data_4F2L # _entry.id 4F2L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4F2L pdb_00004f2l 10.2210/pdb4f2l/pdb RCSB RCSB072375 ? ? WWPDB D_1000072375 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-06-26 2 'Structure model' 1 1 2014-09-03 3 'Structure model' 1 2 2017-11-15 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' chem_comp_atom 3 4 'Structure model' chem_comp_bond 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_entry_details 6 4 'Structure model' pdbx_modification_feature 7 4 'Structure model' pdbx_struct_conn_angle 8 4 'Structure model' struct_conn 9 4 'Structure model' struct_ref_seq_dif 10 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.value' 6 4 'Structure model' '_struct_conn.pdbx_dist_value' 7 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 8 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 9 4 'Structure model' '_struct_ref_seq_dif.details' 10 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 11 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 12 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4F2L _pdbx_database_status.recvd_initial_deposition_date 2012-05-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xin, F.J.' 1 'Zhang, Y.Y.' 2 'Wang, J.' 3 'Wang, Z.X.' 4 'Wu, J.W.' 5 # _citation.id primary _citation.title 'Conserved regulatory elements in AMPK' _citation.journal_abbrev Nature _citation.journal_volume 498 _citation.page_first E8 _citation.page_last E10 _citation.year 2013 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23765502 _citation.pdbx_database_id_DOI 10.1038/nature12189 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, L.' 1 ? primary 'Xin, F.J.' 2 ? primary 'Wang, J.' 3 ? primary 'Hu, J.' 4 ? primary 'Zhang, Y.Y.' 5 ? primary 'Wan, S.' 6 ? primary 'Cao, L.S.' 7 ? primary 'Lu, C.' 8 ? primary 'Li, P.' 9 ? primary 'Yan, S.F.' 10 ? primary 'Neumann, D.' 11 ? primary 'Schlattner, U.' 12 ? primary 'Xia, B.' 13 ? primary 'Wang, Z.X.' 14 ? primary 'Wu, J.W.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;5'-AMP-activated protein kinase catalytic subunit alpha-1 ; 7387.910 1 '2.7.11.1, 2.7.11.26' ? 'regulatory domain, UNP RESIDUES 295-347' ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 water nat water 18.015 79 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AMPK subunit alpha-1, Tau-protein kinase PRKAA1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'SST(MSE)IDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRI(MSE)NELEHHHHHH' _entity_poly.pdbx_seq_one_letter_code_can SSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNELEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 THR n 1 4 MSE n 1 5 ILE n 1 6 ASP n 1 7 ASP n 1 8 GLU n 1 9 ALA n 1 10 LEU n 1 11 LYS n 1 12 GLU n 1 13 VAL n 1 14 CYS n 1 15 GLU n 1 16 LYS n 1 17 PHE n 1 18 GLU n 1 19 CYS n 1 20 SER n 1 21 GLU n 1 22 GLU n 1 23 GLU n 1 24 VAL n 1 25 LEU n 1 26 SER n 1 27 CYS n 1 28 LEU n 1 29 TYR n 1 30 ASN n 1 31 ARG n 1 32 ASN n 1 33 HIS n 1 34 GLN n 1 35 ASP n 1 36 PRO n 1 37 LEU n 1 38 ALA n 1 39 VAL n 1 40 ALA n 1 41 TYR n 1 42 HIS n 1 43 LEU n 1 44 ILE n 1 45 ILE n 1 46 ASP n 1 47 ASN n 1 48 ARG n 1 49 ARG n 1 50 ILE n 1 51 MSE n 1 52 ASN n 1 53 GLU n 1 54 LEU n 1 55 GLU n 1 56 HIS n 1 57 HIS n 1 58 HIS n 1 59 HIS n 1 60 HIS n 1 61 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'brown rat,rat,rats' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Prkaa1, Ampk1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 284 284 SER SER A . n A 1 2 SER 2 285 285 SER SER A . n A 1 3 THR 3 286 286 THR THR A . n A 1 4 MSE 4 287 287 MSE MSE A . n A 1 5 ILE 5 288 288 ILE ILE A . n A 1 6 ASP 6 289 289 ASP ASP A . n A 1 7 ASP 7 290 290 ASP ASP A . n A 1 8 GLU 8 291 291 GLU GLU A . n A 1 9 ALA 9 292 292 ALA ALA A . n A 1 10 LEU 10 293 293 LEU LEU A . n A 1 11 LYS 11 294 294 LYS LYS A . n A 1 12 GLU 12 295 295 GLU GLU A . n A 1 13 VAL 13 296 296 VAL VAL A . n A 1 14 CYS 14 297 297 CYS CYS A . n A 1 15 GLU 15 298 298 GLU GLU A . n A 1 16 LYS 16 299 299 LYS LYS A . n A 1 17 PHE 17 300 300 PHE PHE A . n A 1 18 GLU 18 301 301 GLU GLU A . n A 1 19 CYS 19 302 302 CYS CYS A . n A 1 20 SER 20 303 303 SER SER A . n A 1 21 GLU 21 304 304 GLU GLU A . n A 1 22 GLU 22 305 305 GLU GLU A . n A 1 23 GLU 23 306 306 GLU GLU A . n A 1 24 VAL 24 307 307 VAL VAL A . n A 1 25 LEU 25 308 308 LEU LEU A . n A 1 26 SER 26 309 309 SER SER A . n A 1 27 CYS 27 310 310 CYS CYS A . n A 1 28 LEU 28 311 311 LEU LEU A . n A 1 29 TYR 29 312 312 TYR TYR A . n A 1 30 ASN 30 313 313 ASN ASN A . n A 1 31 ARG 31 314 314 ARG ARG A . n A 1 32 ASN 32 315 315 ASN ASN A . n A 1 33 HIS 33 316 316 HIS HIS A . n A 1 34 GLN 34 317 317 GLN GLN A . n A 1 35 ASP 35 318 318 ASP ASP A . n A 1 36 PRO 36 319 319 PRO PRO A . n A 1 37 LEU 37 320 320 LEU LEU A . n A 1 38 ALA 38 321 321 ALA ALA A . n A 1 39 VAL 39 322 322 VAL VAL A . n A 1 40 ALA 40 323 323 ALA ALA A . n A 1 41 TYR 41 324 324 TYR TYR A . n A 1 42 HIS 42 325 325 HIS HIS A . n A 1 43 LEU 43 326 326 LEU LEU A . n A 1 44 ILE 44 327 327 ILE ILE A . n A 1 45 ILE 45 328 328 ILE ILE A . n A 1 46 ASP 46 329 329 ASP ASP A . n A 1 47 ASN 47 330 330 ASN ASN A . n A 1 48 ARG 48 331 331 ARG ARG A . n A 1 49 ARG 49 332 332 ARG ARG A . n A 1 50 ILE 50 333 333 ILE ILE A . n A 1 51 MSE 51 334 334 MSE MSE A . n A 1 52 ASN 52 335 335 ASN ASN A . n A 1 53 GLU 53 336 336 GLU GLU A . n A 1 54 LEU 54 337 337 LEU LEU A . n A 1 55 GLU 55 338 338 GLU GLU A . n A 1 56 HIS 56 339 339 HIS HIS A . n A 1 57 HIS 57 340 340 HIS HIS A . n A 1 58 HIS 58 341 341 HIS HIS A . n A 1 59 HIS 59 342 342 HIS HIS A . n A 1 60 HIS 60 343 343 HIS HIS A . n A 1 61 HIS 61 344 344 HIS HIS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 401 1 MG MG A . C 3 HOH 1 501 1 HOH HOH A . C 3 HOH 2 502 2 HOH HOH A . C 3 HOH 3 503 3 HOH HOH A . C 3 HOH 4 504 6 HOH HOH A . C 3 HOH 5 505 7 HOH HOH A . C 3 HOH 6 506 8 HOH HOH A . C 3 HOH 7 507 9 HOH HOH A . C 3 HOH 8 508 10 HOH HOH A . C 3 HOH 9 509 11 HOH HOH A . C 3 HOH 10 510 12 HOH HOH A . C 3 HOH 11 511 14 HOH HOH A . C 3 HOH 12 512 15 HOH HOH A . C 3 HOH 13 513 16 HOH HOH A . C 3 HOH 14 514 17 HOH HOH A . C 3 HOH 15 515 18 HOH HOH A . C 3 HOH 16 516 19 HOH HOH A . C 3 HOH 17 517 20 HOH HOH A . C 3 HOH 18 518 21 HOH HOH A . C 3 HOH 19 519 22 HOH HOH A . C 3 HOH 20 520 23 HOH HOH A . C 3 HOH 21 521 24 HOH HOH A . C 3 HOH 22 522 25 HOH HOH A . C 3 HOH 23 523 28 HOH HOH A . C 3 HOH 24 524 29 HOH HOH A . C 3 HOH 25 525 30 HOH HOH A . C 3 HOH 26 526 33 HOH HOH A . C 3 HOH 27 527 34 HOH HOH A . C 3 HOH 28 528 36 HOH HOH A . C 3 HOH 29 529 38 HOH HOH A . C 3 HOH 30 530 40 HOH HOH A . C 3 HOH 31 531 41 HOH HOH A . C 3 HOH 32 532 42 HOH HOH A . C 3 HOH 33 533 43 HOH HOH A . C 3 HOH 34 534 44 HOH HOH A . C 3 HOH 35 535 45 HOH HOH A . C 3 HOH 36 536 47 HOH HOH A . C 3 HOH 37 537 49 HOH HOH A . C 3 HOH 38 538 50 HOH HOH A . C 3 HOH 39 539 52 HOH HOH A . C 3 HOH 40 540 55 HOH HOH A . C 3 HOH 41 541 56 HOH HOH A . C 3 HOH 42 542 57 HOH HOH A . C 3 HOH 43 543 58 HOH HOH A . C 3 HOH 44 544 62 HOH HOH A . C 3 HOH 45 545 65 HOH HOH A . C 3 HOH 46 546 70 HOH HOH A . C 3 HOH 47 547 72 HOH HOH A . C 3 HOH 48 548 73 HOH HOH A . C 3 HOH 49 549 74 HOH HOH A . C 3 HOH 50 550 76 HOH HOH A . C 3 HOH 51 551 78 HOH HOH A . C 3 HOH 52 552 80 HOH HOH A . C 3 HOH 53 553 83 HOH HOH A . C 3 HOH 54 554 84 HOH HOH A . C 3 HOH 55 555 85 HOH HOH A . C 3 HOH 56 556 86 HOH HOH A . C 3 HOH 57 557 87 HOH HOH A . C 3 HOH 58 558 88 HOH HOH A . C 3 HOH 59 559 89 HOH HOH A . C 3 HOH 60 560 90 HOH HOH A . C 3 HOH 61 561 93 HOH HOH A . C 3 HOH 62 562 95 HOH HOH A . C 3 HOH 63 563 97 HOH HOH A . C 3 HOH 64 564 101 HOH HOH A . C 3 HOH 65 565 104 HOH HOH A . C 3 HOH 66 566 105 HOH HOH A . C 3 HOH 67 567 106 HOH HOH A . C 3 HOH 68 568 108 HOH HOH A . C 3 HOH 69 569 110 HOH HOH A . C 3 HOH 70 570 112 HOH HOH A . C 3 HOH 71 571 115 HOH HOH A . C 3 HOH 72 572 130 HOH HOH A . C 3 HOH 73 573 131 HOH HOH A . C 3 HOH 74 574 132 HOH HOH A . C 3 HOH 75 575 133 HOH HOH A . C 3 HOH 76 576 134 HOH HOH A . C 3 HOH 77 577 135 HOH HOH A . C 3 HOH 78 578 136 HOH HOH A . C 3 HOH 79 579 137 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MAR345dtb 'data collection' . ? 1 AutoSol phasing . ? 2 PHENIX refinement '(phenix.refine: 1.7.3_928)' ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # _cell.entry_id 4F2L _cell.length_a 22.117 _cell.length_b 36.258 _cell.length_c 98.755 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4F2L _symmetry.space_group_name_H-M 'P 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 17 _symmetry.space_group_name_Hall ? # _exptl.entry_id 4F2L _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.68 _exptl_crystal.density_percent_sol 54.10 _exptl_crystal.description 'THE ENTRY CONTAINS FRIEDEL PAIRS IN F_PLUS/MINUS COLUMNS' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '0.1M HEPES, 0.3M Magnesium sulfate, 36% isopropanol (v/v), pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.0K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2011-05-26 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.pdbx_synchrotron_site SSRF _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9792 # _reflns.entry_id 4F2L _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.5 _reflns.number_obs 24489 _reflns.number_all ? _reflns.percent_possible_obs 99.5 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 36.4 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.50 _reflns_shell.d_res_low 1.53 _reflns_shell.percent_possible_all 98.5 _reflns_shell.Rmerge_I_obs 0.263 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.6 _reflns_shell.pdbx_redundancy 3.1 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1179 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4F2L _refine.ls_number_reflns_obs 24447 _refine.ls_number_reflns_all 24447 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.90 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 24.372 _refine.ls_d_res_high 1.500 _refine.ls_percent_reflns_obs 99.47 _refine.ls_R_factor_obs 0.1833 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1819 _refine.ls_R_factor_R_free 0.2116 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.90 _refine.ls_number_reflns_R_free 1198 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] -1.6331 _refine.aniso_B[2][2] 5.9066 _refine.aniso_B[3][3] -4.2735 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] -0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.387 _refine.solvent_model_param_bsol 42.764 _refine.pdbx_solvent_vdw_probe_radii 1.00 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.73 _refine.pdbx_ls_cross_valid_method ? _refine.details 'THE ENTRY CONTAINS FRIEDEL PAIRS IN F_PLUS/MINUS COLUMNS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.18 _refine.pdbx_overall_phase_error 17.55 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 508 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 79 _refine_hist.number_atoms_total 588 _refine_hist.d_res_high 1.500 _refine_hist.d_res_low 24.372 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.005 ? ? 538 'X-RAY DIFFRACTION' ? f_angle_d 0.902 ? ? 730 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 15.646 ? ? 207 'X-RAY DIFFRACTION' ? f_chiral_restr 0.068 ? ? 78 'X-RAY DIFFRACTION' ? f_plane_restr 0.003 ? ? 98 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' 9 1.5001 1.5601 2562 0.2275 99.00 0.2470 . . 150 . . . . 'X-RAY DIFFRACTION' 9 1.5601 1.6311 2603 0.1987 100.00 0.2332 . . 132 . . . . 'X-RAY DIFFRACTION' 9 1.6311 1.7171 2559 0.1784 100.00 0.1928 . . 163 . . . . 'X-RAY DIFFRACTION' 9 1.7171 1.8246 2575 0.1833 100.00 0.2231 . . 138 . . . . 'X-RAY DIFFRACTION' 9 1.8246 1.9655 2633 0.1682 100.00 0.2349 . . 91 . . . . 'X-RAY DIFFRACTION' 9 1.9655 2.1631 2600 0.1796 100.00 0.1985 . . 128 . . . . 'X-RAY DIFFRACTION' 9 2.1631 2.4759 2595 0.1755 100.00 0.1780 . . 147 . . . . 'X-RAY DIFFRACTION' 9 2.4759 3.1183 2554 0.1820 99.00 0.2205 . . 141 . . . . 'X-RAY DIFFRACTION' 9 3.1183 24.3753 2568 0.1820 98.00 0.2227 . . 108 . . . . # _database_PDB_matrix.entry_id 4F2L _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 4F2L _struct.title 'Structure of a regulatory domain of AMPK' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4F2L _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'regulatory domain, helix, AMPK intramolecular interaction, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AAPK1_RAT _struct_ref.pdbx_db_accession P54645 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNE _struct_ref.pdbx_align_begin 295 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4F2L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P54645 _struct_ref_seq.db_align_beg 295 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 347 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 284 _struct_ref_seq.pdbx_auth_seq_align_end 336 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4F2L LEU A 54 ? UNP P54645 ? ? 'expression tag' 337 1 1 4F2L GLU A 55 ? UNP P54645 ? ? 'expression tag' 338 2 1 4F2L HIS A 56 ? UNP P54645 ? ? 'expression tag' 339 3 1 4F2L HIS A 57 ? UNP P54645 ? ? 'expression tag' 340 4 1 4F2L HIS A 58 ? UNP P54645 ? ? 'expression tag' 341 5 1 4F2L HIS A 59 ? UNP P54645 ? ? 'expression tag' 342 6 1 4F2L HIS A 60 ? UNP P54645 ? ? 'expression tag' 343 7 1 4F2L HIS A 61 ? UNP P54645 ? ? 'expression tag' 344 8 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 1810 ? 2 MORE -29 ? 2 'SSA (A^2)' 8510 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 2 1,2 A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_556 x,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 98.7550000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 6 ? GLU A 18 ? ASP A 289 GLU A 301 1 ? 13 HELX_P HELX_P2 2 SER A 20 ? ASN A 30 ? SER A 303 ASN A 313 1 ? 11 HELX_P HELX_P3 3 ASP A 35 ? HIS A 61 ? ASP A 318 HIS A 344 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A THR 3 C ? ? ? 1_555 A MSE 4 N ? ? A THR 286 A MSE 287 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? A MSE 4 C ? ? ? 1_555 A ILE 5 N ? ? A MSE 287 A ILE 288 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale3 covale both ? A ILE 50 C ? ? ? 1_555 A MSE 51 N ? ? A ILE 333 A MSE 334 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale4 covale both ? A MSE 51 C ? ? ? 1_555 A ASN 52 N ? ? A MSE 334 A ASN 335 1_555 ? ? ? ? ? ? ? 1.329 ? ? metalc1 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 401 A HOH 572 1_555 ? ? ? ? ? ? ? 2.364 ? ? metalc2 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 401 A HOH 573 1_555 ? ? ? ? ? ? ? 2.080 ? ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 401 A HOH 574 1_555 ? ? ? ? ? ? ? 2.040 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 401 A HOH 575 1_555 ? ? ? ? ? ? ? 2.093 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 401 A HOH 576 1_555 ? ? ? ? ? ? ? 2.014 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 401 A HOH 577 1_555 ? ? ? ? ? ? ? 2.301 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? C HOH . ? A HOH 572 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 573 ? 1_555 90.1 ? 2 O ? C HOH . ? A HOH 572 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 574 ? 1_555 87.6 ? 3 O ? C HOH . ? A HOH 573 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 574 ? 1_555 91.5 ? 4 O ? C HOH . ? A HOH 572 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 575 ? 1_555 85.2 ? 5 O ? C HOH . ? A HOH 573 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 575 ? 1_555 175.2 ? 6 O ? C HOH . ? A HOH 574 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 575 ? 1_555 89.2 ? 7 O ? C HOH . ? A HOH 572 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 576 ? 1_555 174.9 ? 8 O ? C HOH . ? A HOH 573 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 576 ? 1_555 95.0 ? 9 O ? C HOH . ? A HOH 574 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 576 ? 1_555 92.1 ? 10 O ? C HOH . ? A HOH 575 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 576 ? 1_555 89.7 ? 11 O ? C HOH . ? A HOH 572 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 577 ? 1_555 89.7 ? 12 O ? C HOH . ? A HOH 573 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 577 ? 1_555 97.1 ? 13 O ? C HOH . ? A HOH 574 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 577 ? 1_555 171.1 ? 14 O ? C HOH . ? A HOH 575 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 577 ? 1_555 82.1 ? 15 O ? C HOH . ? A HOH 576 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? C HOH . ? A HOH 577 ? 1_555 89.7 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 4 ? . . . . MSE A 287 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 51 ? . . . . MSE A 334 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id MG _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE MG A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HOH C . ? HOH A 572 . ? 1_555 ? 2 AC1 6 HOH C . ? HOH A 573 . ? 1_555 ? 3 AC1 6 HOH C . ? HOH A 574 . ? 1_555 ? 4 AC1 6 HOH C . ? HOH A 575 . ? 1_555 ? 5 AC1 6 HOH C . ? HOH A 576 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 577 . ? 1_555 ? # _pdbx_entry_details.entry_id 4F2L _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 4 A MSE 287 ? MET SELENOMETHIONINE 2 A MSE 51 A MSE 334 ? MET SELENOMETHIONINE # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 HIS N N N N 127 HIS CA C N S 128 HIS C C N N 129 HIS O O N N 130 HIS CB C N N 131 HIS CG C Y N 132 HIS ND1 N Y N 133 HIS CD2 C Y N 134 HIS CE1 C Y N 135 HIS NE2 N Y N 136 HIS OXT O N N 137 HIS H H N N 138 HIS H2 H N N 139 HIS HA H N N 140 HIS HB2 H N N 141 HIS HB3 H N N 142 HIS HD1 H N N 143 HIS HD2 H N N 144 HIS HE1 H N N 145 HIS HE2 H N N 146 HIS HXT H N N 147 HOH O O N N 148 HOH H1 H N N 149 HOH H2 H N N 150 ILE N N N N 151 ILE CA C N S 152 ILE C C N N 153 ILE O O N N 154 ILE CB C N S 155 ILE CG1 C N N 156 ILE CG2 C N N 157 ILE CD1 C N N 158 ILE OXT O N N 159 ILE H H N N 160 ILE H2 H N N 161 ILE HA H N N 162 ILE HB H N N 163 ILE HG12 H N N 164 ILE HG13 H N N 165 ILE HG21 H N N 166 ILE HG22 H N N 167 ILE HG23 H N N 168 ILE HD11 H N N 169 ILE HD12 H N N 170 ILE HD13 H N N 171 ILE HXT H N N 172 LEU N N N N 173 LEU CA C N S 174 LEU C C N N 175 LEU O O N N 176 LEU CB C N N 177 LEU CG C N N 178 LEU CD1 C N N 179 LEU CD2 C N N 180 LEU OXT O N N 181 LEU H H N N 182 LEU H2 H N N 183 LEU HA H N N 184 LEU HB2 H N N 185 LEU HB3 H N N 186 LEU HG H N N 187 LEU HD11 H N N 188 LEU HD12 H N N 189 LEU HD13 H N N 190 LEU HD21 H N N 191 LEU HD22 H N N 192 LEU HD23 H N N 193 LEU HXT H N N 194 LYS N N N N 195 LYS CA C N S 196 LYS C C N N 197 LYS O O N N 198 LYS CB C N N 199 LYS CG C N N 200 LYS CD C N N 201 LYS CE C N N 202 LYS NZ N N N 203 LYS OXT O N N 204 LYS H H N N 205 LYS H2 H N N 206 LYS HA H N N 207 LYS HB2 H N N 208 LYS HB3 H N N 209 LYS HG2 H N N 210 LYS HG3 H N N 211 LYS HD2 H N N 212 LYS HD3 H N N 213 LYS HE2 H N N 214 LYS HE3 H N N 215 LYS HZ1 H N N 216 LYS HZ2 H N N 217 LYS HZ3 H N N 218 LYS HXT H N N 219 MG MG MG N N 220 MSE N N N N 221 MSE CA C N S 222 MSE C C N N 223 MSE O O N N 224 MSE OXT O N N 225 MSE CB C N N 226 MSE CG C N N 227 MSE SE SE N N 228 MSE CE C N N 229 MSE H H N N 230 MSE H2 H N N 231 MSE HA H N N 232 MSE HXT H N N 233 MSE HB2 H N N 234 MSE HB3 H N N 235 MSE HG2 H N N 236 MSE HG3 H N N 237 MSE HE1 H N N 238 MSE HE2 H N N 239 MSE HE3 H N N 240 PHE N N N N 241 PHE CA C N S 242 PHE C C N N 243 PHE O O N N 244 PHE CB C N N 245 PHE CG C Y N 246 PHE CD1 C Y N 247 PHE CD2 C Y N 248 PHE CE1 C Y N 249 PHE CE2 C Y N 250 PHE CZ C Y N 251 PHE OXT O N N 252 PHE H H N N 253 PHE H2 H N N 254 PHE HA H N N 255 PHE HB2 H N N 256 PHE HB3 H N N 257 PHE HD1 H N N 258 PHE HD2 H N N 259 PHE HE1 H N N 260 PHE HE2 H N N 261 PHE HZ H N N 262 PHE HXT H N N 263 PRO N N N N 264 PRO CA C N S 265 PRO C C N N 266 PRO O O N N 267 PRO CB C N N 268 PRO CG C N N 269 PRO CD C N N 270 PRO OXT O N N 271 PRO H H N N 272 PRO HA H N N 273 PRO HB2 H N N 274 PRO HB3 H N N 275 PRO HG2 H N N 276 PRO HG3 H N N 277 PRO HD2 H N N 278 PRO HD3 H N N 279 PRO HXT H N N 280 SER N N N N 281 SER CA C N S 282 SER C C N N 283 SER O O N N 284 SER CB C N N 285 SER OG O N N 286 SER OXT O N N 287 SER H H N N 288 SER H2 H N N 289 SER HA H N N 290 SER HB2 H N N 291 SER HB3 H N N 292 SER HG H N N 293 SER HXT H N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 TYR N N N N 312 TYR CA C N S 313 TYR C C N N 314 TYR O O N N 315 TYR CB C N N 316 TYR CG C Y N 317 TYR CD1 C Y N 318 TYR CD2 C Y N 319 TYR CE1 C Y N 320 TYR CE2 C Y N 321 TYR CZ C Y N 322 TYR OH O N N 323 TYR OXT O N N 324 TYR H H N N 325 TYR H2 H N N 326 TYR HA H N N 327 TYR HB2 H N N 328 TYR HB3 H N N 329 TYR HD1 H N N 330 TYR HD2 H N N 331 TYR HE1 H N N 332 TYR HE2 H N N 333 TYR HH H N N 334 TYR HXT H N N 335 VAL N N N N 336 VAL CA C N S 337 VAL C C N N 338 VAL O O N N 339 VAL CB C N N 340 VAL CG1 C N N 341 VAL CG2 C N N 342 VAL OXT O N N 343 VAL H H N N 344 VAL H2 H N N 345 VAL HA H N N 346 VAL HB H N N 347 VAL HG11 H N N 348 VAL HG12 H N N 349 VAL HG13 H N N 350 VAL HG21 H N N 351 VAL HG22 H N N 352 VAL HG23 H N N 353 VAL HXT H N N 354 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 HIS N CA sing N N 120 HIS N H sing N N 121 HIS N H2 sing N N 122 HIS CA C sing N N 123 HIS CA CB sing N N 124 HIS CA HA sing N N 125 HIS C O doub N N 126 HIS C OXT sing N N 127 HIS CB CG sing N N 128 HIS CB HB2 sing N N 129 HIS CB HB3 sing N N 130 HIS CG ND1 sing Y N 131 HIS CG CD2 doub Y N 132 HIS ND1 CE1 doub Y N 133 HIS ND1 HD1 sing N N 134 HIS CD2 NE2 sing Y N 135 HIS CD2 HD2 sing N N 136 HIS CE1 NE2 sing Y N 137 HIS CE1 HE1 sing N N 138 HIS NE2 HE2 sing N N 139 HIS OXT HXT sing N N 140 HOH O H1 sing N N 141 HOH O H2 sing N N 142 ILE N CA sing N N 143 ILE N H sing N N 144 ILE N H2 sing N N 145 ILE CA C sing N N 146 ILE CA CB sing N N 147 ILE CA HA sing N N 148 ILE C O doub N N 149 ILE C OXT sing N N 150 ILE CB CG1 sing N N 151 ILE CB CG2 sing N N 152 ILE CB HB sing N N 153 ILE CG1 CD1 sing N N 154 ILE CG1 HG12 sing N N 155 ILE CG1 HG13 sing N N 156 ILE CG2 HG21 sing N N 157 ILE CG2 HG22 sing N N 158 ILE CG2 HG23 sing N N 159 ILE CD1 HD11 sing N N 160 ILE CD1 HD12 sing N N 161 ILE CD1 HD13 sing N N 162 ILE OXT HXT sing N N 163 LEU N CA sing N N 164 LEU N H sing N N 165 LEU N H2 sing N N 166 LEU CA C sing N N 167 LEU CA CB sing N N 168 LEU CA HA sing N N 169 LEU C O doub N N 170 LEU C OXT sing N N 171 LEU CB CG sing N N 172 LEU CB HB2 sing N N 173 LEU CB HB3 sing N N 174 LEU CG CD1 sing N N 175 LEU CG CD2 sing N N 176 LEU CG HG sing N N 177 LEU CD1 HD11 sing N N 178 LEU CD1 HD12 sing N N 179 LEU CD1 HD13 sing N N 180 LEU CD2 HD21 sing N N 181 LEU CD2 HD22 sing N N 182 LEU CD2 HD23 sing N N 183 LEU OXT HXT sing N N 184 LYS N CA sing N N 185 LYS N H sing N N 186 LYS N H2 sing N N 187 LYS CA C sing N N 188 LYS CA CB sing N N 189 LYS CA HA sing N N 190 LYS C O doub N N 191 LYS C OXT sing N N 192 LYS CB CG sing N N 193 LYS CB HB2 sing N N 194 LYS CB HB3 sing N N 195 LYS CG CD sing N N 196 LYS CG HG2 sing N N 197 LYS CG HG3 sing N N 198 LYS CD CE sing N N 199 LYS CD HD2 sing N N 200 LYS CD HD3 sing N N 201 LYS CE NZ sing N N 202 LYS CE HE2 sing N N 203 LYS CE HE3 sing N N 204 LYS NZ HZ1 sing N N 205 LYS NZ HZ2 sing N N 206 LYS NZ HZ3 sing N N 207 LYS OXT HXT sing N N 208 MSE N CA sing N N 209 MSE N H sing N N 210 MSE N H2 sing N N 211 MSE CA C sing N N 212 MSE CA CB sing N N 213 MSE CA HA sing N N 214 MSE C O doub N N 215 MSE C OXT sing N N 216 MSE OXT HXT sing N N 217 MSE CB CG sing N N 218 MSE CB HB2 sing N N 219 MSE CB HB3 sing N N 220 MSE CG SE sing N N 221 MSE CG HG2 sing N N 222 MSE CG HG3 sing N N 223 MSE SE CE sing N N 224 MSE CE HE1 sing N N 225 MSE CE HE2 sing N N 226 MSE CE HE3 sing N N 227 PHE N CA sing N N 228 PHE N H sing N N 229 PHE N H2 sing N N 230 PHE CA C sing N N 231 PHE CA CB sing N N 232 PHE CA HA sing N N 233 PHE C O doub N N 234 PHE C OXT sing N N 235 PHE CB CG sing N N 236 PHE CB HB2 sing N N 237 PHE CB HB3 sing N N 238 PHE CG CD1 doub Y N 239 PHE CG CD2 sing Y N 240 PHE CD1 CE1 sing Y N 241 PHE CD1 HD1 sing N N 242 PHE CD2 CE2 doub Y N 243 PHE CD2 HD2 sing N N 244 PHE CE1 CZ doub Y N 245 PHE CE1 HE1 sing N N 246 PHE CE2 CZ sing Y N 247 PHE CE2 HE2 sing N N 248 PHE CZ HZ sing N N 249 PHE OXT HXT sing N N 250 PRO N CA sing N N 251 PRO N CD sing N N 252 PRO N H sing N N 253 PRO CA C sing N N 254 PRO CA CB sing N N 255 PRO CA HA sing N N 256 PRO C O doub N N 257 PRO C OXT sing N N 258 PRO CB CG sing N N 259 PRO CB HB2 sing N N 260 PRO CB HB3 sing N N 261 PRO CG CD sing N N 262 PRO CG HG2 sing N N 263 PRO CG HG3 sing N N 264 PRO CD HD2 sing N N 265 PRO CD HD3 sing N N 266 PRO OXT HXT sing N N 267 SER N CA sing N N 268 SER N H sing N N 269 SER N H2 sing N N 270 SER CA C sing N N 271 SER CA CB sing N N 272 SER CA HA sing N N 273 SER C O doub N N 274 SER C OXT sing N N 275 SER CB OG sing N N 276 SER CB HB2 sing N N 277 SER CB HB3 sing N N 278 SER OG HG sing N N 279 SER OXT HXT sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TYR N CA sing N N 297 TYR N H sing N N 298 TYR N H2 sing N N 299 TYR CA C sing N N 300 TYR CA CB sing N N 301 TYR CA HA sing N N 302 TYR C O doub N N 303 TYR C OXT sing N N 304 TYR CB CG sing N N 305 TYR CB HB2 sing N N 306 TYR CB HB3 sing N N 307 TYR CG CD1 doub Y N 308 TYR CG CD2 sing Y N 309 TYR CD1 CE1 sing Y N 310 TYR CD1 HD1 sing N N 311 TYR CD2 CE2 doub Y N 312 TYR CD2 HD2 sing N N 313 TYR CE1 CZ doub Y N 314 TYR CE1 HE1 sing N N 315 TYR CE2 CZ sing Y N 316 TYR CE2 HE2 sing N N 317 TYR CZ OH sing N N 318 TYR OH HH sing N N 319 TYR OXT HXT sing N N 320 VAL N CA sing N N 321 VAL N H sing N N 322 VAL N H2 sing N N 323 VAL CA C sing N N 324 VAL CA CB sing N N 325 VAL CA HA sing N N 326 VAL C O doub N N 327 VAL C OXT sing N N 328 VAL CB CG1 sing N N 329 VAL CB CG2 sing N N 330 VAL CB HB sing N N 331 VAL CG1 HG11 sing N N 332 VAL CG1 HG12 sing N N 333 VAL CG1 HG13 sing N N 334 VAL CG2 HG21 sing N N 335 VAL CG2 HG22 sing N N 336 VAL CG2 HG23 sing N N 337 VAL OXT HXT sing N N 338 # _atom_sites.entry_id 4F2L _atom_sites.fract_transf_matrix[1][1] 0.045214 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027580 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010126 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S SE # loop_