data_4EW1 # _entry.id 4EW1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4EW1 RCSB RCSB072139 WWPDB D_1000072139 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1MEN 'complex structure of human glycinamide ribonucleotide Transformylase and substrate beta-GAR' unspecified PDB 1MEO 'human glycinamide ribonucleotide Transformylase at pH 4.2' unspecified PDB 4EW2 . unspecified PDB 4EW3 . unspecified # _pdbx_database_status.entry_id 4EW1 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-04-26 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Connelly, S.' 1 'DeMartino, K.' 2 'Boger, D.L.' 3 'Wilson, I.A.' 4 # _citation.id primary _citation.title ;Biological and Structural Evaluation of 10R- and 10S-Methylthio-DDACTHF Reveals a New Role for Sulfur in Inhibition of Glycinamide Ribonucleotide Transformylase. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 52 _citation.page_first 5133 _citation.page_last 5144 _citation.year 2013 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23869564 _citation.pdbx_database_id_DOI 10.1021/bi4005182 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Connelly, S.' 1 primary 'Demartino, J.K.' 2 primary 'Boger, D.L.' 3 primary 'Wilson, I.A.' 4 # _cell.entry_id 4EW1 _cell.length_a 78.028 _cell.length_b 78.028 _cell.length_c 230.841 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4EW1 _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Trifunctional purine biosynthetic protein adenosine-3' 22678.941 1 '6.3.4.13, 6.3.3.1, 2.1.2.2' ? 'Residues 808-1010' ? 2 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 4 water nat water 18.015 227 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Phosphoribosylamine--glycine ligase, Glycinamide ribonucleotide synthetase, GARS, Phosphoribosylglycinamide synthetase, Phosphoribosylformylglycinamidine cyclo-ligase, AIR synthase, AIRS, Phosphoribosyl-aminoimidazole synthetase, Phosphoribosylglycinamide formyltransferase, 5'-phosphoribosylglycinamide transformylase, GAR transformylase, GART ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSI DIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGD TVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSI DIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGD TVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ARG n 1 3 VAL n 1 4 ALA n 1 5 VAL n 1 6 LEU n 1 7 ILE n 1 8 SER n 1 9 GLY n 1 10 THR n 1 11 GLY n 1 12 SER n 1 13 ASN n 1 14 LEU n 1 15 GLN n 1 16 ALA n 1 17 LEU n 1 18 ILE n 1 19 ASP n 1 20 SER n 1 21 THR n 1 22 ARG n 1 23 GLU n 1 24 PRO n 1 25 ASN n 1 26 SER n 1 27 SER n 1 28 ALA n 1 29 GLN n 1 30 ILE n 1 31 ASP n 1 32 ILE n 1 33 VAL n 1 34 ILE n 1 35 SER n 1 36 ASN n 1 37 LYS n 1 38 ALA n 1 39 ALA n 1 40 VAL n 1 41 ALA n 1 42 GLY n 1 43 LEU n 1 44 ASP n 1 45 LYS n 1 46 ALA n 1 47 GLU n 1 48 ARG n 1 49 ALA n 1 50 GLY n 1 51 ILE n 1 52 PRO n 1 53 THR n 1 54 ARG n 1 55 VAL n 1 56 ILE n 1 57 ASN n 1 58 HIS n 1 59 LYS n 1 60 LEU n 1 61 TYR n 1 62 LYS n 1 63 ASN n 1 64 ARG n 1 65 VAL n 1 66 GLU n 1 67 PHE n 1 68 ASP n 1 69 SER n 1 70 ALA n 1 71 ILE n 1 72 ASP n 1 73 LEU n 1 74 VAL n 1 75 LEU n 1 76 GLU n 1 77 GLU n 1 78 PHE n 1 79 SER n 1 80 ILE n 1 81 ASP n 1 82 ILE n 1 83 VAL n 1 84 CYS n 1 85 LEU n 1 86 ALA n 1 87 GLY n 1 88 PHE n 1 89 MET n 1 90 ARG n 1 91 ILE n 1 92 LEU n 1 93 SER n 1 94 GLY n 1 95 PRO n 1 96 PHE n 1 97 VAL n 1 98 GLN n 1 99 LYS n 1 100 TRP n 1 101 ASN n 1 102 GLY n 1 103 LYS n 1 104 MET n 1 105 LEU n 1 106 ASN n 1 107 ILE n 1 108 HIS n 1 109 PRO n 1 110 SER n 1 111 LEU n 1 112 LEU n 1 113 PRO n 1 114 SER n 1 115 PHE n 1 116 LYS n 1 117 GLY n 1 118 SER n 1 119 ASN n 1 120 ALA n 1 121 HIS n 1 122 GLU n 1 123 GLN n 1 124 ALA n 1 125 LEU n 1 126 GLU n 1 127 THR n 1 128 GLY n 1 129 VAL n 1 130 THR n 1 131 VAL n 1 132 THR n 1 133 GLY n 1 134 CYS n 1 135 THR n 1 136 VAL n 1 137 HIS n 1 138 PHE n 1 139 VAL n 1 140 ALA n 1 141 GLU n 1 142 ASP n 1 143 VAL n 1 144 ASP n 1 145 ALA n 1 146 GLY n 1 147 GLN n 1 148 ILE n 1 149 ILE n 1 150 LEU n 1 151 GLN n 1 152 GLU n 1 153 ALA n 1 154 VAL n 1 155 PRO n 1 156 VAL n 1 157 LYS n 1 158 ARG n 1 159 GLY n 1 160 ASP n 1 161 THR n 1 162 VAL n 1 163 ALA n 1 164 THR n 1 165 LEU n 1 166 SER n 1 167 GLU n 1 168 ARG n 1 169 VAL n 1 170 LYS n 1 171 LEU n 1 172 ALA n 1 173 GLU n 1 174 HIS n 1 175 LYS n 1 176 ILE n 1 177 PHE n 1 178 PRO n 1 179 ALA n 1 180 ALA n 1 181 LEU n 1 182 GLN n 1 183 LEU n 1 184 VAL n 1 185 ALA n 1 186 SER n 1 187 GLY n 1 188 THR n 1 189 VAL n 1 190 GLN n 1 191 LEU n 1 192 GLY n 1 193 GLU n 1 194 ASN n 1 195 GLY n 1 196 LYS n 1 197 ILE n 1 198 CYS n 1 199 TRP n 1 200 VAL n 1 201 LYS n 1 202 GLU n 1 203 GLU n 1 204 HIS n 1 205 HIS n 1 206 HIS n 1 207 HIS n 1 208 HIS n 1 209 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GART, PGFT, PRGS' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Bl21(DE3) Gold' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet22b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PUR2_HUMAN _struct_ref.pdbx_db_accession P22102 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDI VCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTV ATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEE ; _struct_ref.pdbx_align_begin 810 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4EW1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 203 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22102 _struct_ref_seq.db_align_beg 810 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1010 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 203 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4EW1 ALA A 1 ? UNP P22102 ? ? 'EXPRESSION TAG' 1 1 1 4EW1 ARG A 2 ? UNP P22102 ? ? 'EXPRESSION TAG' 2 2 1 4EW1 HIS A 204 ? UNP P22102 ? ? 'EXPRESSION TAG' 204 3 1 4EW1 HIS A 205 ? UNP P22102 ? ? 'EXPRESSION TAG' 205 4 1 4EW1 HIS A 206 ? UNP P22102 ? ? 'EXPRESSION TAG' 206 5 1 4EW1 HIS A 207 ? UNP P22102 ? ? 'EXPRESSION TAG' 207 6 1 4EW1 HIS A 208 ? UNP P22102 ? ? 'EXPRESSION TAG' 208 7 1 4EW1 HIS A 209 ? UNP P22102 ? ? 'EXPRESSION TAG' 209 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4EW1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.47 _exptl_crystal.density_percent_sol 72.50 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;0.1 M phosphate/citrate buffer, 1.5-2.0 M ammonium sulfate at p.H 4.2. 25% Glycerol added as cryoprotectant, VAPOR DIFFUSION, SITTING DROP, temperature 298K ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2007-11-05 _diffrn_detector.details ;Flat mirror (vertical focusing), single crystal Si(111) bent monochromator (horizontal focusing) ; # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Side scattering bent cube-root I-beam single crystal, asymmetric cut 4.965 degs' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL11-1' _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL11-1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9795 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4EW1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 67.57 _reflns.d_resolution_high 1.52 _reflns.number_obs 64515 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.043 _reflns.pdbx_netI_over_sigmaI 41.4 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 9.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.52 _reflns_shell.d_res_low 1.57 _reflns_shell.percent_possible_all 98.4 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.589 _reflns_shell.meanI_over_sigI_obs 3.0 _reflns_shell.pdbx_redundancy 7.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4EW1 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 61124 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 67.57 _refine.ls_d_res_high 1.522 _refine.ls_percent_reflns_obs 99.64 _refine.ls_R_factor_obs 0.17385 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.17283 _refine.ls_R_factor_R_free 0.19304 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 3263 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min 0.25 _refine.occupancy_max 1.00 _refine.correlation_coeff_Fo_to_Fc 0.966 _refine.correlation_coeff_Fo_to_Fc_free 0.961 _refine.B_iso_mean 19.836 _refine.aniso_B[1][1] -0.45 _refine.aniso_B[2][2] -0.45 _refine.aniso_B[3][3] 0.67 _refine.aniso_B[1][2] -0.22 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 1MEO' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.056 _refine.pdbx_overall_ESU_R_Free 0.053 _refine.overall_SU_ML 0.031 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 1.822 _refine.overall_SU_R_Cruickshank_DPI 0.059 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1554 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 227 _refine_hist.number_atoms_total 1801 _refine_hist.d_res_high 1.522 _refine_hist.d_res_low 67.57 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.022 ? 1702 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 1136 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.636 1.971 ? 2325 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.974 3.000 ? 2815 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.074 5.000 ? 230 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 36.614 25.139 ? 72 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 12.490 15.000 ? 309 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.065 15.000 ? 9 'X-RAY DIFFRACTION' ? r_chiral_restr 0.098 0.200 ? 270 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.020 ? 1912 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.002 0.020 ? 315 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.969 1.500 ? 1074 'X-RAY DIFFRACTION' ? r_mcbond_other 0.733 1.500 ? 436 'X-RAY DIFFRACTION' ? r_mcangle_it 3.044 2.000 ? 1748 'X-RAY DIFFRACTION' ? r_scbond_it 4.188 3.000 ? 628 'X-RAY DIFFRACTION' ? r_scangle_it 6.090 4.500 ? 568 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 1.709 3.000 ? 2838 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.522 _refine_ls_shell.d_res_low 1.562 _refine_ls_shell.number_reflns_R_work 4318 _refine_ls_shell.R_factor_R_work 0.296 _refine_ls_shell.percent_reflns_obs 96.74 _refine_ls_shell.R_factor_R_free 0.331 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 229 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 4EW1 _struct.title 'High resolution structure of human glycinamide ribonucleotide transformylase in apo form.' _struct.pdbx_descriptor 'Trifunctional purine biosynthetic protein adenosine-3 (E.C.6.3.4.13, 6.3.3.1, 2.1.2.2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4EW1 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text Transferase # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 13 ? ARG A 22 ? ASN A 13 ARG A 22 1 ? 10 HELX_P HELX_P2 2 VAL A 40 ? ALA A 49 ? VAL A 40 ALA A 49 1 ? 10 HELX_P HELX_P3 3 ASN A 57 ? TYR A 61 ? ASN A 57 TYR A 61 5 ? 5 HELX_P HELX_P4 4 ASN A 63 ? PHE A 78 ? ASN A 63 PHE A 78 1 ? 16 HELX_P HELX_P5 5 SER A 93 ? TRP A 100 ? SER A 93 TRP A 100 1 ? 8 HELX_P HELX_P6 6 ASN A 119 ? GLY A 128 ? ASN A 119 GLY A 128 1 ? 10 HELX_P HELX_P7 7 THR A 161 ? SER A 186 ? THR A 161 SER A 186 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 112 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 112 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 113 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 113 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 13.53 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 53 ? VAL A 55 ? THR A 53 VAL A 55 A 2 GLN A 29 ? SER A 35 ? GLN A 29 SER A 35 A 3 ARG A 2 ? ILE A 7 ? ARG A 2 ILE A 7 A 4 ILE A 82 ? ALA A 86 ? ILE A 82 ALA A 86 A 5 MET A 104 ? HIS A 108 ? MET A 104 HIS A 108 A 6 VAL A 131 ? PHE A 138 ? VAL A 131 PHE A 138 A 7 ILE A 148 ? PRO A 155 ? ILE A 148 PRO A 155 B 1 VAL A 189 ? LEU A 191 ? VAL A 189 LEU A 191 B 2 ILE A 197 ? TRP A 199 ? ILE A 197 TRP A 199 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 54 ? O ARG A 54 N SER A 35 ? N SER A 35 A 2 3 O GLN A 29 ? O GLN A 29 N VAL A 3 ? N VAL A 3 A 3 4 N LEU A 6 ? N LEU A 6 O ALA A 86 ? O ALA A 86 A 4 5 N LEU A 85 ? N LEU A 85 O LEU A 105 ? O LEU A 105 A 5 6 N ASN A 106 ? N ASN A 106 O HIS A 137 ? O HIS A 137 A 6 7 N THR A 132 ? N THR A 132 O VAL A 154 ? O VAL A 154 B 1 2 N GLN A 190 ? N GLN A 190 O CYS A 198 ? O CYS A 198 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE PO4 A 301' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 302' AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 303' AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 GLY A 11 ? GLY A 11 . ? 1_555 ? 2 AC1 9 ASN A 13 ? ASN A 13 . ? 1_555 ? 3 AC1 9 LEU A 14 ? LEU A 14 . ? 1_555 ? 4 AC1 9 GLN A 15 ? GLN A 15 . ? 1_555 ? 5 AC1 9 ALA A 16 ? ALA A 16 . ? 1_555 ? 6 AC1 9 LYS A 45 ? LYS A 45 . ? 1_555 ? 7 AC1 9 HIS A 174 ? HIS A 174 . ? 1_555 ? 8 AC1 9 HOH F . ? HOH A 477 . ? 1_555 ? 9 AC1 9 HOH F . ? HOH A 487 . ? 1_555 ? 10 AC2 4 LYS A 157 ? LYS A 157 . ? 1_555 ? 11 AC2 4 ARG A 168 ? ARG A 168 . ? 1_555 ? 12 AC2 4 HOH F . ? HOH A 429 . ? 1_555 ? 13 AC2 4 HOH F . ? HOH A 617 . ? 1_555 ? 14 AC3 6 PRO A 109 ? PRO A 109 . ? 1_555 ? 15 AC3 6 HIS A 121 ? HIS A 121 . ? 1_555 ? 16 AC3 6 LYS A 170 ? LYS A 170 . ? 1_555 ? 17 AC3 6 HOH F . ? HOH A 407 . ? 1_555 ? 18 AC3 6 HOH F . ? HOH A 475 . ? 1_555 ? 19 AC3 6 HOH F . ? HOH A 585 . ? 1_555 ? 20 AC4 7 ASN A 119 ? ASN A 119 . ? 1_555 ? 21 AC4 7 ALA A 120 ? ALA A 120 . ? 1_555 ? 22 AC4 7 HIS A 121 ? HIS A 121 . ? 1_555 ? 23 AC4 7 GLU A 122 ? GLU A 122 . ? 1_555 ? 24 AC4 7 VAL A 162 ? VAL A 162 . ? 1_555 ? 25 AC4 7 SER A 166 ? SER A 166 . ? 1_555 ? 26 AC4 7 HOH F . ? HOH A 585 . ? 1_555 ? # _atom_sites.entry_id 4EW1 _atom_sites.fract_transf_matrix[1][1] 0.012816 _atom_sites.fract_transf_matrix[1][2] 0.007399 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014799 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004332 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 CYS 134 134 134 CYS CYS A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 PRO 155 155 155 PRO PRO A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 HIS 174 174 174 HIS HIS A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 GLN 182 182 182 GLN GLN A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 GLN 190 190 190 GLN GLN A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 ASN 194 194 194 ASN ASN A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 CYS 198 198 198 CYS CYS A . n A 1 199 TRP 199 199 199 TRP TRP A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 HIS 205 205 205 HIS HIS A . n A 1 206 HIS 206 206 ? ? ? A . n A 1 207 HIS 207 207 ? ? ? A . n A 1 208 HIS 208 208 ? ? ? A . n A 1 209 HIS 209 209 ? ? ? A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 2 1,2 A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 1440 ? 2 MORE -6 ? 2 'SSA (A^2)' 19720 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_565 x,x-y+1,-z+5/6 0.5000000000 0.8660254038 0.0000000000 -39.0140000000 0.8660254038 -0.5000000000 0.0000000000 67.5742302065 0.0000000000 0.0000000000 -1.0000000000 192.3675000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 409 ? F HOH . 2 1 A HOH 573 ? F HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-07-31 2 'Structure model' 1 1 2013-08-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 2 HKL-2000 . ? ? ? ? 'data collection' ? ? ? 3 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 4 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ALA _pdbx_validate_close_contact.auth_seq_id_1 145 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 624 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.85 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 CYS _pdbx_validate_rmsd_bond.auth_seq_id_1 198 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 B _pdbx_validate_rmsd_bond.auth_atom_id_2 SG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 CYS _pdbx_validate_rmsd_bond.auth_seq_id_2 198 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 B _pdbx_validate_rmsd_bond.bond_value 1.681 _pdbx_validate_rmsd_bond.bond_target_value 1.812 _pdbx_validate_rmsd_bond.bond_deviation -0.131 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.016 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 168 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 168 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 168 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 124.12 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 3.82 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 13 ? ? 77.99 -3.16 2 1 PRO A 109 ? ? -85.61 48.70 3 1 THR A 132 ? ? -125.32 -150.03 4 1 ASP A 144 ? ? 61.03 -9.77 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 206 ? A HIS 206 2 1 Y 1 A HIS 207 ? A HIS 207 3 1 Y 1 A HIS 208 ? A HIS 208 4 1 Y 1 A HIS 209 ? A HIS 209 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 'SULFATE ION' SO4 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PO4 1 301 1 PO4 PO4 A . C 3 SO4 1 302 1 SO4 SO4 A . D 3 SO4 1 303 3 SO4 SO4 A . E 3 SO4 1 304 4 SO4 SO4 A . F 4 HOH 1 401 1 HOH HOH A . F 4 HOH 2 402 2 HOH HOH A . F 4 HOH 3 403 3 HOH HOH A . F 4 HOH 4 404 4 HOH HOH A . F 4 HOH 5 405 5 HOH HOH A . F 4 HOH 6 406 6 HOH HOH A . F 4 HOH 7 407 7 HOH HOH A . F 4 HOH 8 408 8 HOH HOH A . F 4 HOH 9 409 9 HOH HOH A . F 4 HOH 10 410 10 HOH HOH A . F 4 HOH 11 411 11 HOH HOH A . F 4 HOH 12 412 12 HOH HOH A . F 4 HOH 13 413 13 HOH HOH A . F 4 HOH 14 414 14 HOH HOH A . F 4 HOH 15 415 15 HOH HOH A . F 4 HOH 16 416 16 HOH HOH A . F 4 HOH 17 417 17 HOH HOH A . F 4 HOH 18 418 19 HOH HOH A . F 4 HOH 19 419 20 HOH HOH A . F 4 HOH 20 420 21 HOH HOH A . F 4 HOH 21 421 22 HOH HOH A . F 4 HOH 22 422 23 HOH HOH A . F 4 HOH 23 423 24 HOH HOH A . F 4 HOH 24 424 25 HOH HOH A . F 4 HOH 25 425 26 HOH HOH A . F 4 HOH 26 426 27 HOH HOH A . F 4 HOH 27 427 28 HOH HOH A . F 4 HOH 28 428 29 HOH HOH A . F 4 HOH 29 429 30 HOH HOH A . F 4 HOH 30 430 31 HOH HOH A . F 4 HOH 31 431 32 HOH HOH A . F 4 HOH 32 432 33 HOH HOH A . F 4 HOH 33 433 34 HOH HOH A . F 4 HOH 34 434 35 HOH HOH A . F 4 HOH 35 435 36 HOH HOH A . F 4 HOH 36 436 37 HOH HOH A . F 4 HOH 37 437 38 HOH HOH A . F 4 HOH 38 438 39 HOH HOH A . F 4 HOH 39 439 40 HOH HOH A . F 4 HOH 40 440 43 HOH HOH A . F 4 HOH 41 441 44 HOH HOH A . F 4 HOH 42 442 45 HOH HOH A . F 4 HOH 43 443 46 HOH HOH A . F 4 HOH 44 444 47 HOH HOH A . F 4 HOH 45 445 48 HOH HOH A . F 4 HOH 46 446 49 HOH HOH A . F 4 HOH 47 447 50 HOH HOH A . F 4 HOH 48 448 51 HOH HOH A . F 4 HOH 49 449 52 HOH HOH A . F 4 HOH 50 450 53 HOH HOH A . F 4 HOH 51 451 54 HOH HOH A . F 4 HOH 52 452 55 HOH HOH A . F 4 HOH 53 453 56 HOH HOH A . F 4 HOH 54 454 57 HOH HOH A . F 4 HOH 55 455 58 HOH HOH A . F 4 HOH 56 456 59 HOH HOH A . F 4 HOH 57 457 60 HOH HOH A . F 4 HOH 58 458 61 HOH HOH A . F 4 HOH 59 459 62 HOH HOH A . F 4 HOH 60 460 63 HOH HOH A . F 4 HOH 61 461 64 HOH HOH A . F 4 HOH 62 462 65 HOH HOH A . F 4 HOH 63 463 66 HOH HOH A . F 4 HOH 64 464 67 HOH HOH A . F 4 HOH 65 465 68 HOH HOH A . F 4 HOH 66 466 69 HOH HOH A . F 4 HOH 67 467 70 HOH HOH A . F 4 HOH 68 468 71 HOH HOH A . F 4 HOH 69 469 72 HOH HOH A . F 4 HOH 70 470 73 HOH HOH A . F 4 HOH 71 471 74 HOH HOH A . F 4 HOH 72 472 75 HOH HOH A . F 4 HOH 73 473 76 HOH HOH A . F 4 HOH 74 474 77 HOH HOH A . F 4 HOH 75 475 78 HOH HOH A . F 4 HOH 76 476 79 HOH HOH A . F 4 HOH 77 477 80 HOH HOH A . F 4 HOH 78 478 82 HOH HOH A . F 4 HOH 79 479 83 HOH HOH A . F 4 HOH 80 480 84 HOH HOH A . F 4 HOH 81 481 85 HOH HOH A . F 4 HOH 82 482 86 HOH HOH A . F 4 HOH 83 483 87 HOH HOH A . F 4 HOH 84 484 88 HOH HOH A . F 4 HOH 85 485 89 HOH HOH A . F 4 HOH 86 486 90 HOH HOH A . F 4 HOH 87 487 91 HOH HOH A . F 4 HOH 88 488 92 HOH HOH A . F 4 HOH 89 489 93 HOH HOH A . F 4 HOH 90 490 94 HOH HOH A . F 4 HOH 91 491 95 HOH HOH A . F 4 HOH 92 492 96 HOH HOH A . F 4 HOH 93 493 97 HOH HOH A . F 4 HOH 94 494 98 HOH HOH A . F 4 HOH 95 495 99 HOH HOH A . F 4 HOH 96 496 100 HOH HOH A . F 4 HOH 97 497 101 HOH HOH A . F 4 HOH 98 498 102 HOH HOH A . F 4 HOH 99 499 103 HOH HOH A . F 4 HOH 100 500 104 HOH HOH A . F 4 HOH 101 501 105 HOH HOH A . F 4 HOH 102 502 106 HOH HOH A . F 4 HOH 103 503 107 HOH HOH A . F 4 HOH 104 504 108 HOH HOH A . F 4 HOH 105 505 110 HOH HOH A . F 4 HOH 106 506 111 HOH HOH A . F 4 HOH 107 507 112 HOH HOH A . F 4 HOH 108 508 113 HOH HOH A . F 4 HOH 109 509 114 HOH HOH A . F 4 HOH 110 510 115 HOH HOH A . F 4 HOH 111 511 116 HOH HOH A . F 4 HOH 112 512 117 HOH HOH A . F 4 HOH 113 513 118 HOH HOH A . F 4 HOH 114 514 119 HOH HOH A . F 4 HOH 115 515 120 HOH HOH A . F 4 HOH 116 516 121 HOH HOH A . F 4 HOH 117 517 122 HOH HOH A . F 4 HOH 118 518 123 HOH HOH A . F 4 HOH 119 519 124 HOH HOH A . F 4 HOH 120 520 125 HOH HOH A . F 4 HOH 121 521 126 HOH HOH A . F 4 HOH 122 522 127 HOH HOH A . F 4 HOH 123 523 128 HOH HOH A . F 4 HOH 124 524 129 HOH HOH A . F 4 HOH 125 525 130 HOH HOH A . F 4 HOH 126 526 131 HOH HOH A . F 4 HOH 127 527 132 HOH HOH A . F 4 HOH 128 528 133 HOH HOH A . F 4 HOH 129 529 134 HOH HOH A . F 4 HOH 130 530 135 HOH HOH A . F 4 HOH 131 531 136 HOH HOH A . F 4 HOH 132 532 137 HOH HOH A . F 4 HOH 133 533 138 HOH HOH A . F 4 HOH 134 534 139 HOH HOH A . F 4 HOH 135 535 140 HOH HOH A . F 4 HOH 136 536 141 HOH HOH A . F 4 HOH 137 537 142 HOH HOH A . F 4 HOH 138 538 143 HOH HOH A . F 4 HOH 139 539 144 HOH HOH A . F 4 HOH 140 540 145 HOH HOH A . F 4 HOH 141 541 146 HOH HOH A . F 4 HOH 142 542 147 HOH HOH A . F 4 HOH 143 543 148 HOH HOH A . F 4 HOH 144 544 149 HOH HOH A . F 4 HOH 145 545 150 HOH HOH A . F 4 HOH 146 546 151 HOH HOH A . F 4 HOH 147 547 152 HOH HOH A . F 4 HOH 148 548 153 HOH HOH A . F 4 HOH 149 549 154 HOH HOH A . F 4 HOH 150 550 155 HOH HOH A . F 4 HOH 151 551 156 HOH HOH A . F 4 HOH 152 552 157 HOH HOH A . F 4 HOH 153 553 159 HOH HOH A . F 4 HOH 154 554 160 HOH HOH A . F 4 HOH 155 555 161 HOH HOH A . F 4 HOH 156 556 162 HOH HOH A . F 4 HOH 157 557 163 HOH HOH A . F 4 HOH 158 558 166 HOH HOH A . F 4 HOH 159 559 167 HOH HOH A . F 4 HOH 160 560 168 HOH HOH A . F 4 HOH 161 561 169 HOH HOH A . F 4 HOH 162 562 170 HOH HOH A . F 4 HOH 163 563 171 HOH HOH A . F 4 HOH 164 564 172 HOH HOH A . F 4 HOH 165 565 173 HOH HOH A . F 4 HOH 166 566 174 HOH HOH A . F 4 HOH 167 567 176 HOH HOH A . F 4 HOH 168 568 177 HOH HOH A . F 4 HOH 169 569 178 HOH HOH A . F 4 HOH 170 570 179 HOH HOH A . F 4 HOH 171 571 180 HOH HOH A . F 4 HOH 172 572 181 HOH HOH A . F 4 HOH 173 573 182 HOH HOH A . F 4 HOH 174 574 184 HOH HOH A . F 4 HOH 175 575 185 HOH HOH A . F 4 HOH 176 576 186 HOH HOH A . F 4 HOH 177 577 187 HOH HOH A . F 4 HOH 178 578 188 HOH HOH A . F 4 HOH 179 579 189 HOH HOH A . F 4 HOH 180 580 190 HOH HOH A . F 4 HOH 181 581 191 HOH HOH A . F 4 HOH 182 582 192 HOH HOH A . F 4 HOH 183 583 193 HOH HOH A . F 4 HOH 184 584 194 HOH HOH A . F 4 HOH 185 585 195 HOH HOH A . F 4 HOH 186 586 196 HOH HOH A . F 4 HOH 187 587 197 HOH HOH A . F 4 HOH 188 588 198 HOH HOH A . F 4 HOH 189 589 199 HOH HOH A . F 4 HOH 190 590 200 HOH HOH A . F 4 HOH 191 591 201 HOH HOH A . F 4 HOH 192 592 202 HOH HOH A . F 4 HOH 193 593 203 HOH HOH A . F 4 HOH 194 594 204 HOH HOH A . F 4 HOH 195 595 205 HOH HOH A . F 4 HOH 196 596 206 HOH HOH A . F 4 HOH 197 597 207 HOH HOH A . F 4 HOH 198 598 209 HOH HOH A . F 4 HOH 199 599 212 HOH HOH A . F 4 HOH 200 600 213 HOH HOH A . F 4 HOH 201 601 214 HOH HOH A . F 4 HOH 202 602 215 HOH HOH A . F 4 HOH 203 603 216 HOH HOH A . F 4 HOH 204 604 217 HOH HOH A . F 4 HOH 205 605 218 HOH HOH A . F 4 HOH 206 606 219 HOH HOH A . F 4 HOH 207 607 220 HOH HOH A . F 4 HOH 208 608 221 HOH HOH A . F 4 HOH 209 609 222 HOH HOH A . F 4 HOH 210 610 223 HOH HOH A . F 4 HOH 211 611 224 HOH HOH A . F 4 HOH 212 612 225 HOH HOH A . F 4 HOH 213 613 226 HOH HOH A . F 4 HOH 214 614 227 HOH HOH A . F 4 HOH 215 615 228 HOH HOH A . F 4 HOH 216 616 229 HOH HOH A . F 4 HOH 217 617 230 HOH HOH A . F 4 HOH 218 618 231 HOH HOH A . F 4 HOH 219 619 232 HOH HOH A . F 4 HOH 220 620 233 HOH HOH A . F 4 HOH 221 621 234 HOH HOH A . F 4 HOH 222 622 235 HOH HOH A . F 4 HOH 223 623 236 HOH HOH A . F 4 HOH 224 624 237 HOH HOH A . F 4 HOH 225 625 238 HOH HOH A . F 4 HOH 226 626 239 HOH HOH A . F 4 HOH 227 627 240 HOH HOH A . #