data_4EOA # _entry.id 4EOA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4EOA RCSB RCSB071866 WWPDB D_1000071866 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2013-12-04 _pdbx_database_PDB_obs_spr.pdb_id 4NP5 _pdbx_database_PDB_obs_spr.replace_pdb_id 4EOA _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3BDC 'Crystal structure of Staphylococcal nuclease variant Delta+PHS at cryogenic temperature' unspecified PDB 3V2T 'Crystal structure of Staphylococcal nuclease variant Delta+PHS I92A/V66A at cryogenic temperature' unspecified PDB 3NQT 'Crystal structure of Staphylococcal nuclease variant Delta+PHS V66A at cryogenic temperature' unspecified PDB 3MEH 'Crystal structure of Staphylococcal nuclease variant Delta+PHS I92A at cryogenic temperature' unspecified PDB 2OEO 'Cryogenic crystal structure of Staphylococcal Nuclease variant truncated Delta+PHS I92D' unspecified PDB 1TQO 'Cryogenic Crystal Structure of Staphylococcal Nuclease Variant truncated Delta+PHS I92E' unspecified # _pdbx_database_status.entry_id 4EOA _pdbx_database_status.status_code OBS _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-04-13 _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Caro, J.A.' 1 'Nam, S.' 2 'Schlessman, J.L.' 3 'Garcia-Moreno E., B.' 4 'Heroux, A.' 5 # _citation.id primary _citation.title 'Pressure effects in proteins' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Caro, J.A.' 1 primary 'Schlessman, J.L.' 2 primary 'Garcia-Moreno E., B.' 3 # _cell.length_a 31.221 _cell.length_b 60.453 _cell.length_c 38.536 _cell.angle_alpha 90.000 _cell.angle_beta 93.790 _cell.angle_gamma 90.000 _cell.entry_id 4EOA _cell.pdbx_unique_axis ? _cell.Z_PDB 2 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.entry_id 4EOA _symmetry.Int_Tables_number 4 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Thermonuclease 16116.355 1 3.1.31.1 'G50F,V51N,V66A,I92N,P117G,H124L,S128A,del(44-49)' 'Nuclease A (UNP residues 83-231)' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn "THYMIDINE-3',5'-DIPHOSPHATE" 402.188 1 ? ? ? ? 4 water nat water 18.015 130 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TNase, Micrococcal nuclease, Staphylococcal nuclease' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYG RGLAYNYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSEDNADSGQ ; _entity_poly.pdbx_seq_one_letter_code_can ;ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYG RGLAYNYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSEDNADSGQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 SER n 1 4 THR n 1 5 LYS n 1 6 LYS n 1 7 LEU n 1 8 HIS n 1 9 LYS n 1 10 GLU n 1 11 PRO n 1 12 ALA n 1 13 THR n 1 14 LEU n 1 15 ILE n 1 16 LYS n 1 17 ALA n 1 18 ILE n 1 19 ASP n 1 20 GLY n 1 21 ASP n 1 22 THR n 1 23 VAL n 1 24 LYS n 1 25 LEU n 1 26 MET n 1 27 TYR n 1 28 LYS n 1 29 GLY n 1 30 GLN n 1 31 PRO n 1 32 MET n 1 33 THR n 1 34 PHE n 1 35 ARG n 1 36 LEU n 1 37 LEU n 1 38 LEU n 1 39 VAL n 1 40 ASP n 1 41 THR n 1 42 PRO n 1 43 GLU n 1 44 PHE n 1 45 ASN n 1 46 GLU n 1 47 LYS n 1 48 TYR n 1 49 GLY n 1 50 PRO n 1 51 GLU n 1 52 ALA n 1 53 SER n 1 54 ALA n 1 55 PHE n 1 56 THR n 1 57 LYS n 1 58 LYS n 1 59 MET n 1 60 ALA n 1 61 GLU n 1 62 ASN n 1 63 ALA n 1 64 LYS n 1 65 LYS n 1 66 ILE n 1 67 GLU n 1 68 VAL n 1 69 GLU n 1 70 PHE n 1 71 ASP n 1 72 LYS n 1 73 GLY n 1 74 GLN n 1 75 ARG n 1 76 THR n 1 77 ASP n 1 78 LYS n 1 79 TYR n 1 80 GLY n 1 81 ARG n 1 82 GLY n 1 83 LEU n 1 84 ALA n 1 85 TYR n 1 86 ASN n 1 87 TYR n 1 88 ALA n 1 89 ASP n 1 90 GLY n 1 91 LYS n 1 92 MET n 1 93 VAL n 1 94 ASN n 1 95 GLU n 1 96 ALA n 1 97 LEU n 1 98 VAL n 1 99 ARG n 1 100 GLN n 1 101 GLY n 1 102 LEU n 1 103 ALA n 1 104 LYS n 1 105 VAL n 1 106 ALA n 1 107 TYR n 1 108 VAL n 1 109 TYR n 1 110 LYS n 1 111 GLY n 1 112 ASN n 1 113 ASN n 1 114 THR n 1 115 HIS n 1 116 GLU n 1 117 GLN n 1 118 LEU n 1 119 LEU n 1 120 ARG n 1 121 LYS n 1 122 ALA n 1 123 GLU n 1 124 ALA n 1 125 GLN n 1 126 ALA n 1 127 LYS n 1 128 LYS n 1 129 GLU n 1 130 LYS n 1 131 LEU n 1 132 ASN n 1 133 ILE n 1 134 TRP n 1 135 SER n 1 136 GLU n 1 137 ASP n 1 138 ASN n 1 139 ALA n 1 140 ASP n 1 141 SER n 1 142 GLY n 1 143 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene nuc _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET24a+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NUC_STAAU _struct_ref.pdbx_db_accession P00644 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQ RTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWSEDNADSGQ ; _struct_ref.pdbx_align_begin 83 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4EOA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 143 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00644 _struct_ref_seq.db_align_beg 83 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 149 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4EOA ? A ? ? UNP P00644 THR 126 DELETION ? 1 1 4EOA ? A ? ? UNP P00644 LYS 127 DELETION ? 2 1 4EOA ? A ? ? UNP P00644 HIS 128 DELETION ? 3 1 4EOA ? A ? ? UNP P00644 PRO 129 DELETION ? 4 1 4EOA ? A ? ? UNP P00644 LYS 130 DELETION ? 5 1 4EOA ? A ? ? UNP P00644 LYS 131 DELETION ? 6 1 4EOA PHE A 44 ? UNP P00644 GLY 132 'ENGINEERED MUTATION' 50 7 1 4EOA ASN A 45 ? UNP P00644 VAL 133 'ENGINEERED MUTATION' 51 8 1 4EOA ALA A 60 ? UNP P00644 VAL 148 'ENGINEERED MUTATION' 66 9 1 4EOA ASN A 86 ? UNP P00644 ILE 174 'ENGINEERED MUTATION' 92 10 1 4EOA GLY A 111 ? UNP P00644 PRO 199 'ENGINEERED MUTATION' 117 11 1 4EOA LEU A 118 ? UNP P00644 HIS 206 'ENGINEERED MUTATION' 124 12 1 4EOA ALA A 122 ? UNP P00644 SER 210 'ENGINEERED MUTATION' 128 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THP 'DNA linking' . "THYMIDINE-3',5'-DIPHOSPHATE" ? 'C10 H16 N2 O11 P2' 402.188 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4EOA _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.25 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 45.37 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details '20% MPD, 25 mM potassium phosphate, calcium chloride, pdTp, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2012-02-25 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X25' _diffrn_source.pdbx_wavelength_list 1.1000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X25 # _reflns.entry_id 4EOA _reflns.d_resolution_high 1.500 _reflns.d_resolution_low 50.0 _reflns.number_obs 22825 _reflns.pdbx_Rmerge_I_obs 0.062 _reflns.pdbx_netI_over_sigmaI 16.4 _reflns.pdbx_chi_squared 2.374 _reflns.pdbx_redundancy 9.2 _reflns.percent_possible_obs 99.7 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.number_all 22825 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate 27.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.500 1.530 ? ? ? 0.155 16.3 ? 1.083 9.2 ? 1123 98.9 1 1 1.530 1.550 ? ? ? 0.150 ? ? 1.065 8.9 ? 1142 99.0 2 1 1.550 1.580 ? ? ? 0.140 ? ? 1.181 9.3 ? 1119 99.5 3 1 1.580 1.620 ? ? ? 0.128 ? ? 1.233 9.8 ? 1123 99.5 4 1 1.620 1.650 ? ? ? 0.119 ? ? 1.387 9.5 ? 1147 99.4 5 1 1.650 1.690 ? ? ? 0.112 ? ? 1.526 9.1 ? 1123 99.6 6 1 1.690 1.730 ? ? ? 0.109 ? ? 1.643 9.4 ? 1137 99.6 7 1 1.730 1.780 ? ? ? 0.099 ? ? 1.750 9.6 ? 1125 99.7 8 1 1.780 1.830 ? ? ? 0.091 ? ? 1.984 9.1 ? 1173 100.0 9 1 1.830 1.890 ? ? ? 0.085 ? ? 2.250 9.6 ? 1130 99.8 10 1 1.890 1.960 ? ? ? 0.082 ? ? 2.428 9.6 ? 1122 100.0 11 1 1.960 2.040 ? ? ? 0.076 ? ? 2.628 9.2 ? 1145 100.0 12 1 2.040 2.130 ? ? ? 0.070 ? ? 2.879 8.8 ? 1148 100.0 13 1 2.130 2.240 ? ? ? 0.068 ? ? 3.115 9.4 ? 1142 100.0 14 1 2.240 2.380 ? ? ? 0.065 ? ? 3.204 9.0 ? 1139 100.0 15 1 2.380 2.560 ? ? ? 0.064 ? ? 3.357 9.6 ? 1157 100.0 16 1 2.560 2.820 ? ? ? 0.061 ? ? 3.542 8.9 ? 1149 100.0 17 1 2.820 3.230 ? ? ? 0.057 ? ? 3.645 8.8 ? 1148 99.9 18 1 3.230 4.070 ? ? ? 0.054 ? ? 3.882 8.5 ? 1146 99.7 19 1 4.070 50.000 ? ? ? 0.056 ? ? 4.026 8.4 ? 1187 99.9 20 1 # _refine.entry_id 4EOA _refine.ls_d_res_high 1.500 _refine.ls_d_res_low 38.45 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.49 _refine.ls_number_reflns_obs 22810 _refine.ls_number_reflns_all 22810 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES : REFINED INDIVIDUALLY ; _refine.ls_R_factor_all 0.1826 _refine.ls_R_factor_obs 0.1826 _refine.ls_R_factor_R_work 0.1808 _refine.ls_wR_factor_R_work 0.1970 _refine.ls_R_factor_R_free 0.2143 _refine.ls_wR_factor_R_free 0.2341 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 1171 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 21.5155 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -1.0000 _refine.aniso_B[2][2] -1.3700 _refine.aniso_B[3][3] 2.4200 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.4100 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9660 _refine.correlation_coeff_Fo_to_Fc_free 0.9550 _refine.overall_SU_R_Cruickshank_DPI 0.0756 _refine.overall_SU_R_free 0.0786 _refine.pdbx_overall_ESU_R 0.0760 _refine.pdbx_overall_ESU_R_Free 0.0790 _refine.overall_SU_ML 0.0520 _refine.overall_SU_B 1.3470 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 'PDB ENTRY 3BDC' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8526 _refine.B_iso_max 80.770 _refine.B_iso_min 9.630 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.200 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1031 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 130 _refine_hist.number_atoms_total 1187 _refine_hist.d_res_high 1.500 _refine_hist.d_res_low 38.45 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 1145 0.018 0.020 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1557 1.938 1.997 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 149 6.391 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 53 35.232 25.283 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 227 13.149 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 5 8.312 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 168 0.127 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 847 0.015 0.021 ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 1.500 _refine_ls_shell.d_res_low 1.539 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 95.94 _refine_ls_shell.number_reflns_R_work 1487 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2190 _refine_ls_shell.R_factor_R_free 0.3160 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 95 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 1582 _refine_ls_shell.number_reflns_obs 1582 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4EOA _struct.title 'Crystal structure of Staphylococcal nuclease variant Delta+PHS I92N/V66A at cryogenic temperature' _struct.pdbx_descriptor Thermonuclease _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4EOA _struct_keywords.text 'Staphylococcal nuclease, hyperstable variant, pdtp, cavity, pressure, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 48 ? ALA A 63 ? TYR A 54 ALA A 69 1 ? 16 HELX_P HELX_P2 2 VAL A 93 ? GLN A 100 ? VAL A 99 GLN A 106 1 ? 8 HELX_P HELX_P3 3 HIS A 115 ? GLU A 129 ? HIS A 121 GLU A 135 1 ? 15 HELX_P HELX_P4 4 LEU A 131 ? SER A 135 ? LEU A 137 SER A 141 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A ASP 40 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 40 A CA 201 1_555 ? ? ? ? ? ? ? 2.699 ? metalc2 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 201 A HOH 313 1_555 ? ? ? ? ? ? ? 2.812 ? metalc3 metalc ? ? A ASP 21 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 21 A CA 201 1_555 ? ? ? ? ? ? ? 2.850 ? metalc4 metalc ? ? A THR 41 O ? ? ? 1_555 B CA . CA ? ? A THR 41 A CA 201 1_555 ? ? ? ? ? ? ? 2.856 ? metalc5 metalc ? ? A GLU 43 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 43 A CA 201 1_555 ? ? ? ? ? ? ? 2.948 ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 201 A HOH 309 1_555 ? ? ? ? ? ? ? 2.948 ? metalc7 metalc ? ? B CA . CA ? ? ? 1_555 C THP . O5P ? ? A CA 201 A THP 202 1_555 ? ? ? ? ? ? ? 3.193 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 91 ? MET A 92 ? LYS A 97 MET A 98 A 2 GLY A 82 ? ALA A 88 ? GLY A 88 ALA A 94 A 3 ILE A 66 ? GLU A 69 ? ILE A 72 GLU A 75 A 4 GLU A 10 ? ALA A 17 ? GLU A 10 ALA A 17 A 5 THR A 22 ? TYR A 27 ? THR A 22 TYR A 27 A 6 GLN A 30 ? LEU A 36 ? GLN A 30 LEU A 36 A 7 GLY A 82 ? ALA A 88 ? GLY A 88 ALA A 94 B 1 VAL A 39 ? ASP A 40 ? VAL A 39 ASP A 40 B 2 LYS A 104 ? VAL A 105 ? LYS A 110 VAL A 111 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 91 ? O LYS A 97 N ALA A 88 ? N ALA A 94 A 2 3 O TYR A 87 ? O TYR A 93 N GLU A 67 ? N GLU A 73 A 3 4 O VAL A 68 ? O VAL A 74 N GLU A 10 ? N GLU A 10 A 4 5 N THR A 13 ? N THR A 13 O MET A 26 ? O MET A 26 A 5 6 N VAL A 23 ? N VAL A 23 O PHE A 34 ? O PHE A 34 A 6 7 N ARG A 35 ? N ARG A 35 O GLY A 82 ? O GLY A 88 B 1 2 N ASP A 40 ? N ASP A 40 O LYS A 104 ? O LYS A 110 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA A 201' AC2 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE THP A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASP A 21 ? ASP A 21 . ? 1_555 ? 2 AC1 7 ASP A 40 ? ASP A 40 . ? 1_555 ? 3 AC1 7 THR A 41 ? THR A 41 . ? 1_555 ? 4 AC1 7 GLU A 43 ? GLU A 43 . ? 1_555 ? 5 AC1 7 THP C . ? THP A 202 . ? 1_555 ? 6 AC1 7 HOH D . ? HOH A 309 . ? 1_555 ? 7 AC1 7 HOH D . ? HOH A 313 . ? 1_555 ? 8 AC2 20 ARG A 35 ? ARG A 35 . ? 1_555 ? 9 AC2 20 ASP A 40 ? ASP A 40 . ? 1_555 ? 10 AC2 20 LYS A 78 ? LYS A 84 . ? 1_555 ? 11 AC2 20 TYR A 79 ? TYR A 85 . ? 1_555 ? 12 AC2 20 ARG A 81 ? ARG A 87 . ? 1_555 ? 13 AC2 20 LEU A 83 ? LEU A 89 . ? 1_555 ? 14 AC2 20 TYR A 107 ? TYR A 113 . ? 1_555 ? 15 AC2 20 TYR A 109 ? TYR A 115 . ? 1_555 ? 16 AC2 20 LYS A 121 ? LYS A 127 . ? 1_655 ? 17 AC2 20 CA B . ? CA A 201 . ? 1_555 ? 18 AC2 20 HOH D . ? HOH A 301 . ? 1_555 ? 19 AC2 20 HOH D . ? HOH A 313 . ? 1_555 ? 20 AC2 20 HOH D . ? HOH A 314 . ? 1_555 ? 21 AC2 20 HOH D . ? HOH A 322 . ? 1_555 ? 22 AC2 20 HOH D . ? HOH A 325 . ? 1_555 ? 23 AC2 20 HOH D . ? HOH A 336 . ? 1_555 ? 24 AC2 20 HOH D . ? HOH A 351 . ? 1_555 ? 25 AC2 20 HOH D . ? HOH A 356 . ? 1_555 ? 26 AC2 20 HOH D . ? HOH A 389 . ? 1_555 ? 27 AC2 20 HOH D . ? HOH A 395 . ? 1_555 ? # _atom_sites.entry_id 4EOA _atom_sites.fract_transf_matrix[1][1] 0.032030 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002122 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016542 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026007 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 PHE 44 50 50 PHE PHE A . n A 1 45 ASN 45 51 51 ASN ASN A . n A 1 46 GLU 46 52 52 GLU GLU A . n A 1 47 LYS 47 53 53 LYS LYS A . n A 1 48 TYR 48 54 54 TYR TYR A . n A 1 49 GLY 49 55 55 GLY GLY A . n A 1 50 PRO 50 56 56 PRO PRO A . n A 1 51 GLU 51 57 57 GLU GLU A . n A 1 52 ALA 52 58 58 ALA ALA A . n A 1 53 SER 53 59 59 SER SER A . n A 1 54 ALA 54 60 60 ALA ALA A . n A 1 55 PHE 55 61 61 PHE PHE A . n A 1 56 THR 56 62 62 THR THR A . n A 1 57 LYS 57 63 63 LYS LYS A . n A 1 58 LYS 58 64 64 LYS LYS A . n A 1 59 MET 59 65 65 MET MET A . n A 1 60 ALA 60 66 66 ALA ALA A . n A 1 61 GLU 61 67 67 GLU GLU A . n A 1 62 ASN 62 68 68 ASN ASN A . n A 1 63 ALA 63 69 69 ALA ALA A . n A 1 64 LYS 64 70 70 LYS LYS A . n A 1 65 LYS 65 71 71 LYS LYS A . n A 1 66 ILE 66 72 72 ILE ILE A . n A 1 67 GLU 67 73 73 GLU GLU A . n A 1 68 VAL 68 74 74 VAL VAL A . n A 1 69 GLU 69 75 75 GLU GLU A . n A 1 70 PHE 70 76 76 PHE PHE A . n A 1 71 ASP 71 77 77 ASP ASP A . n A 1 72 LYS 72 78 78 LYS LYS A . n A 1 73 GLY 73 79 79 GLY GLY A . n A 1 74 GLN 74 80 80 GLN GLN A . n A 1 75 ARG 75 81 81 ARG ARG A . n A 1 76 THR 76 82 82 THR THR A . n A 1 77 ASP 77 83 83 ASP ASP A . n A 1 78 LYS 78 84 84 LYS LYS A . n A 1 79 TYR 79 85 85 TYR TYR A . n A 1 80 GLY 80 86 86 GLY GLY A . n A 1 81 ARG 81 87 87 ARG ARG A . n A 1 82 GLY 82 88 88 GLY GLY A . n A 1 83 LEU 83 89 89 LEU LEU A . n A 1 84 ALA 84 90 90 ALA ALA A . n A 1 85 TYR 85 91 91 TYR TYR A . n A 1 86 ASN 86 92 92 ASN ASN A . n A 1 87 TYR 87 93 93 TYR TYR A . n A 1 88 ALA 88 94 94 ALA ALA A . n A 1 89 ASP 89 95 95 ASP ASP A . n A 1 90 GLY 90 96 96 GLY GLY A . n A 1 91 LYS 91 97 97 LYS LYS A . n A 1 92 MET 92 98 98 MET MET A . n A 1 93 VAL 93 99 99 VAL VAL A . n A 1 94 ASN 94 100 100 ASN ASN A . n A 1 95 GLU 95 101 101 GLU GLU A . n A 1 96 ALA 96 102 102 ALA ALA A . n A 1 97 LEU 97 103 103 LEU LEU A . n A 1 98 VAL 98 104 104 VAL VAL A . n A 1 99 ARG 99 105 105 ARG ARG A . n A 1 100 GLN 100 106 106 GLN GLN A . n A 1 101 GLY 101 107 107 GLY GLY A . n A 1 102 LEU 102 108 108 LEU LEU A . n A 1 103 ALA 103 109 109 ALA ALA A . n A 1 104 LYS 104 110 110 LYS LYS A . n A 1 105 VAL 105 111 111 VAL VAL A . n A 1 106 ALA 106 112 112 ALA ALA A . n A 1 107 TYR 107 113 113 TYR TYR A . n A 1 108 VAL 108 114 114 VAL VAL A . n A 1 109 TYR 109 115 115 TYR TYR A . n A 1 110 LYS 110 116 116 LYS LYS A . n A 1 111 GLY 111 117 117 GLY GLY A . n A 1 112 ASN 112 118 118 ASN ASN A . n A 1 113 ASN 113 119 119 ASN ASN A . n A 1 114 THR 114 120 120 THR THR A . n A 1 115 HIS 115 121 121 HIS HIS A . n A 1 116 GLU 116 122 122 GLU GLU A . n A 1 117 GLN 117 123 123 GLN GLN A . n A 1 118 LEU 118 124 124 LEU LEU A . n A 1 119 LEU 119 125 125 LEU LEU A . n A 1 120 ARG 120 126 126 ARG ARG A . n A 1 121 LYS 121 127 127 LYS LYS A . n A 1 122 ALA 122 128 128 ALA ALA A . n A 1 123 GLU 123 129 129 GLU GLU A . n A 1 124 ALA 124 130 130 ALA ALA A . n A 1 125 GLN 125 131 131 GLN GLN A . n A 1 126 ALA 126 132 132 ALA ALA A . n A 1 127 LYS 127 133 133 LYS LYS A . n A 1 128 LYS 128 134 134 LYS LYS A . n A 1 129 GLU 129 135 135 GLU GLU A . n A 1 130 LYS 130 136 136 LYS LYS A . n A 1 131 LEU 131 137 137 LEU LEU A . n A 1 132 ASN 132 138 138 ASN ASN A . n A 1 133 ILE 133 139 139 ILE ILE A . n A 1 134 TRP 134 140 140 TRP TRP A . n A 1 135 SER 135 141 141 SER SER A . n A 1 136 GLU 136 142 ? ? ? A . n A 1 137 ASP 137 143 ? ? ? A . n A 1 138 ASN 138 144 ? ? ? A . n A 1 139 ALA 139 145 ? ? ? A . n A 1 140 ASP 140 146 ? ? ? A . n A 1 141 SER 141 147 ? ? ? A . n A 1 142 GLY 142 148 ? ? ? A . n A 1 143 GLN 143 149 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 1 CA CA A . C 3 THP 1 202 1 THP THP A . D 4 HOH 1 301 1 HOH HOH A . D 4 HOH 2 302 2 HOH HOH A . D 4 HOH 3 303 3 HOH HOH A . D 4 HOH 4 304 4 HOH HOH A . D 4 HOH 5 305 5 HOH HOH A . D 4 HOH 6 306 6 HOH HOH A . D 4 HOH 7 307 7 HOH HOH A . D 4 HOH 8 308 8 HOH HOH A . D 4 HOH 9 309 9 HOH HOH A . D 4 HOH 10 310 10 HOH HOH A . D 4 HOH 11 311 11 HOH HOH A . D 4 HOH 12 312 12 HOH HOH A . D 4 HOH 13 313 13 HOH HOH A . D 4 HOH 14 314 14 HOH HOH A . D 4 HOH 15 315 15 HOH HOH A . D 4 HOH 16 316 16 HOH HOH A . D 4 HOH 17 317 17 HOH HOH A . D 4 HOH 18 318 18 HOH HOH A . D 4 HOH 19 319 19 HOH HOH A . D 4 HOH 20 320 20 HOH HOH A . D 4 HOH 21 321 21 HOH HOH A . D 4 HOH 22 322 22 HOH HOH A . D 4 HOH 23 323 23 HOH HOH A . D 4 HOH 24 324 24 HOH HOH A . D 4 HOH 25 325 25 HOH HOH A . D 4 HOH 26 326 26 HOH HOH A . D 4 HOH 27 327 27 HOH HOH A . D 4 HOH 28 328 28 HOH HOH A . D 4 HOH 29 329 29 HOH HOH A . D 4 HOH 30 330 30 HOH HOH A . D 4 HOH 31 331 31 HOH HOH A . D 4 HOH 32 332 32 HOH HOH A . D 4 HOH 33 333 33 HOH HOH A . D 4 HOH 34 334 34 HOH HOH A . D 4 HOH 35 335 35 HOH HOH A . D 4 HOH 36 336 36 HOH HOH A . D 4 HOH 37 337 37 HOH HOH A . D 4 HOH 38 338 38 HOH HOH A . D 4 HOH 39 339 39 HOH HOH A . D 4 HOH 40 340 40 HOH HOH A . D 4 HOH 41 341 41 HOH HOH A . D 4 HOH 42 342 42 HOH HOH A . D 4 HOH 43 343 43 HOH HOH A . D 4 HOH 44 344 44 HOH HOH A . D 4 HOH 45 345 45 HOH HOH A . D 4 HOH 46 346 46 HOH HOH A . D 4 HOH 47 347 47 HOH HOH A . D 4 HOH 48 348 48 HOH HOH A . D 4 HOH 49 349 49 HOH HOH A . D 4 HOH 50 350 50 HOH HOH A . D 4 HOH 51 351 51 HOH HOH A . D 4 HOH 52 352 52 HOH HOH A . D 4 HOH 53 353 53 HOH HOH A . D 4 HOH 54 354 54 HOH HOH A . D 4 HOH 55 355 55 HOH HOH A . D 4 HOH 56 356 56 HOH HOH A . D 4 HOH 57 357 57 HOH HOH A . D 4 HOH 58 358 58 HOH HOH A . D 4 HOH 59 359 59 HOH HOH A . D 4 HOH 60 360 60 HOH HOH A . D 4 HOH 61 361 61 HOH HOH A . D 4 HOH 62 362 62 HOH HOH A . D 4 HOH 63 363 63 HOH HOH A . D 4 HOH 64 364 64 HOH HOH A . D 4 HOH 65 365 65 HOH HOH A . D 4 HOH 66 366 66 HOH HOH A . D 4 HOH 67 367 67 HOH HOH A . D 4 HOH 68 368 68 HOH HOH A . D 4 HOH 69 369 70 HOH HOH A . D 4 HOH 70 370 71 HOH HOH A . D 4 HOH 71 371 73 HOH HOH A . D 4 HOH 72 372 75 HOH HOH A . D 4 HOH 73 373 76 HOH HOH A . D 4 HOH 74 374 77 HOH HOH A . D 4 HOH 75 375 78 HOH HOH A . D 4 HOH 76 376 79 HOH HOH A . D 4 HOH 77 377 80 HOH HOH A . D 4 HOH 78 378 81 HOH HOH A . D 4 HOH 79 379 82 HOH HOH A . D 4 HOH 80 380 83 HOH HOH A . D 4 HOH 81 381 84 HOH HOH A . D 4 HOH 82 382 85 HOH HOH A . D 4 HOH 83 383 86 HOH HOH A . D 4 HOH 84 384 87 HOH HOH A . D 4 HOH 85 385 88 HOH HOH A . D 4 HOH 86 386 89 HOH HOH A . D 4 HOH 87 387 91 HOH HOH A . D 4 HOH 88 388 92 HOH HOH A . D 4 HOH 89 389 93 HOH HOH A . D 4 HOH 90 390 94 HOH HOH A . D 4 HOH 91 391 95 HOH HOH A . D 4 HOH 92 392 96 HOH HOH A . D 4 HOH 93 393 97 HOH HOH A . D 4 HOH 94 394 98 HOH HOH A . D 4 HOH 95 395 99 HOH HOH A . D 4 HOH 96 396 100 HOH HOH A . D 4 HOH 97 397 101 HOH HOH A . D 4 HOH 98 398 102 HOH HOH A . D 4 HOH 99 399 103 HOH HOH A . D 4 HOH 100 400 104 HOH HOH A . D 4 HOH 101 401 105 HOH HOH A . D 4 HOH 102 402 106 HOH HOH A . D 4 HOH 103 403 107 HOH HOH A . D 4 HOH 104 404 108 HOH HOH A . D 4 HOH 105 405 109 HOH HOH A . D 4 HOH 106 406 110 HOH HOH A . D 4 HOH 107 407 111 HOH HOH A . D 4 HOH 108 408 112 HOH HOH A . D 4 HOH 109 409 113 HOH HOH A . D 4 HOH 110 410 114 HOH HOH A . D 4 HOH 111 411 115 HOH HOH A . D 4 HOH 112 412 116 HOH HOH A . D 4 HOH 113 413 117 HOH HOH A . D 4 HOH 114 414 118 HOH HOH A . D 4 HOH 115 415 119 HOH HOH A . D 4 HOH 116 416 120 HOH HOH A . D 4 HOH 117 417 121 HOH HOH A . D 4 HOH 118 418 122 HOH HOH A . D 4 HOH 119 419 123 HOH HOH A . D 4 HOH 120 420 124 HOH HOH A . D 4 HOH 121 421 125 HOH HOH A . D 4 HOH 122 422 126 HOH HOH A . D 4 HOH 123 423 127 HOH HOH A . D 4 HOH 124 424 128 HOH HOH A . D 4 HOH 125 425 129 HOH HOH A . D 4 HOH 126 426 130 HOH HOH A . D 4 HOH 127 427 131 HOH HOH A . D 4 HOH 128 428 132 HOH HOH A . D 4 HOH 129 429 133 HOH HOH A . D 4 HOH 130 430 134 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 313 ? 1_555 134.9 ? 2 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 80.3 ? 3 O ? D HOH . ? A HOH 313 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 74.3 ? 4 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A THR 41 ? A THR 41 ? 1_555 78.3 ? 5 O ? D HOH . ? A HOH 313 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A THR 41 ? A THR 41 ? 1_555 135.4 ? 6 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A THR 41 ? A THR 41 ? 1_555 87.1 ? 7 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 127.2 ? 8 O ? D HOH . ? A HOH 313 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 78.7 ? 9 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 151.1 ? 10 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 105.6 ? 11 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 309 ? 1_555 137.6 ? 12 O ? D HOH . ? A HOH 313 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 309 ? 1_555 72.7 ? 13 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 309 ? 1_555 79.1 ? 14 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 309 ? 1_555 64.0 ? 15 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 309 ? 1_555 83.4 ? 16 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O5P ? C THP . ? A THP 202 ? 1_555 68.8 ? 17 O ? D HOH . ? A HOH 313 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O5P ? C THP . ? A THP 202 ? 1_555 75.2 ? 18 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O5P ? C THP . ? A THP 202 ? 1_555 91.5 ? 19 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O5P ? C THP . ? A THP 202 ? 1_555 146.8 ? 20 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O5P ? C THP . ? A THP 202 ? 1_555 91.3 ? 21 O ? D HOH . ? A HOH 309 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O5P ? C THP . ? A THP 202 ? 1_555 147.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-04-25 2 'Structure model' 1 1 2013-12-04 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # _pdbx_phasing_MR.entry_id 4EOA _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.500 _pdbx_phasing_MR.d_res_low_rotation 38.450 _pdbx_phasing_MR.d_res_high_translation 2.500 _pdbx_phasing_MR.d_res_low_translation 38.450 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SCALEPACK . ? program 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 PHASER 2.3.0 'Mon Jun 27 09:33:44 2011 (svn )' program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk 'molecular replacement' http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 3 REFMAC5 . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 4 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 CBASS . ? ? ? ? 'data collection' ? ? ? 6 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 7 SCALEPACK . ? ? ? ? 'data scaling' ? ? ? 8 PHASER . ? ? ? ? phasing ? ? ? 9 REFMAC 5.6.0117 ? ? ? ? refinement ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 54 ? ? 71.55 -3.43 2 1 ASN A 138 ? ? 49.72 -107.09 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A GLU 142 ? A GLU 136 8 1 Y 1 A ASP 143 ? A ASP 137 9 1 Y 1 A ASN 144 ? A ASN 138 10 1 Y 1 A ALA 145 ? A ALA 139 11 1 Y 1 A ASP 146 ? A ASP 140 12 1 Y 1 A SER 147 ? A SER 141 13 1 Y 1 A GLY 148 ? A GLY 142 14 1 Y 1 A GLN 149 ? A GLN 143 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 "THYMIDINE-3',5'-DIPHOSPHATE" THP 4 water HOH #