2 HOH 4 304 254 HOH HOH A . B 2 HOH 5 305 255 HOH HOH A . B 2 HOH 6 306 256 HOH HOH A . B 2 HOH 7 307 257 HOH HOH A . B 2 HOH 8 308 258 HOH HOH A . B 2 HOH 9 309 259 HOH HOH A . B 2 HOH 10 310 260 HOH HOH A . B 2 HOH 11 311 261 HOH HOH A . B 2 HOH 12 312 262 HOH HOH A . B 2 HOH 13 313 263 HOH HOH A . B 2 HOH 14 314 264 HOH HOH A . B 2 HOH 15 315 265 HOH HOH A . B 2 HOH 16 316 266 HOH HOH A . B 2 HOH 17 317 267 HOH HOH A . B 2 HOH 18 318 268 HOH HOH A . B 2 HOH 19 319 269 HOH HOH A . B 2 HOH 20 320 270 HOH HOH A . B 2 HOH 21 321 271 HOH HOH A . B 2 HOH 22 322 272 HOH HOH A . B 2 HOH 23 323 273 HOH HOH A . B 2 HOH 24 324 274 HOH HOH A . B 2 HOH 25 325 275 HOH HOH A . B 2 HOH 26 326 276 HOH HOH A . B 2 HOH 27 327 277 HOH HOH A . B 2 HOH 28 328 278 HOH HOH A . B 2 HOH 29 329 279 HOH HOH A . B 2 HOH 30 330 280 HOH HOH A . B 2 HOH 31 331 281 HOH HOH A . B 2 HOH 32 332 282 HOH HOH A . B 2 HOH 33 333 283 HOH HOH A . B 2 HOH 34 334 284 HOH HOH A . B 2 HOH 35 335 285 HOH HOH A . B 2 HOH 36 336 286 HOH HOH A . B 2 HOH 37 337 287 HOH HOH A . B 2 HOH 38 338 288 HOH HOH A . B 2 HOH 39 339 289 HOH HOH A . B 2 HOH 40 340 290 HOH HOH A . B 2 HOH 41 341 291 HOH HOH A . B 2 HOH 42 342 292 HOH HOH A . B 2 HOH 43 343 293 HOH HOH A . B 2 HOH 44 344 294 HOH HOH A . B 2 HOH 45 345 295 HOH HOH A . B 2 HOH 46 346 296 HOH HOH A . B 2 HOH 47 347 297 HOH HOH A . B 2 HOH 48 348 298 HOH HOH A . B 2 HOH 49 349 299 HOH HOH A . B 2 HOH 50 350 300 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 46 ? CG ? A GLN 24 CG 2 1 Y 1 A GLN 46 ? CD ? A GLN 24 CD 3 1 Y 1 A GLN 46 ? OE1 ? A GLN 24 OE1 4 1 Y 1 A GLN 46 ? NE2 ? A GLN 24 NE2 5 1 Y 1 A THR 84 ? OG1 ? A THR 62 OG1 6 1 Y 1 A THR 84 ? CG2 ? A THR 62 CG2 7 1 Y 1 A GLU 165 ? CG ? A GLU 143 CG 8 1 Y 1 A GLU 165 ? CD ? A GLU 143 CD 9 1 Y 1 A GLU 165 ? OE1 ? A GLU 143 OE1 10 1 Y 1 A GLU 165 ? OE2 ? A GLU 143 OE2 # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 MolProbity 3beta29 ? package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 'model building' http://kinemage.biochem.duke.edu/molprobity/ ? ? 2 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 3 SHELX . ? package 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de phasing http://shelx.uni-ac.gwdg.de/SHELX/ Fortran_77 ? 4 SHARP . ? package 'Eric de La Fortelle' sharp-develop@globalphasing.com phasing http://www.globalphasing.com/sharp/ ? ? 5 XSCALE 'December 29, 2011' ? package 'Wolfgang Kabsch' ? 'data scaling' http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? ? 6 BUSTER-TNT 2.10.0 ? program 'Gerard Bricogne' buster-develop@GlobalPhasing.com refinement http://www.globalphasing.com/buster/ ? ? 7 XDS . ? ? ? ? 'data reduction' ? ? ? 8 SHELXD . ? ? ? ? phasing ? ? ? 9 autoSHARP . ? ? ? ? phasing ? ? ? 10 BUSTER 2.10.0 ? ? ? ? refinement ? ? ? # _cell.entry_id 4E72 _cell.length_a 102.840 _cell.length_b 51.890 _cell.length_c 40.860 _cell.angle_alpha 90.000 _cell.angle_beta 98.250 _cell.angle_gamma 90.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4E72 _symmetry.Int_Tables_number 5 _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 4E72 # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 41.59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.pdbx_details '10.0% Glycerol, 1.26M tri-Sodium Citrate, 0.1M HEPES pH 7.5, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.details 'Rhodium-coated vertical and horizontal focusing mirrors; liquid-nitrogen cooled double crystal Si(111) monochromator' _diffrn_detector.pdbx_collection_date 2012-02-29 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9796 1.0 2 0.9184 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.pdbx_wavelength_list 0.9796,0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.entry_id 4E72 _reflns.d_resolution_high 2.15 _reflns.d_resolution_low 46.229 _reflns.number_obs 11243 _reflns.pdbx_Rmerge_I_obs 0.084 _reflns.pdbx_netI_over_sigmaI 8.810 _reflns.percent_possible_obs 96.000 _reflns.B_iso_Wilson_estimate 36.721 _reflns.observed_criterion_sigma_I -3.000 _reflns.observed_criterion_sigma_F ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_redundancy 3.47 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.15 2.23 3363 ? 1078 0.439 2.43 ? ? 3.12 ? ? 90.90 1 1 2.23 2.32 4018 ? 1120 0.363 3.4 ? ? ? ? ? 97.10 2 1 2.32 2.42 3852 ? 1086 0.292 4.0 ? ? ? ? ? 97.40 3 1 2.42 2.55 4120 ? 1165 0.226 4.7 ? ? ? ? ? 97.60 4 1 2.55 2.71 3869 ? 1112 0.171 6.0 ? ? ? ? ? 96.90 5 1 2.71 2.92 3789 ? 1119 0.124 7.5 ? ? ? ? ? 94.60 6 1 2.92 3.21 4123 ? 1139 0.088 10.8 ? ? ? ? ? 98.70 7 1 3.21 3.67 3989 ? 1136 0.073 14.1 ? ? ? ? ? 97.00 8 1 3.67 4.61 3743 ? 1105 0.062 16.5 ? ? ? ? ? 94.60 9 1 4.61 46.23 4094 ? 1183 0.059 17.9 ? ? ? ? ? 95.90 10 1 # _refine.entry_id 4E72 _refine.ls_d_res_high 2.1500 _refine.ls_d_res_low 46.229 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 96.0200 _refine.ls_number_reflns_obs 11219 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;1. A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. 2. ATOM RECORD CONTAINS SUM OF TLS AND RESIDUAL B FACTORS. ANISOU RECORD CONTAINS SUM OF TLS AND RESIDUAL U FACTORS. 3. THE MAD PHASES WERE USED AS RESTRAINTS DURING REFINEMENT. ; _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1732 _refine.ls_R_factor_R_work 0.1713 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2100 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.7400 _refine.ls_number_reflns_R_free 532 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 43.9958 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.5077 _refine.aniso_B[2][2] -10.3510 _refine.aniso_B[3][3] 9.8433 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 1.7381 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9449 _refine.correlation_coeff_Fo_to_Fc_free 0.9160 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.solvent_model_details ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 142.330 _refine.B_iso_min 20.750 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.500 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 4E72 _refine_analyze.Luzzati_coordinate_error_obs 0.264 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1731 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 1781 _refine_hist.d_res_high 2.1500 _refine_hist.d_res_low 46.229 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id t_dihedral_angle_d 813 ? ? 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' t_trig_c_planes 44 ? ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_gen_planes 262 ? ? 5.000 HARMONIC 'X-RAY DIFFRACTION' t_it 1799 ? ? 20.000 HARMONIC 'X-RAY DIFFRACTION' t_nbd ? ? ? ? ? 'X-RAY DIFFRACTION' t_improper_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_pseud_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_chiral_improper_torsion 223 ? ? 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_sum_occupancies ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_distance ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_ideal_dist_contact 1936 ? ? 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_bond_d 1799 0.010 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_angle_deg 2454 1.020 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_omega_torsion ? 3.470 ? ? ? 'X-RAY DIFFRACTION' t_other_torsion ? 2.890 ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 2.1500 _refine_ls_shell.d_res_low 2.3500 _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.percent_reflns_obs 96.0200 _refine_ls_shell.number_reflns_R_work 2503 _refine_ls_shell.R_factor_all 0.1869 _refine_ls_shell.R_factor_R_work 0.1846 _refine_ls_shell.R_factor_R_free 0.2361 _refine_ls_shell.percent_reflns_R_free 4.3200 _refine_ls_shell.number_reflns_R_free 113 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 2616 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.title 'Crystal structure of a DUF3298 family protein (PA4972) from Pseudomonas aeruginosa PAO1 at 2.15 A resolution' _struct.entry_id 4E72 _struct.pdbx_model_type_details ? _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.text ;PF11738 FAMILY, DUF3298, STRUCTURAL GENOMICS, JOINT CENTER FOR STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI-BIOLOGY, UNKNOWN FUNCTION ; _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.entry_id 4E72 # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9HUJ3_PSEAE _struct_ref.pdbx_db_accession Q9HUJ3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KPGLDDPLPTERLASEHLKPGCQGEQCPLVNIDTLKFPDEPQLDPIVERALLEMTRENNETPLPASLAAYERQFLDSAEP GWSSYLQAKVREQHDGLVIIELSSYLFTGGAHGMPGRGFINYDRRQHKVLSLQDMLVPGQEEAFWKQAELAHKAWLLANK LDQDADFQKTWPFQRTPHVALTFGAVTLKYDAYSIAPYSYAHPELKIPYPRLNGIVKPNLFPGRG ; _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4E72 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 226 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HUJ3 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 248 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 24 _struct_ref_seq.pdbx_auth_seq_align_end 248 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4E72 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9HUJ3 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 43 ? MSE A 55 ? GLN A 65 MSE A 77 1 ? 13 HELX_P HELX_P2 2 SER A 67 ? ALA A 79 ? SER A 89 ALA A 101 1 ? 13 HELX_P HELX_P3 3 SER A 132 ? LEU A 137 ? SER A 154 LEU A 159 1 ? 6 HELX_P HELX_P4 4 GLN A 141 ? ASN A 160 ? GLN A 163 ASN A 182 1 ? 20 HELX_P HELX_P5 5 ASP A 165 ? TRP A 172 ? ASP A 187 TRP A 194 1 ? 8 HELX_P HELX_P6 6 PRO A 198 ? ALA A 202 ? PRO A 220 ALA A 224 5 ? 5 HELX_P HELX_P7 7 PRO A 209 ? ASN A 214 ? PRO A 231 ASN A 236 5 ? 6 HELX_P HELX_P8 8 LYS A 218 ? PHE A 222 ? LYS A 240 PHE A 244 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLU 54 C ? ? ? 1_555 A MSE 55 N ? ? A GLU 76 A MSE 77 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale2 covale both ? A MSE 55 C ? ? ? 1_555 A THR 56 N ? ? A MSE 77 A THR 78 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale3 covale both ? A GLY 114 C ? ? ? 1_555 A MSE 115 N ? ? A GLY 136 A MSE 137 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale4 covale both ? A MSE 115 C ? ? ? 1_555 A PRO 116 N ? ? A MSE 137 A PRO 138 1_555 ? ? ? ? ? ? ? 1.352 ? ? covale5 covale both ? A ASP 135 C ? ? ? 1_555 A MSE 136 N ? ? A ASP 157 A MSE 158 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale6 covale both ? A MSE 136 C ? ? ? 1_555 A LEU 137 N ? ? A MSE 158 A LEU 159 1_555 ? ? ? ? ? ? ? 1.339 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 55 ? . . . . MSE A 77 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 115 ? . . . . MSE A 137 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 136 ? . . . . MSE A 158 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 12 ? LEU A 19 ? GLU A 34 LEU A 41 A 2 LEU A 30 ? LYS A 37 ? LEU A 52 LYS A 59 A 3 SER A 84 ? HIS A 95 ? SER A 106 HIS A 117 A 4 LEU A 98 ? PHE A 108 ? LEU A 120 PHE A 130 A 5 MSE A 115 ? ASP A 124 ? MSE A 137 ASP A 146 A 6 LYS A 129 ? VAL A 130 ? LYS A 151 VAL A 152 B 1 HIS A 179 ? ALA A 181 ? HIS A 201 ALA A 203 B 2 VAL A 187 ? LYS A 190 ? VAL A 209 LYS A 212 B 3 GLU A 205 ? ILE A 208 ? GLU A 227 ILE A 230 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 14 ? N LEU A 36 O THR A 35 ? O THR A 57 A 2 3 N ASN A 32 ? N ASN A 54 O SER A 85 ? O SER A 107 A 3 4 N GLU A 93 ? N GLU A 115 O ILE A 100 ? O ILE A 122 A 4 5 N LEU A 107 ? N LEU A 129 O MSE A 115 ? O MSE A 137 A 5 6 N ASP A 124 ? N ASP A 146 O LYS A 129 ? O LYS A 151 B 1 2 N ALA A 181 ? N ALA A 203 O THR A 188 ? O THR A 210 B 2 3 N LEU A 189 ? N LEU A 211 O LEU A 206 ? O LEU A 228 # _pdbx_entry_details.entry_id 4E72 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE CONSTRUCT (RESIDUES 24-248) WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY THE TARGET SEQUENCE. ; _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ALA _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 224 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 55.29 _pdbx_validate_torsion.psi -119.17 # _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center JCSG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 55 A MSE 77 ? MET SELENOMETHIONINE 2 A MSE 115 A MSE 137 ? MET SELENOMETHIONINE 3 A MSE 136 A MSE 158 ? MET SELENOMETHIONINE # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 35.8035 _pdbx_refine_tls.origin_y 17.9340 _pdbx_refine_tls.origin_z 18.4987 _pdbx_refine_tls.T[1][1] -0.1395 _pdbx_refine_tls.T[2][2] 0.0231 _pdbx_refine_tls.T[3][3] -0.1317 _pdbx_refine_tls.T[1][2] 0.0041 _pdbx_refine_tls.T[1][3] -0.0137 _pdbx_refine_tls.T[2][3] 0.0197 _pdbx_refine_tls.L[1][1] 1.0421 _pdbx_refine_tls.L[2][2] 1.3059 _pdbx_refine_tls.L[3][3] 2.0653 _pdbx_refine_tls.L[1][2] 0.1792 _pdbx_refine_tls.L[1][3] 0.1769 _pdbx_refine_tls.L[2][3] 0.4648 _pdbx_refine_tls.S[1][1] -0.0736 _pdbx_refine_tls.S[2][2] 0.0571 _pdbx_refine_tls.S[3][3] 0.0165 _pdbx_refine_tls.S[1][2] -0.1913 _pdbx_refine_tls.S[1][3] -0.0596 _pdbx_refine_tls.S[2][3] -0.0681 _pdbx_refine_tls.S[2][1] -0.0369 _pdbx_refine_tls.S[3][1] 0.0407 _pdbx_refine_tls.S[3][2] 0.0489 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 26 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 247 _pdbx_refine_tls_group.selection_details '{ A|26 - 247 }' _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? # _phasing.method MAD # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A LYS 24 ? A LYS 2 3 1 Y 1 A PRO 25 ? A PRO 3 4 1 Y 1 A GLU 80 ? A GLU 58 5 1 Y 1 A ASN 81 ? A ASN 59 6 1 Y 1 A ASN 82 ? A ASN 60 7 1 Y 1 A GLU 83 ? A GLU 61 8 1 Y 1 A GLY 248 ? A GLY 226 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MSE N N N N 230 MSE CA C N S 231 MSE C C N N 232 MSE O O N N 233 MSE OXT O N N 234 MSE CB C N N 235 MSE CG C N N 236 MSE SE SE N N 237 MSE CE C N N 238 MSE H H N N 239 MSE H2 H N N 240 MSE HA H N N 241 MSE HXT H N N 242 MSE HB2 H N N 243 MSE HB3 H N N 244 MSE HG2 H N N 245 MSE HG3 H N N 246 MSE HE1 H N N 247 MSE HE2 H N N 248 MSE HE3 H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _atom_sites.entry_id 4E72 _atom_sites.fract_transf_matrix[1][1] 0.009724 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001410 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019272 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024730 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ # loop_ #