data_4FRU # _entry.id 4FRU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4FRU pdb_00004fru 10.2210/pdb4fru/pdb RCSB RCSB073276 ? ? WWPDB D_1000073276 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4FRU _pdbx_database_status.recvd_initial_deposition_date 2012-06-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Boudko, S.P.' 1 'Ishikawa, Y.' 2 'Bachinger, H.P.' 3 # _citation.id primary _citation.title 'Crystal structures of wild-type and mutated cyclophilin B that causes hyperelastosis cutis in the American quarter horse.' _citation.journal_abbrev 'BMC Res Notes' _citation.journal_volume 5 _citation.page_first 626 _citation.page_last 626 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1756-0500 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23137129 _citation.pdbx_database_id_DOI 10.1186/1756-0500-5-626 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Boudko, S.P.' 1 ? primary 'Ishikawa, Y.' 2 ? primary 'Lerch, T.F.' 3 ? primary 'Nix, J.' 4 ? primary 'Chapman, M.S.' 5 ? primary 'Bachinger, H.P.' 6 ? # _cell.entry_id 4FRU _cell.length_a 64.880 _cell.length_b 44.070 _cell.length_c 60.570 _cell.angle_alpha 90.00 _cell.angle_beta 95.20 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4FRU _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidyl-prolyl cis-trans isomerase' 20465.518 1 5.2.1.8 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn '1-ETHOXY-2-(2-METHOXYETHOXY)ETHANE' 148.200 1 ? ? ? ? 4 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 5 water nat water 18.015 283 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CYCLOPHILIN B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AMDEKKKGPKVTVKVYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVALATGEKGFGYKDSKFHRVIKDFMIQGGDFTRGD GTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVETTKTDGRD KPLKDVTIADCGKIEVEKPFAIAKE ; _entity_poly.pdbx_seq_one_letter_code_can ;AMDEKKKGPKVTVKVYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVALATGEKGFGYKDSKFHRVIKDFMIQGGDFTRGD GTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVETTKTDGRD KPLKDVTIADCGKIEVEKPFAIAKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 MET n 1 3 ASP n 1 4 GLU n 1 5 LYS n 1 6 LYS n 1 7 LYS n 1 8 GLY n 1 9 PRO n 1 10 LYS n 1 11 VAL n 1 12 THR n 1 13 VAL n 1 14 LYS n 1 15 VAL n 1 16 TYR n 1 17 PHE n 1 18 ASP n 1 19 LEU n 1 20 ARG n 1 21 ILE n 1 22 GLY n 1 23 ASP n 1 24 GLU n 1 25 ASP n 1 26 ILE n 1 27 GLY n 1 28 ARG n 1 29 VAL n 1 30 VAL n 1 31 ILE n 1 32 GLY n 1 33 LEU n 1 34 PHE n 1 35 GLY n 1 36 LYS n 1 37 THR n 1 38 VAL n 1 39 PRO n 1 40 LYS n 1 41 THR n 1 42 VAL n 1 43 ASP n 1 44 ASN n 1 45 PHE n 1 46 VAL n 1 47 ALA n 1 48 LEU n 1 49 ALA n 1 50 THR n 1 51 GLY n 1 52 GLU n 1 53 LYS n 1 54 GLY n 1 55 PHE n 1 56 GLY n 1 57 TYR n 1 58 LYS n 1 59 ASP n 1 60 SER n 1 61 LYS n 1 62 PHE n 1 63 HIS n 1 64 ARG n 1 65 VAL n 1 66 ILE n 1 67 LYS n 1 68 ASP n 1 69 PHE n 1 70 MET n 1 71 ILE n 1 72 GLN n 1 73 GLY n 1 74 GLY n 1 75 ASP n 1 76 PHE n 1 77 THR n 1 78 ARG n 1 79 GLY n 1 80 ASP n 1 81 GLY n 1 82 THR n 1 83 GLY n 1 84 GLY n 1 85 LYS n 1 86 SER n 1 87 ILE n 1 88 TYR n 1 89 GLY n 1 90 GLU n 1 91 ARG n 1 92 PHE n 1 93 PRO n 1 94 ASP n 1 95 GLU n 1 96 ASN n 1 97 PHE n 1 98 LYS n 1 99 LEU n 1 100 LYS n 1 101 HIS n 1 102 TYR n 1 103 GLY n 1 104 PRO n 1 105 GLY n 1 106 TRP n 1 107 VAL n 1 108 SER n 1 109 MET n 1 110 ALA n 1 111 ASN n 1 112 ALA n 1 113 GLY n 1 114 LYS n 1 115 ASP n 1 116 THR n 1 117 ASN n 1 118 GLY n 1 119 SER n 1 120 GLN n 1 121 PHE n 1 122 PHE n 1 123 ILE n 1 124 THR n 1 125 THR n 1 126 VAL n 1 127 LYS n 1 128 THR n 1 129 ALA n 1 130 TRP n 1 131 LEU n 1 132 ASP n 1 133 GLY n 1 134 LYS n 1 135 HIS n 1 136 VAL n 1 137 VAL n 1 138 PHE n 1 139 GLY n 1 140 LYS n 1 141 VAL n 1 142 LEU n 1 143 GLU n 1 144 GLY n 1 145 MET n 1 146 GLU n 1 147 VAL n 1 148 VAL n 1 149 ARG n 1 150 LYS n 1 151 VAL n 1 152 GLU n 1 153 THR n 1 154 THR n 1 155 LYS n 1 156 THR n 1 157 ASP n 1 158 GLY n 1 159 ARG n 1 160 ASP n 1 161 LYS n 1 162 PRO n 1 163 LEU n 1 164 LYS n 1 165 ASP n 1 166 VAL n 1 167 THR n 1 168 ILE n 1 169 ALA n 1 170 ASP n 1 171 CYS n 1 172 GLY n 1 173 LYS n 1 174 ILE n 1 175 GLU n 1 176 VAL n 1 177 GLU n 1 178 LYS n 1 179 PRO n 1 180 PHE n 1 181 ALA n 1 182 ILE n 1 183 ALA n 1 184 LYS n 1 185 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'domestic horse,equine' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PPIB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Equus caballus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9796 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET30b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A5YBL8_HORSE _struct_ref.pdbx_db_accession A5YBL8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DEKKKGPKVTVKVYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVALATGEKGFGYKDSKFHRVIKDFMIQGGDFTRGDGT GGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVETTKTDGRDKP LKDVTIADCGKIEVEKPFAIAKE ; _struct_ref.pdbx_align_begin 34 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4FRU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 185 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A5YBL8 _struct_ref_seq.db_align_beg 34 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 216 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4FRU ALA A 1 ? UNP A5YBL8 ? ? 'expression tag' -1 1 1 4FRU MET A 2 ? UNP A5YBL8 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 ME2 non-polymer . '1-ETHOXY-2-(2-METHOXYETHOXY)ETHANE' ? 'C7 H16 O3' 148.200 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 4FRU _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_percent_sol 41.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 295.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.1M MES, 10mM ZnCl2, 10% glycerol, 28% PEG MME 550, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 295.0K' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type NOIR-1 _diffrn_detector.pdbx_collection_date 2010-08-12 _diffrn_detector.details ;Rosenbaum-Rock monochromator 1: high-resolution double-crystal sagittal focusing, Rosenbaum-Rock monochromator 2: double crystal, Rosenbaum-Rock vertical focusing mirror ; # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.827 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 4.2.2' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 4.2.2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.827 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4FRU _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F 1.0 _reflns.d_resolution_low 16.42 _reflns.d_resolution_high 1.10 _reflns.number_obs 62397 _reflns.number_all 69023 _reflns.percent_possible_obs 90.4 _reflns.pdbx_Rmerge_I_obs 0.078 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 9.8 _reflns.B_iso_Wilson_estimate 4.2 _reflns.pdbx_redundancy 3.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.10 _reflns_shell.d_res_low 1.16 _reflns_shell.percent_possible_all 53.4 _reflns_shell.Rmerge_I_obs 0.272 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.9 _reflns_shell.pdbx_redundancy 2.0 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4FRU _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 62351 _refine.ls_number_reflns_all 69108 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 16.416 _refine.ls_d_res_high 1.100 _refine.ls_percent_reflns_obs 90.22 _refine.ls_R_factor_obs 0.1167 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1155 _refine.ls_R_factor_R_free 0.1391 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.07 _refine.ls_number_reflns_R_free 3161 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1CYN' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.07 _refine.pdbx_overall_phase_error 11.54 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1429 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.number_atoms_solvent 283 _refine_hist.number_atoms_total 1729 _refine_hist.d_res_high 1.100 _refine_hist.d_res_low 16.416 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.007 ? ? 1521 'X-RAY DIFFRACTION' ? f_angle_d 1.301 ? ? 2041 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 11.819 ? ? 588 'X-RAY DIFFRACTION' ? f_chiral_restr 0.078 ? ? 218 'X-RAY DIFFRACTION' ? f_plane_restr 0.006 ? ? 260 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 1.1000 1.1164 1248 0.2130 43.00 0.1861 . . 56 . . . . 'X-RAY DIFFRACTION' . 1.1164 1.1339 1449 0.1919 52.00 0.1995 . . 81 . . . . 'X-RAY DIFFRACTION' . 1.1339 1.1524 1695 0.1764 59.00 0.2159 . . 92 . . . . 'X-RAY DIFFRACTION' . 1.1524 1.1723 1897 0.1658 68.00 0.2102 . . 95 . . . . 'X-RAY DIFFRACTION' . 1.1723 1.1936 2212 0.1609 77.00 0.1925 . . 104 . . . . 'X-RAY DIFFRACTION' . 1.1936 1.2166 2410 0.1455 86.00 0.1733 . . 148 . . . . 'X-RAY DIFFRACTION' . 1.2166 1.2414 2605 0.1346 92.00 0.1912 . . 147 . . . . 'X-RAY DIFFRACTION' . 1.2414 1.2684 2781 0.1223 97.00 0.1674 . . 163 . . . . 'X-RAY DIFFRACTION' . 1.2684 1.2979 2824 0.1072 100.00 0.1293 . . 142 . . . . 'X-RAY DIFFRACTION' . 1.2979 1.3303 2863 0.0996 100.00 0.1353 . . 115 . . . . 'X-RAY DIFFRACTION' . 1.3303 1.3663 2871 0.0970 100.00 0.1294 . . 147 . . . . 'X-RAY DIFFRACTION' . 1.3663 1.4064 2815 0.0913 100.00 0.1182 . . 179 . . . . 'X-RAY DIFFRACTION' . 1.4064 1.4518 2831 0.0881 100.00 0.1287 . . 165 . . . . 'X-RAY DIFFRACTION' . 1.4518 1.5037 2838 0.0884 100.00 0.1099 . . 163 . . . . 'X-RAY DIFFRACTION' . 1.5037 1.5638 2846 0.0856 100.00 0.1285 . . 169 . . . . 'X-RAY DIFFRACTION' . 1.5638 1.6349 2843 0.0874 100.00 0.1139 . . 153 . . . . 'X-RAY DIFFRACTION' . 1.6349 1.7211 2837 0.0898 100.00 0.1072 . . 139 . . . . 'X-RAY DIFFRACTION' . 1.7211 1.8288 2857 0.0920 100.00 0.1072 . . 169 . . . . 'X-RAY DIFFRACTION' . 1.8288 1.9697 2873 0.0964 100.00 0.1241 . . 151 . . . . 'X-RAY DIFFRACTION' . 1.9697 2.1676 2894 0.0980 100.00 0.1152 . . 129 . . . . 'X-RAY DIFFRACTION' . 2.1676 2.4803 2858 0.1085 100.00 0.1301 . . 154 . . . . 'X-RAY DIFFRACTION' . 2.4803 3.1214 2885 0.1301 100.00 0.1545 . . 155 . . . . 'X-RAY DIFFRACTION' . 3.1214 16.4181 2958 0.1391 100.00 0.1483 . . 145 . . . . # _struct.entry_id 4FRU _struct.title 'Crystal structure of horse wild-type cyclophilin B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4FRU _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text ;cyclophilin-type PPIase, Peptidyl-prolyl cis-trans isomerase; chaperone; foldase, P3H1-CRTAP-CypB complex; LH1 binding, endoplasmic reticulum, ISOMERASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 3 ? LYS A 5 ? ASP A 1 LYS A 3 5 ? 3 HELX_P HELX_P2 2 VAL A 38 ? GLY A 51 ? VAL A 36 GLY A 49 1 ? 14 HELX_P HELX_P3 3 THR A 128 ? ASP A 132 ? THR A 126 ASP A 130 5 ? 5 HELX_P HELX_P4 4 GLY A 144 ? THR A 153 ? GLY A 142 THR A 151 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 23 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 21 A ZN 202 1_555 ? ? ? ? ? ? ? 1.937 ? ? metalc2 metalc ? ? A HIS 135 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 133 A ZN 201 1_555 ? ? ? ? ? ? ? 2.027 ? ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 201 A HOH 472 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 201 A HOH 476 1_555 ? ? ? ? ? ? ? 2.230 ? ? metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 202 A HOH 320 1_555 ? ? ? ? ? ? ? 1.990 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 64 ? ILE A 66 ? ARG A 62 ILE A 64 A 2 MET A 70 ? GLY A 73 ? MET A 68 GLY A 71 A 3 PHE A 121 ? THR A 124 ? PHE A 119 THR A 122 A 4 TRP A 106 ? MET A 109 ? TRP A 104 MET A 107 A 5 VAL A 137 ? GLU A 143 ? VAL A 135 GLU A 141 A 6 GLU A 24 ? LEU A 33 ? GLU A 22 LEU A 31 A 7 LYS A 7 ? ILE A 21 ? LYS A 5 ILE A 19 A 8 VAL A 166 ? ALA A 183 ? VAL A 164 ALA A 181 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 64 ? N ARG A 62 O GLN A 72 ? O GLN A 70 A 2 3 N ILE A 71 ? N ILE A 69 O ILE A 123 ? O ILE A 121 A 3 4 O THR A 124 ? O THR A 122 N TRP A 106 ? N TRP A 104 A 4 5 N VAL A 107 ? N VAL A 105 O GLY A 139 ? O GLY A 137 A 5 6 O LEU A 142 ? O LEU A 140 N VAL A 30 ? N VAL A 28 A 6 7 O ILE A 31 ? O ILE A 29 N VAL A 15 ? N VAL A 13 A 7 8 N VAL A 11 ? N VAL A 9 O PHE A 180 ? O PHE A 178 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 202 ? 4 'BINDING SITE FOR RESIDUE ZN A 202' AC3 Software A ME2 203 ? 4 'BINDING SITE FOR RESIDUE ME2 A 203' AC4 Software A PEG 204 ? 3 'BINDING SITE FOR RESIDUE PEG A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ALA A 1 ? ALA A -1 . ? 4_546 ? 2 AC1 4 HIS A 135 ? HIS A 133 . ? 1_555 ? 3 AC1 4 HOH F . ? HOH A 472 . ? 1_555 ? 4 AC1 4 HOH F . ? HOH A 476 . ? 1_555 ? 5 AC2 4 ASP A 23 ? ASP A 21 . ? 1_555 ? 6 AC2 4 ASP A 59 ? ASP A 57 . ? 2_555 ? 7 AC2 4 GLU A 90 ? GLU A 88 . ? 3_455 ? 8 AC2 4 HOH F . ? HOH A 320 . ? 1_555 ? 9 AC3 4 ILE A 21 ? ILE A 19 . ? 1_555 ? 10 AC3 4 GLY A 22 ? GLY A 20 . ? 1_555 ? 11 AC3 4 ASP A 23 ? ASP A 21 . ? 1_555 ? 12 AC3 4 LYS A 164 ? LYS A 162 . ? 1_555 ? 13 AC4 3 ASP A 59 ? ASP A 57 . ? 2_555 ? 14 AC4 3 ARG A 91 ? ARG A 89 . ? 3_455 ? 15 AC4 3 LYS A 164 ? LYS A 162 . ? 1_555 ? # _database_PDB_matrix.entry_id 4FRU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4FRU _atom_sites.fract_transf_matrix[1][1] 0.015413 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001403 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022691 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016578 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -1 -1 ALA ALA A . n A 1 2 MET 2 0 0 MET MET A . n A 1 3 ASP 3 1 1 ASP ASP A . n A 1 4 GLU 4 2 2 GLU GLU A . n A 1 5 LYS 5 3 3 LYS LYS A . n A 1 6 LYS 6 4 4 LYS LYS A . n A 1 7 LYS 7 5 5 LYS LYS A . n A 1 8 GLY 8 6 6 GLY GLY A . n A 1 9 PRO 9 7 7 PRO PRO A . n A 1 10 LYS 10 8 8 LYS LYS A . n A 1 11 VAL 11 9 9 VAL VAL A . n A 1 12 THR 12 10 10 THR THR A . n A 1 13 VAL 13 11 11 VAL VAL A . n A 1 14 LYS 14 12 12 LYS LYS A . n A 1 15 VAL 15 13 13 VAL VAL A . n A 1 16 TYR 16 14 14 TYR TYR A . n A 1 17 PHE 17 15 15 PHE PHE A . n A 1 18 ASP 18 16 16 ASP ASP A . n A 1 19 LEU 19 17 17 LEU LEU A . n A 1 20 ARG 20 18 18 ARG ARG A . n A 1 21 ILE 21 19 19 ILE ILE A . n A 1 22 GLY 22 20 20 GLY GLY A . n A 1 23 ASP 23 21 21 ASP ASP A . n A 1 24 GLU 24 22 22 GLU GLU A . n A 1 25 ASP 25 23 23 ASP ASP A . n A 1 26 ILE 26 24 24 ILE ILE A . n A 1 27 GLY 27 25 25 GLY GLY A . n A 1 28 ARG 28 26 26 ARG ARG A . n A 1 29 VAL 29 27 27 VAL VAL A . n A 1 30 VAL 30 28 28 VAL VAL A . n A 1 31 ILE 31 29 29 ILE ILE A . n A 1 32 GLY 32 30 30 GLY GLY A . n A 1 33 LEU 33 31 31 LEU LEU A . n A 1 34 PHE 34 32 32 PHE PHE A . n A 1 35 GLY 35 33 33 GLY GLY A . n A 1 36 LYS 36 34 34 LYS LYS A . n A 1 37 THR 37 35 35 THR THR A . n A 1 38 VAL 38 36 36 VAL VAL A . n A 1 39 PRO 39 37 37 PRO PRO A . n A 1 40 LYS 40 38 38 LYS LYS A . n A 1 41 THR 41 39 39 THR THR A . n A 1 42 VAL 42 40 40 VAL VAL A . n A 1 43 ASP 43 41 41 ASP ASP A . n A 1 44 ASN 44 42 42 ASN ASN A . n A 1 45 PHE 45 43 43 PHE PHE A . n A 1 46 VAL 46 44 44 VAL VAL A . n A 1 47 ALA 47 45 45 ALA ALA A . n A 1 48 LEU 48 46 46 LEU LEU A . n A 1 49 ALA 49 47 47 ALA ALA A . n A 1 50 THR 50 48 48 THR THR A . n A 1 51 GLY 51 49 49 GLY GLY A . n A 1 52 GLU 52 50 50 GLU GLU A . n A 1 53 LYS 53 51 51 LYS LYS A . n A 1 54 GLY 54 52 52 GLY GLY A . n A 1 55 PHE 55 53 53 PHE PHE A . n A 1 56 GLY 56 54 54 GLY GLY A . n A 1 57 TYR 57 55 55 TYR TYR A . n A 1 58 LYS 58 56 56 LYS LYS A . n A 1 59 ASP 59 57 57 ASP ASP A . n A 1 60 SER 60 58 58 SER SER A . n A 1 61 LYS 61 59 59 LYS LYS A . n A 1 62 PHE 62 60 60 PHE PHE A . n A 1 63 HIS 63 61 61 HIS HIS A . n A 1 64 ARG 64 62 62 ARG ARG A . n A 1 65 VAL 65 63 63 VAL VAL A . n A 1 66 ILE 66 64 64 ILE ILE A . n A 1 67 LYS 67 65 65 LYS LYS A . n A 1 68 ASP 68 66 66 ASP ASP A . n A 1 69 PHE 69 67 67 PHE PHE A . n A 1 70 MET 70 68 68 MET MET A . n A 1 71 ILE 71 69 69 ILE ILE A . n A 1 72 GLN 72 70 70 GLN GLN A . n A 1 73 GLY 73 71 71 GLY GLY A . n A 1 74 GLY 74 72 72 GLY GLY A . n A 1 75 ASP 75 73 73 ASP ASP A . n A 1 76 PHE 76 74 74 PHE PHE A . n A 1 77 THR 77 75 75 THR THR A . n A 1 78 ARG 78 76 76 ARG ARG A . n A 1 79 GLY 79 77 77 GLY GLY A . n A 1 80 ASP 80 78 78 ASP ASP A . n A 1 81 GLY 81 79 79 GLY GLY A . n A 1 82 THR 82 80 80 THR THR A . n A 1 83 GLY 83 81 81 GLY GLY A . n A 1 84 GLY 84 82 82 GLY GLY A . n A 1 85 LYS 85 83 83 LYS LYS A . n A 1 86 SER 86 84 84 SER SER A . n A 1 87 ILE 87 85 85 ILE ILE A . n A 1 88 TYR 88 86 86 TYR TYR A . n A 1 89 GLY 89 87 87 GLY GLY A . n A 1 90 GLU 90 88 88 GLU GLU A . n A 1 91 ARG 91 89 89 ARG ARG A . n A 1 92 PHE 92 90 90 PHE PHE A . n A 1 93 PRO 93 91 91 PRO PRO A . n A 1 94 ASP 94 92 92 ASP ASP A . n A 1 95 GLU 95 93 93 GLU GLU A . n A 1 96 ASN 96 94 94 ASN ASN A . n A 1 97 PHE 97 95 95 PHE PHE A . n A 1 98 LYS 98 96 96 LYS LYS A . n A 1 99 LEU 99 97 97 LEU LEU A . n A 1 100 LYS 100 98 98 LYS LYS A . n A 1 101 HIS 101 99 99 HIS HIS A . n A 1 102 TYR 102 100 100 TYR TYR A . n A 1 103 GLY 103 101 101 GLY GLY A . n A 1 104 PRO 104 102 102 PRO PRO A . n A 1 105 GLY 105 103 103 GLY GLY A . n A 1 106 TRP 106 104 104 TRP TRP A . n A 1 107 VAL 107 105 105 VAL VAL A . n A 1 108 SER 108 106 106 SER SER A . n A 1 109 MET 109 107 107 MET MET A . n A 1 110 ALA 110 108 108 ALA ALA A . n A 1 111 ASN 111 109 109 ASN ASN A . n A 1 112 ALA 112 110 110 ALA ALA A . n A 1 113 GLY 113 111 111 GLY GLY A . n A 1 114 LYS 114 112 112 LYS LYS A . n A 1 115 ASP 115 113 113 ASP ASP A . n A 1 116 THR 116 114 114 THR THR A . n A 1 117 ASN 117 115 115 ASN ASN A . n A 1 118 GLY 118 116 116 GLY GLY A . n A 1 119 SER 119 117 117 SER SER A . n A 1 120 GLN 120 118 118 GLN GLN A . n A 1 121 PHE 121 119 119 PHE PHE A . n A 1 122 PHE 122 120 120 PHE PHE A . n A 1 123 ILE 123 121 121 ILE ILE A . n A 1 124 THR 124 122 122 THR THR A . n A 1 125 THR 125 123 123 THR THR A . n A 1 126 VAL 126 124 124 VAL VAL A . n A 1 127 LYS 127 125 125 LYS LYS A . n A 1 128 THR 128 126 126 THR THR A . n A 1 129 ALA 129 127 127 ALA ALA A . n A 1 130 TRP 130 128 128 TRP TRP A . n A 1 131 LEU 131 129 129 LEU LEU A . n A 1 132 ASP 132 130 130 ASP ASP A . n A 1 133 GLY 133 131 131 GLY GLY A . n A 1 134 LYS 134 132 132 LYS LYS A . n A 1 135 HIS 135 133 133 HIS HIS A . n A 1 136 VAL 136 134 134 VAL VAL A . n A 1 137 VAL 137 135 135 VAL VAL A . n A 1 138 PHE 138 136 136 PHE PHE A . n A 1 139 GLY 139 137 137 GLY GLY A . n A 1 140 LYS 140 138 138 LYS LYS A . n A 1 141 VAL 141 139 139 VAL VAL A . n A 1 142 LEU 142 140 140 LEU LEU A . n A 1 143 GLU 143 141 141 GLU GLU A . n A 1 144 GLY 144 142 142 GLY GLY A . n A 1 145 MET 145 143 143 MET MET A . n A 1 146 GLU 146 144 144 GLU GLU A . n A 1 147 VAL 147 145 145 VAL VAL A . n A 1 148 VAL 148 146 146 VAL VAL A . n A 1 149 ARG 149 147 147 ARG ARG A . n A 1 150 LYS 150 148 148 LYS LYS A . n A 1 151 VAL 151 149 149 VAL VAL A . n A 1 152 GLU 152 150 150 GLU GLU A . n A 1 153 THR 153 151 151 THR THR A . n A 1 154 THR 154 152 152 THR THR A . n A 1 155 LYS 155 153 153 LYS LYS A . n A 1 156 THR 156 154 154 THR THR A . n A 1 157 ASP 157 155 155 ASP ASP A . n A 1 158 GLY 158 156 156 GLY GLY A . n A 1 159 ARG 159 157 157 ARG ARG A . n A 1 160 ASP 160 158 158 ASP ASP A . n A 1 161 LYS 161 159 159 LYS LYS A . n A 1 162 PRO 162 160 160 PRO PRO A . n A 1 163 LEU 163 161 161 LEU LEU A . n A 1 164 LYS 164 162 162 LYS LYS A . n A 1 165 ASP 165 163 163 ASP ASP A . n A 1 166 VAL 166 164 164 VAL VAL A . n A 1 167 THR 167 165 165 THR THR A . n A 1 168 ILE 168 166 166 ILE ILE A . n A 1 169 ALA 169 167 167 ALA ALA A . n A 1 170 ASP 170 168 168 ASP ASP A . n A 1 171 CYS 171 169 169 CYS CYS A . n A 1 172 GLY 172 170 170 GLY GLY A . n A 1 173 LYS 173 171 171 LYS LYS A . n A 1 174 ILE 174 172 172 ILE ILE A . n A 1 175 GLU 175 173 173 GLU GLU A . n A 1 176 VAL 176 174 174 VAL VAL A . n A 1 177 GLU 177 175 175 GLU GLU A . n A 1 178 LYS 178 176 176 LYS LYS A . n A 1 179 PRO 179 177 177 PRO PRO A . n A 1 180 PHE 180 178 178 PHE PHE A . n A 1 181 ALA 181 179 179 ALA ALA A . n A 1 182 ILE 182 180 180 ILE ILE A . n A 1 183 ALA 183 181 181 ALA ALA A . n A 1 184 LYS 184 182 182 LYS LYS A . n A 1 185 GLU 185 183 183 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 1 ZN ZN A . C 2 ZN 1 202 2 ZN ZN A . D 3 ME2 1 203 1 ME2 PO7 A . E 4 PEG 1 204 1 PEG PO6 A . F 5 HOH 1 301 1 HOH HOH A . F 5 HOH 2 302 2 HOH HOH A . F 5 HOH 3 303 3 HOH HOH A . F 5 HOH 4 304 4 HOH HOH A . F 5 HOH 5 305 5 HOH HOH A . F 5 HOH 6 306 6 HOH HOH A . F 5 HOH 7 307 7 HOH HOH A . F 5 HOH 8 308 8 HOH HOH A . F 5 HOH 9 309 9 HOH HOH A . F 5 HOH 10 310 10 HOH HOH A . F 5 HOH 11 311 11 HOH HOH A . F 5 HOH 12 312 12 HOH HOH A . F 5 HOH 13 313 13 HOH HOH A . F 5 HOH 14 314 14 HOH HOH A . F 5 HOH 15 315 15 HOH HOH A . F 5 HOH 16 316 16 HOH HOH A . F 5 HOH 17 317 17 HOH HOH A . F 5 HOH 18 318 18 HOH HOH A . F 5 HOH 19 319 19 HOH HOH A . F 5 HOH 20 320 20 HOH HOH A . F 5 HOH 21 321 21 HOH HOH A . F 5 HOH 22 322 22 HOH HOH A . F 5 HOH 23 323 23 HOH HOH A . F 5 HOH 24 324 24 HOH HOH A . F 5 HOH 25 325 25 HOH HOH A . F 5 HOH 26 326 26 HOH HOH A . F 5 HOH 27 327 27 HOH HOH A . F 5 HOH 28 328 28 HOH HOH A . F 5 HOH 29 329 29 HOH HOH A . F 5 HOH 30 330 30 HOH HOH A . F 5 HOH 31 331 31 HOH HOH A . F 5 HOH 32 332 32 HOH HOH A . F 5 HOH 33 333 33 HOH HOH A . F 5 HOH 34 334 34 HOH HOH A . F 5 HOH 35 335 35 HOH HOH A . F 5 HOH 36 336 36 HOH HOH A . F 5 HOH 37 337 37 HOH HOH A . F 5 HOH 38 338 38 HOH HOH A . F 5 HOH 39 339 39 HOH HOH A . F 5 HOH 40 340 40 HOH HOH A . F 5 HOH 41 341 41 HOH HOH A . F 5 HOH 42 342 42 HOH HOH A . F 5 HOH 43 343 43 HOH HOH A . F 5 HOH 44 344 44 HOH HOH A . F 5 HOH 45 345 45 HOH HOH A . F 5 HOH 46 346 46 HOH HOH A . F 5 HOH 47 347 47 HOH HOH A . F 5 HOH 48 348 48 HOH HOH A . F 5 HOH 49 349 49 HOH HOH A . F 5 HOH 50 350 50 HOH HOH A . F 5 HOH 51 351 51 HOH HOH A . F 5 HOH 52 352 52 HOH HOH A . F 5 HOH 53 353 53 HOH HOH A . F 5 HOH 54 354 54 HOH HOH A . F 5 HOH 55 355 55 HOH HOH A . F 5 HOH 56 356 56 HOH HOH A . F 5 HOH 57 357 57 HOH HOH A . F 5 HOH 58 358 58 HOH HOH A . F 5 HOH 59 359 59 HOH HOH A . F 5 HOH 60 360 60 HOH HOH A . F 5 HOH 61 361 61 HOH HOH A . F 5 HOH 62 362 62 HOH HOH A . F 5 HOH 63 363 63 HOH HOH A . F 5 HOH 64 364 64 HOH HOH A . F 5 HOH 65 365 65 HOH HOH A . F 5 HOH 66 366 66 HOH HOH A . F 5 HOH 67 367 67 HOH HOH A . F 5 HOH 68 368 68 HOH HOH A . F 5 HOH 69 369 69 HOH HOH A . F 5 HOH 70 370 70 HOH HOH A . F 5 HOH 71 371 71 HOH HOH A . F 5 HOH 72 372 72 HOH HOH A . F 5 HOH 73 373 73 HOH HOH A . F 5 HOH 74 374 74 HOH HOH A . F 5 HOH 75 375 75 HOH HOH A . F 5 HOH 76 376 76 HOH HOH A . F 5 HOH 77 377 77 HOH HOH A . F 5 HOH 78 378 78 HOH HOH A . F 5 HOH 79 379 79 HOH HOH A . F 5 HOH 80 380 80 HOH HOH A . F 5 HOH 81 381 81 HOH HOH A . F 5 HOH 82 382 82 HOH HOH A . F 5 HOH 83 383 83 HOH HOH A . F 5 HOH 84 384 84 HOH HOH A . F 5 HOH 85 385 85 HOH HOH A . F 5 HOH 86 386 86 HOH HOH A . F 5 HOH 87 387 87 HOH HOH A . F 5 HOH 88 388 88 HOH HOH A . F 5 HOH 89 389 89 HOH HOH A . F 5 HOH 90 390 90 HOH HOH A . F 5 HOH 91 391 91 HOH HOH A . F 5 HOH 92 392 92 HOH HOH A . F 5 HOH 93 393 93 HOH HOH A . F 5 HOH 94 394 94 HOH HOH A . F 5 HOH 95 395 95 HOH HOH A . F 5 HOH 96 396 96 HOH HOH A . F 5 HOH 97 397 97 HOH HOH A . F 5 HOH 98 398 98 HOH HOH A . F 5 HOH 99 399 99 HOH HOH A . F 5 HOH 100 400 100 HOH HOH A . F 5 HOH 101 401 101 HOH HOH A . F 5 HOH 102 402 102 HOH HOH A . F 5 HOH 103 403 103 HOH HOH A . F 5 HOH 104 404 104 HOH HOH A . F 5 HOH 105 405 105 HOH HOH A . F 5 HOH 106 406 106 HOH HOH A . F 5 HOH 107 407 107 HOH HOH A . F 5 HOH 108 408 108 HOH HOH A . F 5 HOH 109 409 109 HOH HOH A . F 5 HOH 110 410 110 HOH HOH A . F 5 HOH 111 411 111 HOH HOH A . F 5 HOH 112 412 112 HOH HOH A . F 5 HOH 113 413 113 HOH HOH A . F 5 HOH 114 414 114 HOH HOH A . F 5 HOH 115 415 115 HOH HOH A . F 5 HOH 116 416 116 HOH HOH A . F 5 HOH 117 417 117 HOH HOH A . F 5 HOH 118 418 118 HOH HOH A . F 5 HOH 119 419 119 HOH HOH A . F 5 HOH 120 420 120 HOH HOH A . F 5 HOH 121 421 121 HOH HOH A . F 5 HOH 122 422 122 HOH HOH A . F 5 HOH 123 423 123 HOH HOH A . F 5 HOH 124 424 124 HOH HOH A . F 5 HOH 125 425 125 HOH HOH A . F 5 HOH 126 426 126 HOH HOH A . F 5 HOH 127 427 127 HOH HOH A . F 5 HOH 128 428 128 HOH HOH A . F 5 HOH 129 429 129 HOH HOH A . F 5 HOH 130 430 130 HOH HOH A . F 5 HOH 131 431 131 HOH HOH A . F 5 HOH 132 432 132 HOH HOH A . F 5 HOH 133 433 133 HOH HOH A . F 5 HOH 134 434 134 HOH HOH A . F 5 HOH 135 435 135 HOH HOH A . F 5 HOH 136 436 136 HOH HOH A . F 5 HOH 137 437 137 HOH HOH A . F 5 HOH 138 438 138 HOH HOH A . F 5 HOH 139 439 139 HOH HOH A . F 5 HOH 140 440 140 HOH HOH A . F 5 HOH 141 441 141 HOH HOH A . F 5 HOH 142 442 142 HOH HOH A . F 5 HOH 143 443 143 HOH HOH A . F 5 HOH 144 444 144 HOH HOH A . F 5 HOH 145 445 145 HOH HOH A . F 5 HOH 146 446 146 HOH HOH A . F 5 HOH 147 447 147 HOH HOH A . F 5 HOH 148 448 148 HOH HOH A . F 5 HOH 149 449 149 HOH HOH A . F 5 HOH 150 450 150 HOH HOH A . F 5 HOH 151 451 151 HOH HOH A . F 5 HOH 152 452 152 HOH HOH A . F 5 HOH 153 453 153 HOH HOH A . F 5 HOH 154 454 154 HOH HOH A . F 5 HOH 155 455 155 HOH HOH A . F 5 HOH 156 456 156 HOH HOH A . F 5 HOH 157 457 157 HOH HOH A . F 5 HOH 158 458 158 HOH HOH A . F 5 HOH 159 459 159 HOH HOH A . F 5 HOH 160 460 160 HOH HOH A . F 5 HOH 161 461 161 HOH HOH A . F 5 HOH 162 462 162 HOH HOH A . F 5 HOH 163 463 163 HOH HOH A . F 5 HOH 164 464 164 HOH HOH A . F 5 HOH 165 465 165 HOH HOH A . F 5 HOH 166 466 166 HOH HOH A . F 5 HOH 167 467 167 HOH HOH A . F 5 HOH 168 468 168 HOH HOH A . F 5 HOH 169 469 169 HOH HOH A . F 5 HOH 170 470 170 HOH HOH A . F 5 HOH 171 471 171 HOH HOH A . F 5 HOH 172 472 172 HOH HOH A . F 5 HOH 173 473 173 HOH HOH A . F 5 HOH 174 474 174 HOH HOH A . F 5 HOH 175 475 175 HOH HOH A . F 5 HOH 176 476 176 HOH HOH A . F 5 HOH 177 477 177 HOH HOH A . F 5 HOH 178 478 178 HOH HOH A . F 5 HOH 179 479 179 HOH HOH A . F 5 HOH 180 480 180 HOH HOH A . F 5 HOH 181 481 181 HOH HOH A . F 5 HOH 182 482 182 HOH HOH A . F 5 HOH 183 483 183 HOH HOH A . F 5 HOH 184 484 184 HOH HOH A . F 5 HOH 185 485 185 HOH HOH A . F 5 HOH 186 486 186 HOH HOH A . F 5 HOH 187 487 187 HOH HOH A . F 5 HOH 188 488 188 HOH HOH A . F 5 HOH 189 489 189 HOH HOH A . F 5 HOH 190 490 190 HOH HOH A . F 5 HOH 191 491 191 HOH HOH A . F 5 HOH 192 492 192 HOH HOH A . F 5 HOH 193 493 193 HOH HOH A . F 5 HOH 194 494 194 HOH HOH A . F 5 HOH 195 495 195 HOH HOH A . F 5 HOH 196 496 196 HOH HOH A . F 5 HOH 197 497 197 HOH HOH A . F 5 HOH 198 498 198 HOH HOH A . F 5 HOH 199 499 199 HOH HOH A . F 5 HOH 200 500 200 HOH HOH A . F 5 HOH 201 501 201 HOH HOH A . F 5 HOH 202 502 202 HOH HOH A . F 5 HOH 203 503 203 HOH HOH A . F 5 HOH 204 504 204 HOH HOH A . F 5 HOH 205 505 205 HOH HOH A . F 5 HOH 206 506 206 HOH HOH A . F 5 HOH 207 507 207 HOH HOH A . F 5 HOH 208 508 208 HOH HOH A . F 5 HOH 209 509 209 HOH HOH A . F 5 HOH 210 510 210 HOH HOH A . F 5 HOH 211 511 211 HOH HOH A . F 5 HOH 212 512 212 HOH HOH A . F 5 HOH 213 513 213 HOH HOH A . F 5 HOH 214 514 214 HOH HOH A . F 5 HOH 215 515 215 HOH HOH A . F 5 HOH 216 516 216 HOH HOH A . F 5 HOH 217 517 217 HOH HOH A . F 5 HOH 218 518 218 HOH HOH A . F 5 HOH 219 519 220 HOH HOH A . F 5 HOH 220 520 221 HOH HOH A . F 5 HOH 221 521 222 HOH HOH A . F 5 HOH 222 522 223 HOH HOH A . F 5 HOH 223 523 224 HOH HOH A . F 5 HOH 224 524 225 HOH HOH A . F 5 HOH 225 525 226 HOH HOH A . F 5 HOH 226 526 227 HOH HOH A . F 5 HOH 227 527 228 HOH HOH A . F 5 HOH 228 528 229 HOH HOH A . F 5 HOH 229 529 230 HOH HOH A . F 5 HOH 230 530 231 HOH HOH A . F 5 HOH 231 531 232 HOH HOH A . F 5 HOH 232 532 233 HOH HOH A . F 5 HOH 233 533 234 HOH HOH A . F 5 HOH 234 534 235 HOH HOH A . F 5 HOH 235 535 236 HOH HOH A . F 5 HOH 236 536 237 HOH HOH A . F 5 HOH 237 537 238 HOH HOH A . F 5 HOH 238 538 239 HOH HOH A . F 5 HOH 239 539 240 HOH HOH A . F 5 HOH 240 540 241 HOH HOH A . F 5 HOH 241 541 242 HOH HOH A . F 5 HOH 242 542 243 HOH HOH A . F 5 HOH 243 543 244 HOH HOH A . F 5 HOH 244 544 245 HOH HOH A . F 5 HOH 245 545 246 HOH HOH A . F 5 HOH 246 546 247 HOH HOH A . F 5 HOH 247 547 248 HOH HOH A . F 5 HOH 248 548 249 HOH HOH A . F 5 HOH 249 549 250 HOH HOH A . F 5 HOH 250 550 251 HOH HOH A . F 5 HOH 251 551 252 HOH HOH A . F 5 HOH 252 552 253 HOH HOH A . F 5 HOH 253 553 254 HOH HOH A . F 5 HOH 254 554 554 HOH HOH A . F 5 HOH 255 555 256 HOH HOH A . F 5 HOH 256 556 257 HOH HOH A . F 5 HOH 257 557 258 HOH HOH A . F 5 HOH 258 558 259 HOH HOH A . F 5 HOH 259 559 260 HOH HOH A . F 5 HOH 260 560 261 HOH HOH A . F 5 HOH 261 561 262 HOH HOH A . F 5 HOH 262 562 263 HOH HOH A . F 5 HOH 263 563 264 HOH HOH A . F 5 HOH 264 564 265 HOH HOH A . F 5 HOH 265 565 266 HOH HOH A . F 5 HOH 266 566 267 HOH HOH A . F 5 HOH 267 567 268 HOH HOH A . F 5 HOH 268 568 269 HOH HOH A . F 5 HOH 269 569 270 HOH HOH A . F 5 HOH 270 570 271 HOH HOH A . F 5 HOH 271 571 272 HOH HOH A . F 5 HOH 272 572 273 HOH HOH A . F 5 HOH 273 573 274 HOH HOH A . F 5 HOH 274 574 275 HOH HOH A . F 5 HOH 275 575 276 HOH HOH A . F 5 HOH 276 576 277 HOH HOH A . F 5 HOH 277 577 278 HOH HOH A . F 5 HOH 278 578 279 HOH HOH A . F 5 HOH 279 579 280 HOH HOH A . F 5 HOH 280 580 281 HOH HOH A . F 5 HOH 281 581 282 HOH HOH A . F 5 HOH 282 582 283 HOH HOH A . F 5 HOH 283 583 284 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 492 ? F HOH . 2 1 A HOH 554 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 23 ? A ASP 21 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O ? F HOH . ? A HOH 320 ? 1_555 97.6 ? 2 NE2 ? A HIS 135 ? A HIS 133 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? F HOH . ? A HOH 472 ? 1_555 110.9 ? 3 NE2 ? A HIS 135 ? A HIS 133 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? F HOH . ? A HOH 476 ? 1_555 91.8 ? 4 O ? F HOH . ? A HOH 472 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? F HOH . ? A HOH 476 ? 1_555 83.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-11-14 2 'Structure model' 1 1 2013-01-09 3 'Structure model' 1 2 2013-03-13 4 'Structure model' 1 3 2017-11-15 5 'Structure model' 1 4 2023-09-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' chem_comp_atom 3 5 'Structure model' chem_comp_bond 4 5 'Structure model' database_2 5 5 'Structure model' pdbx_initial_refinement_model 6 5 'Structure model' pdbx_struct_conn_angle 7 5 'Structure model' struct_conn 8 5 'Structure model' struct_ref_seq_dif 9 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.value' 16 5 'Structure model' '_struct_conn.pdbx_dist_value' 17 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 5 'Structure model' '_struct_ref_seq_dif.details' 29 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 PHENIX refinement '(phenix.refine: 1.8_1069)' ? 2 MOSFLM 'data reduction' . ? 3 SCALA 'data scaling' . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ1 A LYS 59 ? A O A HOH 486 ? ? 1.58 2 1 O A HOH 487 ? ? O A HOH 540 ? ? 1.98 3 1 O A HOH 491 ? ? O A HOH 537 ? ? 2.06 4 1 O A HOH 550 ? ? O A HOH 563 ? ? 2.08 5 1 O A HOH 455 ? ? O A HOH 456 ? ? 2.08 6 1 O A HOH 523 ? ? O A HOH 538 ? ? 2.10 7 1 O A HOH 482 ? ? O A HOH 520 ? ? 2.15 8 1 O A HOH 523 ? ? O A HOH 553 ? ? 2.17 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 526 ? ? 1_555 O A HOH 526 ? ? 2_656 1.84 2 1 O A HOH 540 ? ? 1_555 O A HOH 545 ? ? 2_656 1.97 3 1 O A HOH 483 ? ? 1_555 O A HOH 485 ? ? 3_545 2.05 4 1 O A HOH 540 ? ? 1_555 O A HOH 555 ? ? 3_555 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 67 ? ? -142.77 -74.72 2 1 PHE A 136 ? ? -140.75 -2.53 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 3 ? CG ? A LYS 5 CG 2 1 Y 1 A LYS 3 ? CD ? A LYS 5 CD 3 1 Y 1 A LYS 3 ? CE ? A LYS 5 CE 4 1 Y 1 A LYS 3 ? NZ ? A LYS 5 NZ 5 1 Y 1 A LYS 4 ? CE ? A LYS 6 CE 6 1 Y 1 A LYS 4 ? NZ ? A LYS 6 NZ 7 1 Y 1 A LYS 34 ? CE ? A LYS 36 CE 8 1 Y 1 A LYS 34 ? NZ ? A LYS 36 NZ 9 1 Y 1 A ARG 157 ? NE ? A ARG 159 NE 10 1 Y 1 A ARG 157 ? CZ ? A ARG 159 CZ 11 1 Y 1 A ARG 157 ? NH1 ? A ARG 159 NH1 12 1 Y 1 A ARG 157 ? NH2 ? A ARG 159 NH2 13 1 N 1 A PEG 204 ? O1 ? E PEG 1 O1 14 1 N 1 A PEG 204 ? O4 ? E PEG 1 O4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 ME2 C7 C N N 230 ME2 C6 C N N 231 ME2 O3 O N N 232 ME2 C5 C N N 233 ME2 C4 C N N 234 ME2 O2 O N N 235 ME2 C3 C N N 236 ME2 C2 C N N 237 ME2 O1 O N N 238 ME2 C1 C N N 239 ME2 H71 H N N 240 ME2 H72 H N N 241 ME2 H73 H N N 242 ME2 H61 H N N 243 ME2 H62 H N N 244 ME2 H51 H N N 245 ME2 H52 H N N 246 ME2 H41 H N N 247 ME2 H42 H N N 248 ME2 H31 H N N 249 ME2 H32 H N N 250 ME2 H21 H N N 251 ME2 H22 H N N 252 ME2 H11 H N N 253 ME2 H12 H N N 254 ME2 H13 H N N 255 MET N N N N 256 MET CA C N S 257 MET C C N N 258 MET O O N N 259 MET CB C N N 260 MET CG C N N 261 MET SD S N N 262 MET CE C N N 263 MET OXT O N N 264 MET H H N N 265 MET H2 H N N 266 MET HA H N N 267 MET HB2 H N N 268 MET HB3 H N N 269 MET HG2 H N N 270 MET HG3 H N N 271 MET HE1 H N N 272 MET HE2 H N N 273 MET HE3 H N N 274 MET HXT H N N 275 PEG C1 C N N 276 PEG O1 O N N 277 PEG C2 C N N 278 PEG O2 O N N 279 PEG C3 C N N 280 PEG C4 C N N 281 PEG O4 O N N 282 PEG H11 H N N 283 PEG H12 H N N 284 PEG HO1 H N N 285 PEG H21 H N N 286 PEG H22 H N N 287 PEG H31 H N N 288 PEG H32 H N N 289 PEG H41 H N N 290 PEG H42 H N N 291 PEG HO4 H N N 292 PHE N N N N 293 PHE CA C N S 294 PHE C C N N 295 PHE O O N N 296 PHE CB C N N 297 PHE CG C Y N 298 PHE CD1 C Y N 299 PHE CD2 C Y N 300 PHE CE1 C Y N 301 PHE CE2 C Y N 302 PHE CZ C Y N 303 PHE OXT O N N 304 PHE H H N N 305 PHE H2 H N N 306 PHE HA H N N 307 PHE HB2 H N N 308 PHE HB3 H N N 309 PHE HD1 H N N 310 PHE HD2 H N N 311 PHE HE1 H N N 312 PHE HE2 H N N 313 PHE HZ H N N 314 PHE HXT H N N 315 PRO N N N N 316 PRO CA C N S 317 PRO C C N N 318 PRO O O N N 319 PRO CB C N N 320 PRO CG C N N 321 PRO CD C N N 322 PRO OXT O N N 323 PRO H H N N 324 PRO HA H N N 325 PRO HB2 H N N 326 PRO HB3 H N N 327 PRO HG2 H N N 328 PRO HG3 H N N 329 PRO HD2 H N N 330 PRO HD3 H N N 331 PRO HXT H N N 332 SER N N N N 333 SER CA C N S 334 SER C C N N 335 SER O O N N 336 SER CB C N N 337 SER OG O N N 338 SER OXT O N N 339 SER H H N N 340 SER H2 H N N 341 SER HA H N N 342 SER HB2 H N N 343 SER HB3 H N N 344 SER HG H N N 345 SER HXT H N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TRP N N N N 364 TRP CA C N S 365 TRP C C N N 366 TRP O O N N 367 TRP CB C N N 368 TRP CG C Y N 369 TRP CD1 C Y N 370 TRP CD2 C Y N 371 TRP NE1 N Y N 372 TRP CE2 C Y N 373 TRP CE3 C Y N 374 TRP CZ2 C Y N 375 TRP CZ3 C Y N 376 TRP CH2 C Y N 377 TRP OXT O N N 378 TRP H H N N 379 TRP H2 H N N 380 TRP HA H N N 381 TRP HB2 H N N 382 TRP HB3 H N N 383 TRP HD1 H N N 384 TRP HE1 H N N 385 TRP HE3 H N N 386 TRP HZ2 H N N 387 TRP HZ3 H N N 388 TRP HH2 H N N 389 TRP HXT H N N 390 TYR N N N N 391 TYR CA C N S 392 TYR C C N N 393 TYR O O N N 394 TYR CB C N N 395 TYR CG C Y N 396 TYR CD1 C Y N 397 TYR CD2 C Y N 398 TYR CE1 C Y N 399 TYR CE2 C Y N 400 TYR CZ C Y N 401 TYR OH O N N 402 TYR OXT O N N 403 TYR H H N N 404 TYR H2 H N N 405 TYR HA H N N 406 TYR HB2 H N N 407 TYR HB3 H N N 408 TYR HD1 H N N 409 TYR HD2 H N N 410 TYR HE1 H N N 411 TYR HE2 H N N 412 TYR HH H N N 413 TYR HXT H N N 414 VAL N N N N 415 VAL CA C N S 416 VAL C C N N 417 VAL O O N N 418 VAL CB C N N 419 VAL CG1 C N N 420 VAL CG2 C N N 421 VAL OXT O N N 422 VAL H H N N 423 VAL H2 H N N 424 VAL HA H N N 425 VAL HB H N N 426 VAL HG11 H N N 427 VAL HG12 H N N 428 VAL HG13 H N N 429 VAL HG21 H N N 430 VAL HG22 H N N 431 VAL HG23 H N N 432 VAL HXT H N N 433 ZN ZN ZN N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 ME2 C7 C6 sing N N 218 ME2 C7 H71 sing N N 219 ME2 C7 H72 sing N N 220 ME2 C7 H73 sing N N 221 ME2 C6 O3 sing N N 222 ME2 C6 H61 sing N N 223 ME2 C6 H62 sing N N 224 ME2 O3 C5 sing N N 225 ME2 C5 C4 sing N N 226 ME2 C5 H51 sing N N 227 ME2 C5 H52 sing N N 228 ME2 C4 O2 sing N N 229 ME2 C4 H41 sing N N 230 ME2 C4 H42 sing N N 231 ME2 O2 C3 sing N N 232 ME2 C3 C2 sing N N 233 ME2 C3 H31 sing N N 234 ME2 C3 H32 sing N N 235 ME2 C2 O1 sing N N 236 ME2 C2 H21 sing N N 237 ME2 C2 H22 sing N N 238 ME2 O1 C1 sing N N 239 ME2 C1 H11 sing N N 240 ME2 C1 H12 sing N N 241 ME2 C1 H13 sing N N 242 MET N CA sing N N 243 MET N H sing N N 244 MET N H2 sing N N 245 MET CA C sing N N 246 MET CA CB sing N N 247 MET CA HA sing N N 248 MET C O doub N N 249 MET C OXT sing N N 250 MET CB CG sing N N 251 MET CB HB2 sing N N 252 MET CB HB3 sing N N 253 MET CG SD sing N N 254 MET CG HG2 sing N N 255 MET CG HG3 sing N N 256 MET SD CE sing N N 257 MET CE HE1 sing N N 258 MET CE HE2 sing N N 259 MET CE HE3 sing N N 260 MET OXT HXT sing N N 261 PEG C1 O1 sing N N 262 PEG C1 C2 sing N N 263 PEG C1 H11 sing N N 264 PEG C1 H12 sing N N 265 PEG O1 HO1 sing N N 266 PEG C2 O2 sing N N 267 PEG C2 H21 sing N N 268 PEG C2 H22 sing N N 269 PEG O2 C3 sing N N 270 PEG C3 C4 sing N N 271 PEG C3 H31 sing N N 272 PEG C3 H32 sing N N 273 PEG C4 O4 sing N N 274 PEG C4 H41 sing N N 275 PEG C4 H42 sing N N 276 PEG O4 HO4 sing N N 277 PHE N CA sing N N 278 PHE N H sing N N 279 PHE N H2 sing N N 280 PHE CA C sing N N 281 PHE CA CB sing N N 282 PHE CA HA sing N N 283 PHE C O doub N N 284 PHE C OXT sing N N 285 PHE CB CG sing N N 286 PHE CB HB2 sing N N 287 PHE CB HB3 sing N N 288 PHE CG CD1 doub Y N 289 PHE CG CD2 sing Y N 290 PHE CD1 CE1 sing Y N 291 PHE CD1 HD1 sing N N 292 PHE CD2 CE2 doub Y N 293 PHE CD2 HD2 sing N N 294 PHE CE1 CZ doub Y N 295 PHE CE1 HE1 sing N N 296 PHE CE2 CZ sing Y N 297 PHE CE2 HE2 sing N N 298 PHE CZ HZ sing N N 299 PHE OXT HXT sing N N 300 PRO N CA sing N N 301 PRO N CD sing N N 302 PRO N H sing N N 303 PRO CA C sing N N 304 PRO CA CB sing N N 305 PRO CA HA sing N N 306 PRO C O doub N N 307 PRO C OXT sing N N 308 PRO CB CG sing N N 309 PRO CB HB2 sing N N 310 PRO CB HB3 sing N N 311 PRO CG CD sing N N 312 PRO CG HG2 sing N N 313 PRO CG HG3 sing N N 314 PRO CD HD2 sing N N 315 PRO CD HD3 sing N N 316 PRO OXT HXT sing N N 317 SER N CA sing N N 318 SER N H sing N N 319 SER N H2 sing N N 320 SER CA C sing N N 321 SER CA CB sing N N 322 SER CA HA sing N N 323 SER C O doub N N 324 SER C OXT sing N N 325 SER CB OG sing N N 326 SER CB HB2 sing N N 327 SER CB HB3 sing N N 328 SER OG HG sing N N 329 SER OXT HXT sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 '1-ETHOXY-2-(2-METHOXYETHOXY)ETHANE' ME2 4 'DI(HYDROXYETHYL)ETHER' PEG 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1CYN _pdbx_initial_refinement_model.details 'PDB ENTRY 1CYN' #