data_4ENX # _entry.id 4ENX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4ENX RCSB RCSB071853 WWPDB D_1000071853 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3UMW ;Crystal structure of Pim1 kinase in complex with inhibitor (Z)-2-[(1H-indazol-3-yl)methylene]-6-methoxy-7-(piperazin-1-ylmethyl)benzofuran-3(2H)-one ; unspecified PDB 3UMX ;Crystal structure of Pim1 kinase in complex with inhibitor (Z)-2-[(1H-indol-3-yl)methylene]-7-(azepan-1-ylmethyl)-6-hydroxybenzofuran-3(2H)-one ; unspecified PDB 3UIX 'Crystal structure of Pim1 kinase in complex with small molecule inhibitor' unspecified PDB 4ENY . unspecified # _pdbx_database_status.entry_id 4ENX _pdbx_database_status.methods_development_category ? _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2012-04-13 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Parker, L.J.' 1 'Handa, N.' 2 'Yokoyama, S.' 3 # _citation.id primary _citation.title 'Flexibility of the P-loop of Pim-1 kinase: observation of a novel conformation induced by interaction with an inhibitor' _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_volume 68 _citation.page_first 860 _citation.page_last 866 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country DK _citation.journal_id_ISSN 1744-3091 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22869110 _citation.pdbx_database_id_DOI 10.1107/S1744309112027108 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Parker, L.J.' 1 primary 'Watanabe, H.' 2 primary 'Tsuganezawa, K.' 3 primary 'Tomabechi, Y.' 4 primary 'Handa, N.' 5 primary 'Shirouzu, M.' 6 primary 'Yuki, H.' 7 primary 'Honma, T.' 8 primary 'Ogawa, N.' 9 primary 'Nagano, T.' 10 primary 'Yokoyama, S.' 11 primary 'Tanaka, A.' 12 # _cell.length_a 97.074 _cell.length_b 97.074 _cell.length_c 80.941 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4ENX _cell.pdbx_unique_axis ? _cell.Z_PDB 6 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 65' _symmetry.entry_id 4ENX _symmetry.Int_Tables_number 170 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase pim-1' 34187.727 1 2.7.11.1 ? 'Protein kinase domain, UNP RESIDUES 120-404' ? 2 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 3 non-polymer syn '(2Z,5Z)-2-[(2-chlorophenyl)imino]-5-(4-hydroxy-3-nitrobenzylidene)-1,3-thiazolidin-4-one' 375.786 1 ? ? ? ? 4 water nat water 18.015 55 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLL DWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDF GSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLI RWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSKSGPSSGENLYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLL DWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDF GSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLI RWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSKSGPSSGENLYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 GLU n 1 4 LYS n 1 5 GLU n 1 6 PRO n 1 7 LEU n 1 8 GLU n 1 9 SER n 1 10 GLN n 1 11 TYR n 1 12 GLN n 1 13 VAL n 1 14 GLY n 1 15 PRO n 1 16 LEU n 1 17 LEU n 1 18 GLY n 1 19 SER n 1 20 GLY n 1 21 GLY n 1 22 PHE n 1 23 GLY n 1 24 SER n 1 25 VAL n 1 26 TYR n 1 27 SER n 1 28 GLY n 1 29 ILE n 1 30 ARG n 1 31 VAL n 1 32 SER n 1 33 ASP n 1 34 ASN n 1 35 LEU n 1 36 PRO n 1 37 VAL n 1 38 ALA n 1 39 ILE n 1 40 LYS n 1 41 HIS n 1 42 VAL n 1 43 GLU n 1 44 LYS n 1 45 ASP n 1 46 ARG n 1 47 ILE n 1 48 SER n 1 49 ASP n 1 50 TRP n 1 51 GLY n 1 52 GLU n 1 53 LEU n 1 54 PRO n 1 55 ASN n 1 56 GLY n 1 57 THR n 1 58 ARG n 1 59 VAL n 1 60 PRO n 1 61 MET n 1 62 GLU n 1 63 VAL n 1 64 VAL n 1 65 LEU n 1 66 LEU n 1 67 LYS n 1 68 LYS n 1 69 VAL n 1 70 SER n 1 71 SER n 1 72 GLY n 1 73 PHE n 1 74 SER n 1 75 GLY n 1 76 VAL n 1 77 ILE n 1 78 ARG n 1 79 LEU n 1 80 LEU n 1 81 ASP n 1 82 TRP n 1 83 PHE n 1 84 GLU n 1 85 ARG n 1 86 PRO n 1 87 ASP n 1 88 SER n 1 89 PHE n 1 90 VAL n 1 91 LEU n 1 92 ILE n 1 93 LEU n 1 94 GLU n 1 95 ARG n 1 96 PRO n 1 97 GLU n 1 98 PRO n 1 99 VAL n 1 100 GLN n 1 101 ASP n 1 102 LEU n 1 103 PHE n 1 104 ASP n 1 105 PHE n 1 106 ILE n 1 107 THR n 1 108 GLU n 1 109 ARG n 1 110 GLY n 1 111 ALA n 1 112 LEU n 1 113 GLN n 1 114 GLU n 1 115 GLU n 1 116 LEU n 1 117 ALA n 1 118 ARG n 1 119 SER n 1 120 PHE n 1 121 PHE n 1 122 TRP n 1 123 GLN n 1 124 VAL n 1 125 LEU n 1 126 GLU n 1 127 ALA n 1 128 VAL n 1 129 ARG n 1 130 HIS n 1 131 CYS n 1 132 HIS n 1 133 ASN n 1 134 CYS n 1 135 GLY n 1 136 VAL n 1 137 LEU n 1 138 HIS n 1 139 ARG n 1 140 ASP n 1 141 ILE n 1 142 LYS n 1 143 ASP n 1 144 GLU n 1 145 ASN n 1 146 ILE n 1 147 LEU n 1 148 ILE n 1 149 ASP n 1 150 LEU n 1 151 ASN n 1 152 ARG n 1 153 GLY n 1 154 GLU n 1 155 LEU n 1 156 LYS n 1 157 LEU n 1 158 ILE n 1 159 ASP n 1 160 PHE n 1 161 GLY n 1 162 SER n 1 163 GLY n 1 164 ALA n 1 165 LEU n 1 166 LEU n 1 167 LYS n 1 168 ASP n 1 169 THR n 1 170 VAL n 1 171 TYR n 1 172 THR n 1 173 ASP n 1 174 PHE n 1 175 ASP n 1 176 GLY n 1 177 THR n 1 178 ARG n 1 179 VAL n 1 180 TYR n 1 181 SER n 1 182 PRO n 1 183 PRO n 1 184 GLU n 1 185 TRP n 1 186 ILE n 1 187 ARG n 1 188 TYR n 1 189 HIS n 1 190 ARG n 1 191 TYR n 1 192 HIS n 1 193 GLY n 1 194 ARG n 1 195 SER n 1 196 ALA n 1 197 ALA n 1 198 VAL n 1 199 TRP n 1 200 SER n 1 201 LEU n 1 202 GLY n 1 203 ILE n 1 204 LEU n 1 205 LEU n 1 206 TYR n 1 207 ASP n 1 208 MET n 1 209 VAL n 1 210 CYS n 1 211 GLY n 1 212 ASP n 1 213 ILE n 1 214 PRO n 1 215 PHE n 1 216 GLU n 1 217 HIS n 1 218 ASP n 1 219 GLU n 1 220 GLU n 1 221 ILE n 1 222 ILE n 1 223 ARG n 1 224 GLY n 1 225 GLN n 1 226 VAL n 1 227 PHE n 1 228 PHE n 1 229 ARG n 1 230 GLN n 1 231 ARG n 1 232 VAL n 1 233 SER n 1 234 SER n 1 235 GLU n 1 236 CYS n 1 237 GLN n 1 238 HIS n 1 239 LEU n 1 240 ILE n 1 241 ARG n 1 242 TRP n 1 243 CYS n 1 244 LEU n 1 245 ALA n 1 246 LEU n 1 247 ARG n 1 248 PRO n 1 249 SER n 1 250 ASP n 1 251 ARG n 1 252 PRO n 1 253 THR n 1 254 PHE n 1 255 GLU n 1 256 GLU n 1 257 ILE n 1 258 GLN n 1 259 ASN n 1 260 HIS n 1 261 PRO n 1 262 TRP n 1 263 MET n 1 264 GLN n 1 265 ASP n 1 266 VAL n 1 267 LEU n 1 268 LEU n 1 269 PRO n 1 270 GLN n 1 271 GLU n 1 272 THR n 1 273 ALA n 1 274 GLU n 1 275 ILE n 1 276 HIS n 1 277 LEU n 1 278 HIS n 1 279 SER n 1 280 LEU n 1 281 SER n 1 282 PRO n 1 283 GLY n 1 284 PRO n 1 285 SER n 1 286 LYS n 1 287 SER n 1 288 GLY n 1 289 PRO n 1 290 SER n 1 291 SER n 1 292 GLY n 1 293 GLU n 1 294 ASN n 1 295 LEU n 1 296 TYR n 1 297 PHE n 1 298 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PIM1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'cell-free protein synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pCR2.1-TOPO _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PIM1_HUMAN _struct_ref.pdbx_db_accession P11309 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLD WFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFG SGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIR WCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK ; _struct_ref.pdbx_align_begin 120 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4ENX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 286 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11309 _struct_ref_seq.db_align_beg 120 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 404 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 29 _struct_ref_seq.pdbx_auth_seq_align_end 313 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4ENX MET A 1 ? UNP P11309 ? ? 'EXPRESSION TAG' 28 1 1 4ENX SER A 287 ? UNP P11309 ? ? 'EXPRESSION TAG' 314 2 1 4ENX GLY A 288 ? UNP P11309 ? ? 'EXPRESSION TAG' 315 3 1 4ENX PRO A 289 ? UNP P11309 ? ? 'EXPRESSION TAG' 316 4 1 4ENX SER A 290 ? UNP P11309 ? ? 'EXPRESSION TAG' 317 5 1 4ENX SER A 291 ? UNP P11309 ? ? 'EXPRESSION TAG' 318 6 1 4ENX GLY A 292 ? UNP P11309 ? ? 'EXPRESSION TAG' 319 7 1 4ENX GLU A 293 ? UNP P11309 ? ? 'EXPRESSION TAG' 320 8 1 4ENX ASN A 294 ? UNP P11309 ? ? 'EXPRESSION TAG' 321 9 1 4ENX LEU A 295 ? UNP P11309 ? ? 'EXPRESSION TAG' 322 10 1 4ENX TYR A 296 ? UNP P11309 ? ? 'EXPRESSION TAG' 323 11 1 4ENX PHE A 297 ? UNP P11309 ? ? 'EXPRESSION TAG' 324 12 1 4ENX GLN A 298 ? UNP P11309 ? ? 'EXPRESSION TAG' 325 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 Z20 non-polymer . '(2Z,5Z)-2-[(2-chlorophenyl)imino]-5-(4-hydroxy-3-nitrobenzylidene)-1,3-thiazolidin-4-one' ? 'C16 H10 Cl N3 O4 S' 375.786 # _exptl.crystals_number 1 _exptl.entry_id 4ENX _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 3.22 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 61.80 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '100mM Citrate buffer, pH 5.5, 200mM NaCl, 1M NH4HPO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.pdbx_collection_date 2009-08-31 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU MICROMAX-007' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.entry_id 4ENX _reflns.d_resolution_high 2.800 _reflns.d_resolution_low 31.782 _reflns.number_all 10791 _reflns.number_obs 10791 _reflns.pdbx_Rmerge_I_obs 0.086 _reflns.pdbx_netI_over_sigmaI 40.100 _reflns.pdbx_Rsym_value 0.086 _reflns.pdbx_redundancy 22.700 _reflns.percent_possible_obs 99.900 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.B_iso_Wilson_estimate 60.77 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.800 2.950 ? 35369 ? ? 0.385 2.000 0.385 ? 22.600 ? 10.100 ? 1565 ? ? 0.394 ? 100.000 0.394 0.082 1 1 2.950 3.130 ? 33546 ? ? 0.282 2.700 0.282 ? 22.600 ? 14.000 ? 1482 ? ? 0.288 ? 100.000 0.288 0.060 2 1 3.130 3.350 ? 31477 ? ? 0.181 4.200 0.181 ? 22.700 ? 21.100 ? 1386 ? ? 0.185 ? 100.000 0.185 0.038 3 1 3.350 3.610 ? 29737 ? ? 0.112 6.700 0.112 ? 22.800 ? 32.200 ? 1307 ? ? 0.115 ? 100.000 0.115 0.024 4 1 3.610 3.960 ? 27280 ? ? 0.073 10.100 0.073 ? 22.800 ? 45.300 ? 1194 ? ? 0.075 ? 100.000 0.075 0.016 5 1 3.960 4.430 ? 24657 ? ? 0.052 13.900 0.052 ? 22.800 ? 58.800 ? 1083 ? ? 0.054 ? 100.000 0.054 0.011 6 1 4.430 5.110 ? 22030 ? ? 0.042 17.000 0.042 ? 22.900 ? 69.300 ? 964 ? ? 0.043 ? 100.000 0.043 0.009 7 1 5.110 6.260 ? 18595 ? ? 0.046 16.100 0.046 ? 22.800 ? 66.800 ? 816 ? ? 0.047 ? 100.000 0.047 0.010 8 1 6.260 8.850 ? 14406 ? ? 0.036 19.500 0.036 ? 22.500 ? 78.500 ? 639 ? ? 0.037 ? 100.000 0.037 0.008 9 1 8.850 31.782 ? 7327 ? ? 0.026 22.300 0.026 ? 20.600 ? 99.400 ? 355 ? ? 0.027 ? 98.200 0.027 0.006 10 1 # _refine.entry_id 4ENX _refine.ls_d_res_high 2.8000 _refine.ls_d_res_low 31.7750 _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.9300 _refine.ls_number_reflns_obs 10762 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1923 _refine.ls_R_factor_R_work 0.1902 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2326 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0500 _refine.ls_number_reflns_R_free 544 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 43.2285 _refine.solvent_model_param_bsol 30.5870 _refine.solvent_model_param_ksol 0.3670 _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 2.6182 _refine.aniso_B[2][2] 2.6182 _refine.aniso_B[3][3] -5.2364 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][3] -0.0000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.3100 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.0000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.7300 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 3UMX _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8502 _refine.B_iso_max 99.290 _refine.B_iso_min 16.490 _refine.pdbx_overall_phase_error 22.0600 _refine.occupancy_max 1.000 _refine.occupancy_min 0.500 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2160 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 55 _refine_hist.number_atoms_total 2245 _refine_hist.d_res_high 2.8000 _refine_hist.d_res_low 31.7750 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 2248 0.006 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 3052 0.891 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 322 0.058 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 395 0.003 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 820 13.147 ? ? ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.redundancy_reflns_obs 2.8003 3.0819 4 100.0000 2534 . 0.2558 0.2980 . 140 . 2674 2534 'X-RAY DIFFRACTION' . 3.0819 3.5274 4 100.0000 2540 . 0.2004 0.2709 . 143 . 2683 2540 'X-RAY DIFFRACTION' . 3.5274 4.4422 4 100.0000 2556 . 0.1657 0.2125 . 131 . 2687 2556 'X-RAY DIFFRACTION' . 4.4422 31.7771 4 100.0000 2588 . 0.1816 0.1997 . 130 . 2718 2588 'X-RAY DIFFRACTION' . # _struct.entry_id 4ENX _struct.title ;Crystal Structure of Pim-1 Kinase in complex with inhibitor (2E,5Z)-2-(2-chlorophenylimino)-5-(4-hydroxy-3-nitrobenzylidene)thiazolidin-4-one ; _struct.pdbx_descriptor 'Serine/threonine-protein kinase pim-1 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4ENX _struct_keywords.pdbx_keywords TRANSFERASE/INHIBITOR _struct_keywords.text 'Pim-1 kinase, TRANSFERASE-INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 45 ? ILE A 47 ? ASP A 72 ILE A 74 5 ? 3 HELX_P HELX_P2 2 MET A 61 ? SER A 70 ? MET A 88 SER A 97 1 ? 10 HELX_P HELX_P3 3 LEU A 102 ? GLY A 110 ? LEU A 129 GLY A 137 1 ? 9 HELX_P HELX_P4 4 GLN A 113 ? CYS A 134 ? GLN A 140 CYS A 161 1 ? 22 HELX_P HELX_P5 5 LYS A 142 ? GLU A 144 ? LYS A 169 GLU A 171 5 ? 3 HELX_P HELX_P6 6 THR A 177 ? SER A 181 ? THR A 204 SER A 208 5 ? 5 HELX_P HELX_P7 7 PRO A 182 ? HIS A 189 ? PRO A 209 HIS A 216 1 ? 8 HELX_P HELX_P8 8 HIS A 192 ? GLY A 211 ? HIS A 219 GLY A 238 1 ? 20 HELX_P HELX_P9 9 HIS A 217 ? GLY A 224 ? HIS A 244 GLY A 251 1 ? 8 HELX_P HELX_P10 10 SER A 233 ? LEU A 244 ? SER A 260 LEU A 271 1 ? 12 HELX_P HELX_P11 11 ARG A 247 ? ARG A 251 ? ARG A 274 ARG A 278 5 ? 5 HELX_P HELX_P12 12 THR A 253 ? ASN A 259 ? THR A 280 ASN A 286 1 ? 7 HELX_P HELX_P13 13 HIS A 260 ? GLN A 264 ? HIS A 287 GLN A 291 5 ? 5 HELX_P HELX_P14 14 LEU A 268 ? LEU A 277 ? LEU A 295 LEU A 304 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 97 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 124 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 98 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 125 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.00 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? C ? 3 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 11 ? GLY A 20 ? TYR A 38 GLY A 47 A 2 GLY A 23 ? ARG A 30 ? GLY A 50 ARG A 57 A 3 LEU A 35 ? GLU A 43 ? LEU A 62 GLU A 70 A 4 SER A 88 ? GLU A 94 ? SER A 115 GLU A 121 A 5 LEU A 79 ? GLU A 84 ? LEU A 106 GLU A 111 B 1 TRP A 50 ? GLY A 51 ? TRP A 77 GLY A 78 B 2 VAL A 59 ? PRO A 60 ? VAL A 86 PRO A 87 C 1 VAL A 99 ? ASP A 101 ? VAL A 126 ASP A 128 C 2 ILE A 146 ? ASP A 149 ? ILE A 173 ASP A 176 C 3 GLU A 154 ? LEU A 157 ? GLU A 181 LEU A 184 D 1 VAL A 136 ? LEU A 137 ? VAL A 163 LEU A 164 D 2 ALA A 164 ? LEU A 165 ? ALA A 191 LEU A 192 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 14 ? N GLY A 41 O SER A 27 ? O SER A 54 A 2 3 N SER A 24 ? N SER A 51 O HIS A 41 ? O HIS A 68 A 3 4 N LYS A 40 ? N LYS A 67 O LEU A 91 ? O LEU A 118 A 4 5 O VAL A 90 ? O VAL A 117 N PHE A 83 ? N PHE A 110 B 1 2 N GLY A 51 ? N GLY A 78 O VAL A 59 ? O VAL A 86 C 1 2 N GLN A 100 ? N GLN A 127 O ILE A 148 ? O ILE A 175 C 2 3 N LEU A 147 ? N LEU A 174 O LYS A 156 ? O LYS A 183 D 1 2 N LEU A 137 ? N LEU A 164 O ALA A 164 ? O ALA A 191 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PO4 A 401' AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE Z20 A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 129 ? ARG A 156 . ? 3_445 ? 2 AC1 4 ARG A 231 ? ARG A 258 . ? 1_555 ? 3 AC1 4 SER A 233 ? SER A 260 . ? 1_555 ? 4 AC1 4 SER A 234 ? SER A 261 . ? 1_555 ? 5 AC2 14 LEU A 17 ? LEU A 44 . ? 1_555 ? 6 AC2 14 GLY A 18 ? GLY A 45 . ? 1_555 ? 7 AC2 14 SER A 19 ? SER A 46 . ? 1_555 ? 8 AC2 14 PHE A 22 ? PHE A 49 . ? 1_555 ? 9 AC2 14 GLY A 23 ? GLY A 50 . ? 1_555 ? 10 AC2 14 VAL A 25 ? VAL A 52 . ? 1_555 ? 11 AC2 14 ALA A 38 ? ALA A 65 . ? 1_555 ? 12 AC2 14 LYS A 40 ? LYS A 67 . ? 1_555 ? 13 AC2 14 LEU A 93 ? LEU A 120 . ? 1_555 ? 14 AC2 14 GLU A 94 ? GLU A 121 . ? 1_555 ? 15 AC2 14 ARG A 95 ? ARG A 122 . ? 1_555 ? 16 AC2 14 LEU A 147 ? LEU A 174 . ? 1_555 ? 17 AC2 14 ASP A 159 ? ASP A 186 . ? 1_555 ? 18 AC2 14 HOH D . ? HOH A 545 . ? 1_555 ? # _atom_sites.entry_id 4ENX _atom_sites.fract_transf_matrix[1][1] 0.010301 _atom_sites.fract_transf_matrix[1][2] 0.005947 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011895 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012355 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 28 ? ? ? A . n A 1 2 LYS 2 29 ? ? ? A . n A 1 3 GLU 3 30 ? ? ? A . n A 1 4 LYS 4 31 ? ? ? A . n A 1 5 GLU 5 32 ? ? ? A . n A 1 6 PRO 6 33 ? ? ? A . n A 1 7 LEU 7 34 ? ? ? A . n A 1 8 GLU 8 35 ? ? ? A . n A 1 9 SER 9 36 ? ? ? A . n A 1 10 GLN 10 37 37 GLN GLN A . n A 1 11 TYR 11 38 38 TYR TYR A . n A 1 12 GLN 12 39 39 GLN GLN A . n A 1 13 VAL 13 40 40 VAL VAL A . n A 1 14 GLY 14 41 41 GLY GLY A . n A 1 15 PRO 15 42 42 PRO PRO A . n A 1 16 LEU 16 43 43 LEU LEU A . n A 1 17 LEU 17 44 44 LEU LEU A . n A 1 18 GLY 18 45 45 GLY GLY A . n A 1 19 SER 19 46 46 SER SER A . n A 1 20 GLY 20 47 47 GLY GLY A . n A 1 21 GLY 21 48 48 GLY GLY A . n A 1 22 PHE 22 49 49 PHE PHE A . n A 1 23 GLY 23 50 50 GLY GLY A . n A 1 24 SER 24 51 51 SER SER A . n A 1 25 VAL 25 52 52 VAL VAL A . n A 1 26 TYR 26 53 53 TYR TYR A . n A 1 27 SER 27 54 54 SER SER A . n A 1 28 GLY 28 55 55 GLY GLY A . n A 1 29 ILE 29 56 56 ILE ILE A . n A 1 30 ARG 30 57 57 ARG ARG A . n A 1 31 VAL 31 58 58 VAL VAL A . n A 1 32 SER 32 59 59 SER SER A . n A 1 33 ASP 33 60 60 ASP ASP A . n A 1 34 ASN 34 61 61 ASN ASN A . n A 1 35 LEU 35 62 62 LEU LEU A . n A 1 36 PRO 36 63 63 PRO PRO A . n A 1 37 VAL 37 64 64 VAL VAL A . n A 1 38 ALA 38 65 65 ALA ALA A . n A 1 39 ILE 39 66 66 ILE ILE A . n A 1 40 LYS 40 67 67 LYS LYS A . n A 1 41 HIS 41 68 68 HIS HIS A . n A 1 42 VAL 42 69 69 VAL VAL A . n A 1 43 GLU 43 70 70 GLU GLU A . n A 1 44 LYS 44 71 71 LYS LYS A . n A 1 45 ASP 45 72 72 ASP ASP A . n A 1 46 ARG 46 73 73 ARG ARG A . n A 1 47 ILE 47 74 74 ILE ILE A . n A 1 48 SER 48 75 75 SER SER A . n A 1 49 ASP 49 76 76 ASP ASP A . n A 1 50 TRP 50 77 77 TRP TRP A . n A 1 51 GLY 51 78 78 GLY GLY A . n A 1 52 GLU 52 79 79 GLU GLU A . n A 1 53 LEU 53 80 80 LEU LEU A . n A 1 54 PRO 54 81 ? ? ? A . n A 1 55 ASN 55 82 ? ? ? A . n A 1 56 GLY 56 83 ? ? ? A . n A 1 57 THR 57 84 84 THR THR A . n A 1 58 ARG 58 85 85 ARG ARG A . n A 1 59 VAL 59 86 86 VAL VAL A . n A 1 60 PRO 60 87 87 PRO PRO A . n A 1 61 MET 61 88 88 MET MET A . n A 1 62 GLU 62 89 89 GLU GLU A . n A 1 63 VAL 63 90 90 VAL VAL A . n A 1 64 VAL 64 91 91 VAL VAL A . n A 1 65 LEU 65 92 92 LEU LEU A . n A 1 66 LEU 66 93 93 LEU LEU A . n A 1 67 LYS 67 94 94 LYS LYS A . n A 1 68 LYS 68 95 95 LYS LYS A . n A 1 69 VAL 69 96 96 VAL VAL A . n A 1 70 SER 70 97 97 SER SER A . n A 1 71 SER 71 98 98 SER SER A . n A 1 72 GLY 72 99 99 GLY GLY A . n A 1 73 PHE 73 100 100 PHE PHE A . n A 1 74 SER 74 101 101 SER SER A . n A 1 75 GLY 75 102 102 GLY GLY A . n A 1 76 VAL 76 103 103 VAL VAL A . n A 1 77 ILE 77 104 104 ILE ILE A . n A 1 78 ARG 78 105 105 ARG ARG A . n A 1 79 LEU 79 106 106 LEU LEU A . n A 1 80 LEU 80 107 107 LEU LEU A . n A 1 81 ASP 81 108 108 ASP ASP A . n A 1 82 TRP 82 109 109 TRP TRP A . n A 1 83 PHE 83 110 110 PHE PHE A . n A 1 84 GLU 84 111 111 GLU GLU A . n A 1 85 ARG 85 112 112 ARG ARG A . n A 1 86 PRO 86 113 113 PRO PRO A . n A 1 87 ASP 87 114 114 ASP ASP A . n A 1 88 SER 88 115 115 SER SER A . n A 1 89 PHE 89 116 116 PHE PHE A . n A 1 90 VAL 90 117 117 VAL VAL A . n A 1 91 LEU 91 118 118 LEU LEU A . n A 1 92 ILE 92 119 119 ILE ILE A . n A 1 93 LEU 93 120 120 LEU LEU A . n A 1 94 GLU 94 121 121 GLU GLU A . n A 1 95 ARG 95 122 122 ARG ARG A . n A 1 96 PRO 96 123 123 PRO PRO A . n A 1 97 GLU 97 124 124 GLU GLU A . n A 1 98 PRO 98 125 125 PRO PRO A . n A 1 99 VAL 99 126 126 VAL VAL A . n A 1 100 GLN 100 127 127 GLN GLN A . n A 1 101 ASP 101 128 128 ASP ASP A . n A 1 102 LEU 102 129 129 LEU LEU A . n A 1 103 PHE 103 130 130 PHE PHE A . n A 1 104 ASP 104 131 131 ASP ASP A . n A 1 105 PHE 105 132 132 PHE PHE A . n A 1 106 ILE 106 133 133 ILE ILE A . n A 1 107 THR 107 134 134 THR THR A . n A 1 108 GLU 108 135 135 GLU GLU A . n A 1 109 ARG 109 136 136 ARG ARG A . n A 1 110 GLY 110 137 137 GLY GLY A . n A 1 111 ALA 111 138 138 ALA ALA A . n A 1 112 LEU 112 139 139 LEU LEU A . n A 1 113 GLN 113 140 140 GLN GLN A . n A 1 114 GLU 114 141 141 GLU GLU A . n A 1 115 GLU 115 142 142 GLU GLU A . n A 1 116 LEU 116 143 143 LEU LEU A . n A 1 117 ALA 117 144 144 ALA ALA A . n A 1 118 ARG 118 145 145 ARG ARG A . n A 1 119 SER 119 146 146 SER SER A . n A 1 120 PHE 120 147 147 PHE PHE A . n A 1 121 PHE 121 148 148 PHE PHE A . n A 1 122 TRP 122 149 149 TRP TRP A . n A 1 123 GLN 123 150 150 GLN GLN A . n A 1 124 VAL 124 151 151 VAL VAL A . n A 1 125 LEU 125 152 152 LEU LEU A . n A 1 126 GLU 126 153 153 GLU GLU A . n A 1 127 ALA 127 154 154 ALA ALA A . n A 1 128 VAL 128 155 155 VAL VAL A . n A 1 129 ARG 129 156 156 ARG ARG A . n A 1 130 HIS 130 157 157 HIS HIS A . n A 1 131 CYS 131 158 158 CYS CYS A . n A 1 132 HIS 132 159 159 HIS HIS A . n A 1 133 ASN 133 160 160 ASN ASN A . n A 1 134 CYS 134 161 161 CYS CYS A . n A 1 135 GLY 135 162 162 GLY GLY A . n A 1 136 VAL 136 163 163 VAL VAL A . n A 1 137 LEU 137 164 164 LEU LEU A . n A 1 138 HIS 138 165 165 HIS HIS A . n A 1 139 ARG 139 166 166 ARG ARG A . n A 1 140 ASP 140 167 167 ASP ASP A . n A 1 141 ILE 141 168 168 ILE ILE A . n A 1 142 LYS 142 169 169 LYS LYS A . n A 1 143 ASP 143 170 170 ASP ASP A . n A 1 144 GLU 144 171 171 GLU GLU A . n A 1 145 ASN 145 172 172 ASN ASN A . n A 1 146 ILE 146 173 173 ILE ILE A . n A 1 147 LEU 147 174 174 LEU LEU A . n A 1 148 ILE 148 175 175 ILE ILE A . n A 1 149 ASP 149 176 176 ASP ASP A . n A 1 150 LEU 150 177 177 LEU LEU A . n A 1 151 ASN 151 178 178 ASN ASN A . n A 1 152 ARG 152 179 179 ARG ARG A . n A 1 153 GLY 153 180 180 GLY GLY A . n A 1 154 GLU 154 181 181 GLU GLU A . n A 1 155 LEU 155 182 182 LEU LEU A . n A 1 156 LYS 156 183 183 LYS LYS A . n A 1 157 LEU 157 184 184 LEU LEU A . n A 1 158 ILE 158 185 185 ILE ILE A . n A 1 159 ASP 159 186 186 ASP ASP A . n A 1 160 PHE 160 187 187 PHE PHE A . n A 1 161 GLY 161 188 188 GLY GLY A . n A 1 162 SER 162 189 189 SER SER A . n A 1 163 GLY 163 190 190 GLY GLY A . n A 1 164 ALA 164 191 191 ALA ALA A . n A 1 165 LEU 165 192 192 LEU LEU A . n A 1 166 LEU 166 193 193 LEU LEU A . n A 1 167 LYS 167 194 194 LYS LYS A . n A 1 168 ASP 168 195 195 ASP ASP A . n A 1 169 THR 169 196 196 THR THR A . n A 1 170 VAL 170 197 197 VAL VAL A . n A 1 171 TYR 171 198 198 TYR TYR A . n A 1 172 THR 172 199 199 THR THR A . n A 1 173 ASP 173 200 200 ASP ASP A . n A 1 174 PHE 174 201 201 PHE PHE A . n A 1 175 ASP 175 202 202 ASP ASP A . n A 1 176 GLY 176 203 203 GLY GLY A . n A 1 177 THR 177 204 204 THR THR A . n A 1 178 ARG 178 205 205 ARG ARG A . n A 1 179 VAL 179 206 206 VAL VAL A . n A 1 180 TYR 180 207 207 TYR TYR A . n A 1 181 SER 181 208 208 SER SER A . n A 1 182 PRO 182 209 209 PRO PRO A . n A 1 183 PRO 183 210 210 PRO PRO A . n A 1 184 GLU 184 211 211 GLU GLU A . n A 1 185 TRP 185 212 212 TRP TRP A . n A 1 186 ILE 186 213 213 ILE ILE A . n A 1 187 ARG 187 214 214 ARG ARG A . n A 1 188 TYR 188 215 215 TYR TYR A . n A 1 189 HIS 189 216 216 HIS HIS A . n A 1 190 ARG 190 217 217 ARG ARG A . n A 1 191 TYR 191 218 218 TYR TYR A . n A 1 192 HIS 192 219 219 HIS HIS A . n A 1 193 GLY 193 220 220 GLY GLY A . n A 1 194 ARG 194 221 221 ARG ARG A . n A 1 195 SER 195 222 222 SER SER A . n A 1 196 ALA 196 223 223 ALA ALA A . n A 1 197 ALA 197 224 224 ALA ALA A . n A 1 198 VAL 198 225 225 VAL VAL A . n A 1 199 TRP 199 226 226 TRP TRP A . n A 1 200 SER 200 227 227 SER SER A . n A 1 201 LEU 201 228 228 LEU LEU A . n A 1 202 GLY 202 229 229 GLY GLY A . n A 1 203 ILE 203 230 230 ILE ILE A . n A 1 204 LEU 204 231 231 LEU LEU A . n A 1 205 LEU 205 232 232 LEU LEU A . n A 1 206 TYR 206 233 233 TYR TYR A . n A 1 207 ASP 207 234 234 ASP ASP A . n A 1 208 MET 208 235 235 MET MET A . n A 1 209 VAL 209 236 236 VAL VAL A . n A 1 210 CYS 210 237 237 CYS CYS A . n A 1 211 GLY 211 238 238 GLY GLY A . n A 1 212 ASP 212 239 239 ASP ASP A . n A 1 213 ILE 213 240 240 ILE ILE A . n A 1 214 PRO 214 241 241 PRO PRO A . n A 1 215 PHE 215 242 242 PHE PHE A . n A 1 216 GLU 216 243 243 GLU GLU A . n A 1 217 HIS 217 244 244 HIS HIS A . n A 1 218 ASP 218 245 245 ASP ASP A . n A 1 219 GLU 219 246 246 GLU GLU A . n A 1 220 GLU 220 247 247 GLU GLU A . n A 1 221 ILE 221 248 248 ILE ILE A . n A 1 222 ILE 222 249 249 ILE ILE A . n A 1 223 ARG 223 250 250 ARG ARG A . n A 1 224 GLY 224 251 251 GLY GLY A . n A 1 225 GLN 225 252 252 GLN GLN A . n A 1 226 VAL 226 253 253 VAL VAL A . n A 1 227 PHE 227 254 254 PHE PHE A . n A 1 228 PHE 228 255 255 PHE PHE A . n A 1 229 ARG 229 256 256 ARG ARG A . n A 1 230 GLN 230 257 257 GLN GLN A . n A 1 231 ARG 231 258 258 ARG ARG A . n A 1 232 VAL 232 259 259 VAL VAL A . n A 1 233 SER 233 260 260 SER SER A . n A 1 234 SER 234 261 261 SER SER A . n A 1 235 GLU 235 262 262 GLU GLU A . n A 1 236 CYS 236 263 263 CYS CYS A . n A 1 237 GLN 237 264 264 GLN GLN A . n A 1 238 HIS 238 265 265 HIS HIS A . n A 1 239 LEU 239 266 266 LEU LEU A . n A 1 240 ILE 240 267 267 ILE ILE A . n A 1 241 ARG 241 268 268 ARG ARG A . n A 1 242 TRP 242 269 269 TRP TRP A . n A 1 243 CYS 243 270 270 CYS CYS A . n A 1 244 LEU 244 271 271 LEU LEU A . n A 1 245 ALA 245 272 272 ALA ALA A . n A 1 246 LEU 246 273 273 LEU LEU A . n A 1 247 ARG 247 274 274 ARG ARG A . n A 1 248 PRO 248 275 275 PRO PRO A . n A 1 249 SER 249 276 276 SER SER A . n A 1 250 ASP 250 277 277 ASP ASP A . n A 1 251 ARG 251 278 278 ARG ARG A . n A 1 252 PRO 252 279 279 PRO PRO A . n A 1 253 THR 253 280 280 THR THR A . n A 1 254 PHE 254 281 281 PHE PHE A . n A 1 255 GLU 255 282 282 GLU GLU A . n A 1 256 GLU 256 283 283 GLU GLU A . n A 1 257 ILE 257 284 284 ILE ILE A . n A 1 258 GLN 258 285 285 GLN GLN A . n A 1 259 ASN 259 286 286 ASN ASN A . n A 1 260 HIS 260 287 287 HIS HIS A . n A 1 261 PRO 261 288 288 PRO PRO A . n A 1 262 TRP 262 289 289 TRP TRP A . n A 1 263 MET 263 290 290 MET MET A . n A 1 264 GLN 264 291 291 GLN GLN A . n A 1 265 ASP 265 292 292 ASP ASP A . n A 1 266 VAL 266 293 293 VAL VAL A . n A 1 267 LEU 267 294 294 LEU LEU A . n A 1 268 LEU 268 295 295 LEU LEU A . n A 1 269 PRO 269 296 296 PRO PRO A . n A 1 270 GLN 270 297 297 GLN GLN A . n A 1 271 GLU 271 298 298 GLU GLU A . n A 1 272 THR 272 299 299 THR THR A . n A 1 273 ALA 273 300 300 ALA ALA A . n A 1 274 GLU 274 301 301 GLU GLU A . n A 1 275 ILE 275 302 302 ILE ILE A . n A 1 276 HIS 276 303 303 HIS HIS A . n A 1 277 LEU 277 304 304 LEU LEU A . n A 1 278 HIS 278 305 305 HIS HIS A . n A 1 279 SER 279 306 ? ? ? A . n A 1 280 LEU 280 307 ? ? ? A . n A 1 281 SER 281 308 ? ? ? A . n A 1 282 PRO 282 309 ? ? ? A . n A 1 283 GLY 283 310 ? ? ? A . n A 1 284 PRO 284 311 ? ? ? A . n A 1 285 SER 285 312 ? ? ? A . n A 1 286 LYS 286 313 ? ? ? A . n A 1 287 SER 287 314 ? ? ? A . n A 1 288 GLY 288 315 ? ? ? A . n A 1 289 PRO 289 316 ? ? ? A . n A 1 290 SER 290 317 ? ? ? A . n A 1 291 SER 291 318 ? ? ? A . n A 1 292 GLY 292 319 ? ? ? A . n A 1 293 GLU 293 320 ? ? ? A . n A 1 294 ASN 294 321 ? ? ? A . n A 1 295 LEU 295 322 ? ? ? A . n A 1 296 TYR 296 323 ? ? ? A . n A 1 297 PHE 297 324 ? ? ? A . n A 1 298 GLN 298 325 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-08-08 2 'Structure model' 1 1 2012-10-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -42.9382 6.9813 -2.5774 0.7098 0.1264 0.3293 0.0407 0.0462 0.0223 9.0424 6.3637 6.8751 0.3482 4.6552 0.7015 0.2722 -0.3221 -0.1117 0.7966 0.5995 0.5514 -0.4137 -0.0060 0.3997 'X-RAY DIFFRACTION' 2 ? refined -30.5281 1.3770 -7.7860 0.4768 0.4019 0.2905 -0.1201 0.0701 0.0093 2.1783 6.3891 4.9574 -2.6657 0.0611 -0.2753 -0.0651 -0.1727 0.2241 0.0777 -0.0791 -0.5212 -0.1706 -0.5085 1.0286 'X-RAY DIFFRACTION' 3 ? refined -39.2166 -7.8137 -11.8545 0.6199 0.3130 0.2670 -0.0172 0.0348 0.0412 1.9993 6.8917 7.2403 1.3645 -7.3452 -0.7338 -0.4826 0.3632 0.1867 1.6282 -0.0096 0.1006 -1.0417 0.1320 -0.6552 'X-RAY DIFFRACTION' 4 ? refined -43.8645 -8.9090 -1.2634 0.2312 0.1616 0.2263 0.0444 0.0207 -0.0218 1.6007 4.1995 2.2371 1.0085 0.7367 -0.8721 0.0414 0.0315 -0.1001 0.0207 0.2091 0.1715 -0.0815 -0.4065 -0.0460 'X-RAY DIFFRACTION' 5 ? refined -36.4423 -12.4844 -3.2554 0.3350 0.1395 0.1642 -0.0304 0.0334 0.0273 5.4289 2.0795 3.4152 -0.7801 -0.5069 0.9257 0.0188 -0.0499 0.0499 0.0301 0.2513 -0.0556 -0.0861 -0.3871 0.1951 'X-RAY DIFFRACTION' 6 ? refined -23.9609 -20.9868 3.1335 0.2948 0.4173 0.2368 0.0368 -0.0470 -0.0296 6.9452 6.5673 5.1385 -0.0862 -4.6357 2.2263 0.0968 0.1698 -0.2995 -0.3499 0.1553 -0.6354 0.3918 0.0981 0.5274 'X-RAY DIFFRACTION' 7 ? refined -34.2851 -21.8219 8.8306 0.2298 0.2627 0.1952 -0.0373 0.0130 -0.0393 6.1933 4.3987 3.1859 -1.8342 0.3153 -2.6378 0.0202 0.2045 -0.1922 -0.6228 -0.0945 -0.0510 0.0655 -0.2827 0.4227 'X-RAY DIFFRACTION' 8 ? refined -40.0960 -29.9913 5.2154 0.2848 0.1368 0.2720 0.0317 -0.0419 -0.0131 4.8393 3.4551 5.3184 -0.0476 0.1078 -0.2405 0.0761 0.1159 -0.1623 0.0959 -0.5176 0.0207 -0.3217 0.7879 0.0071 'X-RAY DIFFRACTION' 9 ? refined -58.4529 -18.1259 1.5928 0.2420 0.4546 0.3718 0.0880 -0.0413 0.1346 9.0505 5.3146 8.1106 4.4383 -0.3827 3.5403 -0.1641 -0.0905 0.3619 0.3212 0.2950 0.7306 -0.8478 -0.7706 -0.8843 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 37 A 61 'CHAIN A AND (RESSEQ 37:61)' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 62 A 87 'CHAIN A AND (RESSEQ 62:87)' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 88 A 105 'CHAIN A AND (RESSEQ 88:105)' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 106 A 160 'CHAIN A AND (RESSEQ 106:160)' ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 161 A 204 'CHAIN A AND (RESSEQ 161:204)' ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 205 A 219 'CHAIN A AND (RESSEQ 205:219)' ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 220 A 250 'CHAIN A AND (RESSEQ 220:250)' ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 251 A 290 'CHAIN A AND (RESSEQ 251:290)' ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 291 A 305 'CHAIN A AND (RESSEQ 291:305)' ? ? ? ? ? # _pdbx_phasing_MR.entry_id 4ENX _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.800 _pdbx_phasing_MR.d_res_low_rotation 31.780 _pdbx_phasing_MR.d_res_high_translation 2.800 _pdbx_phasing_MR.d_res_low_translation 31.780 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 MOSFLM . ? package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk 'data reduction' http://www.mrc-lmb.cam.ac.uk/harry/mosflm/ ? ? 2 SCALA 3.2.25 21/9/2006 other 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 3 PHASER 2.3.0 'Fri Sep 23 00:11:57 2011 (svn )' program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 4 PHENIX 1.7.3_928 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 5 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 CrystalClear . ? ? ? ? 'data collection' ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 98 ? ? -163.01 -167.54 2 1 ASP A 167 ? ? -157.84 42.64 3 1 ASP A 176 ? ? -66.07 98.69 4 1 ASP A 186 ? ? 56.93 87.82 5 1 ASP A 202 ? ? -141.34 41.24 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 79 ? CG ? A GLU 52 CG 2 1 Y 1 A GLU 79 ? CD ? A GLU 52 CD 3 1 Y 1 A GLU 79 ? OE1 ? A GLU 52 OE1 4 1 Y 1 A GLU 79 ? OE2 ? A GLU 52 OE2 5 1 Y 1 A LEU 80 ? CG ? A LEU 53 CG 6 1 Y 1 A LEU 80 ? CD1 ? A LEU 53 CD1 7 1 Y 1 A LEU 80 ? CD2 ? A LEU 53 CD2 8 1 Y 1 A THR 84 ? OG1 ? A THR 57 OG1 9 1 Y 1 A THR 84 ? CG2 ? A THR 57 CG2 10 1 Y 1 A ARG 105 ? CG ? A ARG 78 CG 11 1 Y 1 A ARG 105 ? CD ? A ARG 78 CD 12 1 Y 1 A ARG 105 ? NE ? A ARG 78 NE 13 1 Y 1 A ARG 105 ? CZ ? A ARG 78 CZ 14 1 Y 1 A ARG 105 ? NH1 ? A ARG 78 NH1 15 1 Y 1 A ARG 105 ? NH2 ? A ARG 78 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 28 ? A MET 1 2 1 Y 1 A LYS 29 ? A LYS 2 3 1 Y 1 A GLU 30 ? A GLU 3 4 1 Y 1 A LYS 31 ? A LYS 4 5 1 Y 1 A GLU 32 ? A GLU 5 6 1 Y 1 A PRO 33 ? A PRO 6 7 1 Y 1 A LEU 34 ? A LEU 7 8 1 Y 1 A GLU 35 ? A GLU 8 9 1 Y 1 A SER 36 ? A SER 9 10 1 Y 1 A PRO 81 ? A PRO 54 11 1 Y 1 A ASN 82 ? A ASN 55 12 1 Y 1 A GLY 83 ? A GLY 56 13 1 Y 1 A SER 306 ? A SER 279 14 1 Y 1 A LEU 307 ? A LEU 280 15 1 Y 1 A SER 308 ? A SER 281 16 1 Y 1 A PRO 309 ? A PRO 282 17 1 Y 1 A GLY 310 ? A GLY 283 18 1 Y 1 A PRO 311 ? A PRO 284 19 1 Y 1 A SER 312 ? A SER 285 20 1 Y 1 A LYS 313 ? A LYS 286 21 1 Y 1 A SER 314 ? A SER 287 22 1 Y 1 A GLY 315 ? A GLY 288 23 1 Y 1 A PRO 316 ? A PRO 289 24 1 Y 1 A SER 317 ? A SER 290 25 1 Y 1 A SER 318 ? A SER 291 26 1 Y 1 A GLY 319 ? A GLY 292 27 1 Y 1 A GLU 320 ? A GLU 293 28 1 Y 1 A ASN 321 ? A ASN 294 29 1 Y 1 A LEU 322 ? A LEU 295 30 1 Y 1 A TYR 323 ? A TYR 296 31 1 Y 1 A PHE 324 ? A PHE 297 32 1 Y 1 A GLN 325 ? A GLN 298 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 '(2Z,5Z)-2-[(2-chlorophenyl)imino]-5-(4-hydroxy-3-nitrobenzylidene)-1,3-thiazolidin-4-one' Z20 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PO4 1 401 1 PO4 PO4 A . C 3 Z20 1 402 1 Z20 020 A . D 4 HOH 1 501 1 HOH HOH A . D 4 HOH 2 502 2 HOH HOH A . D 4 HOH 3 503 3 HOH HOH A . D 4 HOH 4 504 4 HOH HOH A . D 4 HOH 5 505 5 HOH HOH A . D 4 HOH 6 506 6 HOH HOH A . D 4 HOH 7 507 7 HOH HOH A . D 4 HOH 8 508 8 HOH HOH A . D 4 HOH 9 509 9 HOH HOH A . D 4 HOH 10 510 10 HOH HOH A . D 4 HOH 11 511 11 HOH HOH A . D 4 HOH 12 512 12 HOH HOH A . D 4 HOH 13 513 13 HOH HOH A . D 4 HOH 14 514 14 HOH HOH A . D 4 HOH 15 515 15 HOH HOH A . D 4 HOH 16 516 16 HOH HOH A . D 4 HOH 17 517 17 HOH HOH A . D 4 HOH 18 518 18 HOH HOH A . D 4 HOH 19 519 19 HOH HOH A . D 4 HOH 20 520 20 HOH HOH A . D 4 HOH 21 521 21 HOH HOH A . D 4 HOH 22 522 22 HOH HOH A . D 4 HOH 23 523 23 HOH HOH A . D 4 HOH 24 524 24 HOH HOH A . D 4 HOH 25 525 25 HOH HOH A . D 4 HOH 26 526 26 HOH HOH A . D 4 HOH 27 527 27 HOH HOH A . D 4 HOH 28 528 28 HOH HOH A . D 4 HOH 29 529 29 HOH HOH A . D 4 HOH 30 530 30 HOH HOH A . D 4 HOH 31 531 31 HOH HOH A . D 4 HOH 32 532 32 HOH HOH A . D 4 HOH 33 533 33 HOH HOH A . D 4 HOH 34 534 34 HOH HOH A . D 4 HOH 35 535 35 HOH HOH A . D 4 HOH 36 536 36 HOH HOH A . D 4 HOH 37 537 37 HOH HOH A . D 4 HOH 38 538 38 HOH HOH A . D 4 HOH 39 539 39 HOH HOH A . D 4 HOH 40 540 40 HOH HOH A . D 4 HOH 41 541 41 HOH HOH A . D 4 HOH 42 542 42 HOH HOH A . D 4 HOH 43 543 43 HOH HOH A . D 4 HOH 44 544 44 HOH HOH A . D 4 HOH 45 545 45 HOH HOH A . D 4 HOH 46 546 46 HOH HOH A . D 4 HOH 47 547 47 HOH HOH A . D 4 HOH 48 548 48 HOH HOH A . D 4 HOH 49 549 49 HOH HOH A . D 4 HOH 50 550 50 HOH HOH A . D 4 HOH 51 551 51 HOH HOH A . D 4 HOH 52 552 52 HOH HOH A . D 4 HOH 53 553 53 HOH HOH A . D 4 HOH 54 554 54 HOH HOH A . D 4 HOH 55 555 55 HOH HOH A . #