data_4FUX # _entry.id 4FUX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4FUX RCSB RCSB073386 WWPDB D_1000073386 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4FUY 'Crystal Structure of the ERK2 complexed with EK2' unspecified PDB 4FV0 'Crystal Structure of the ERK2 complexed with EK3' unspecified PDB 4FV1 'Crystal Structure of the ERK2 complexed with EK4' unspecified PDB 4FV2 'Crystal Structure of the ERK2 complexed with EK5' unspecified PDB 4FV3 'Crystal Structure of the ERK2 complexed with EK6' unspecified PDB 4FV4 'Crystal Structure of the ERK2 complexed with EK7' unspecified PDB 4FV5 'Crystal Structure of the ERK2 complexed with EK9' unspecified PDB 4FV6 'Crystal Structure of the ERK2 complexed with E57' unspecified PDB 4FV7 'Crystal Structure of the ERK2 complexed with E94' unspecified PDB 4FV8 'Crystal Structure of the ERK2 complexed with E63' unspecified PDB 4FV9 'Crystal Structure of the ERK2 complexed with E71' unspecified # _pdbx_database_status.entry_id 4FUX _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-06-28 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kang, Y.N.' 1 'Stuckey, J.A.' 2 'Xie, X.' 3 # _citation.id primary _citation.title 'Crystal Structure of the ERK2 complexed with E75' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kang, Y.N.' 1 primary 'Stuckey, J.A.' 2 primary 'Xie, X.' 3 # _cell.length_a 48.703 _cell.length_b 70.283 _cell.length_c 60.372 _cell.angle_alpha 90.000 _cell.angle_beta 109.090 _cell.angle_gamma 90.000 _cell.entry_id 4FUX _cell.pdbx_unique_axis ? _cell.Z_PDB 2 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.entry_id 4FUX _symmetry.Int_Tables_number 4 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase 1' 41520.773 1 2.7.11.24 ? ? ? 2 non-polymer syn 'trans-4-{[4-(5-methyl-3-phenyl-1,2-oxazol-4-yl)pyrimidin-2-yl]amino}cyclohexanol' 350.414 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 5 water nat water 18.015 160 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;MAP kinase 1, MAPK 1, ERT1, Extracellular signal-regulated kinase 2, ERK-2, MAP kinase isoform p42, p42-MAPK, Mitogen-activated protein kinase 2, MAP kinase 2, MAPK 2 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRH ENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT (CME)DLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQ LNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQY YDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS ; _entity_poly.pdbx_seq_one_letter_code_can ;MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRH ENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT CDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPS DEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 ALA n 1 5 ALA n 1 6 ALA n 1 7 ALA n 1 8 GLY n 1 9 ALA n 1 10 GLY n 1 11 PRO n 1 12 GLU n 1 13 MET n 1 14 VAL n 1 15 ARG n 1 16 GLY n 1 17 GLN n 1 18 VAL n 1 19 PHE n 1 20 ASP n 1 21 VAL n 1 22 GLY n 1 23 PRO n 1 24 ARG n 1 25 TYR n 1 26 THR n 1 27 ASN n 1 28 LEU n 1 29 SER n 1 30 TYR n 1 31 ILE n 1 32 GLY n 1 33 GLU n 1 34 GLY n 1 35 ALA n 1 36 TYR n 1 37 GLY n 1 38 MET n 1 39 VAL n 1 40 CYS n 1 41 SER n 1 42 ALA n 1 43 TYR n 1 44 ASP n 1 45 ASN n 1 46 VAL n 1 47 ASN n 1 48 LYS n 1 49 VAL n 1 50 ARG n 1 51 VAL n 1 52 ALA n 1 53 ILE n 1 54 LYS n 1 55 LYS n 1 56 ILE n 1 57 SER n 1 58 PRO n 1 59 PHE n 1 60 GLU n 1 61 HIS n 1 62 GLN n 1 63 THR n 1 64 TYR n 1 65 CYS n 1 66 GLN n 1 67 ARG n 1 68 THR n 1 69 LEU n 1 70 ARG n 1 71 GLU n 1 72 ILE n 1 73 LYS n 1 74 ILE n 1 75 LEU n 1 76 LEU n 1 77 ARG n 1 78 PHE n 1 79 ARG n 1 80 HIS n 1 81 GLU n 1 82 ASN n 1 83 ILE n 1 84 ILE n 1 85 GLY n 1 86 ILE n 1 87 ASN n 1 88 ASP n 1 89 ILE n 1 90 ILE n 1 91 ARG n 1 92 ALA n 1 93 PRO n 1 94 THR n 1 95 ILE n 1 96 GLU n 1 97 GLN n 1 98 MET n 1 99 LYS n 1 100 ASP n 1 101 VAL n 1 102 TYR n 1 103 ILE n 1 104 VAL n 1 105 GLN n 1 106 ASP n 1 107 LEU n 1 108 MET n 1 109 GLU n 1 110 THR n 1 111 ASP n 1 112 LEU n 1 113 TYR n 1 114 LYS n 1 115 LEU n 1 116 LEU n 1 117 LYS n 1 118 THR n 1 119 GLN n 1 120 HIS n 1 121 LEU n 1 122 SER n 1 123 ASN n 1 124 ASP n 1 125 HIS n 1 126 ILE n 1 127 CYS n 1 128 TYR n 1 129 PHE n 1 130 LEU n 1 131 TYR n 1 132 GLN n 1 133 ILE n 1 134 LEU n 1 135 ARG n 1 136 GLY n 1 137 LEU n 1 138 LYS n 1 139 TYR n 1 140 ILE n 1 141 HIS n 1 142 SER n 1 143 ALA n 1 144 ASN n 1 145 VAL n 1 146 LEU n 1 147 HIS n 1 148 ARG n 1 149 ASP n 1 150 LEU n 1 151 LYS n 1 152 PRO n 1 153 SER n 1 154 ASN n 1 155 LEU n 1 156 LEU n 1 157 LEU n 1 158 ASN n 1 159 THR n 1 160 THR n 1 161 CME n 1 162 ASP n 1 163 LEU n 1 164 LYS n 1 165 ILE n 1 166 CYS n 1 167 ASP n 1 168 PHE n 1 169 GLY n 1 170 LEU n 1 171 ALA n 1 172 ARG n 1 173 VAL n 1 174 ALA n 1 175 ASP n 1 176 PRO n 1 177 ASP n 1 178 HIS n 1 179 ASP n 1 180 HIS n 1 181 THR n 1 182 GLY n 1 183 PHE n 1 184 LEU n 1 185 THR n 1 186 GLU n 1 187 TYR n 1 188 VAL n 1 189 ALA n 1 190 THR n 1 191 ARG n 1 192 TRP n 1 193 TYR n 1 194 ARG n 1 195 ALA n 1 196 PRO n 1 197 GLU n 1 198 ILE n 1 199 MET n 1 200 LEU n 1 201 ASN n 1 202 SER n 1 203 LYS n 1 204 GLY n 1 205 TYR n 1 206 THR n 1 207 LYS n 1 208 SER n 1 209 ILE n 1 210 ASP n 1 211 ILE n 1 212 TRP n 1 213 SER n 1 214 VAL n 1 215 GLY n 1 216 CYS n 1 217 ILE n 1 218 LEU n 1 219 ALA n 1 220 GLU n 1 221 MET n 1 222 LEU n 1 223 SER n 1 224 ASN n 1 225 ARG n 1 226 PRO n 1 227 ILE n 1 228 PHE n 1 229 PRO n 1 230 GLY n 1 231 LYS n 1 232 HIS n 1 233 TYR n 1 234 LEU n 1 235 ASP n 1 236 GLN n 1 237 LEU n 1 238 ASN n 1 239 HIS n 1 240 ILE n 1 241 LEU n 1 242 GLY n 1 243 ILE n 1 244 LEU n 1 245 GLY n 1 246 SER n 1 247 PRO n 1 248 SER n 1 249 GLN n 1 250 GLU n 1 251 ASP n 1 252 LEU n 1 253 ASN n 1 254 CYS n 1 255 ILE n 1 256 ILE n 1 257 ASN n 1 258 LEU n 1 259 LYS n 1 260 ALA n 1 261 ARG n 1 262 ASN n 1 263 TYR n 1 264 LEU n 1 265 LEU n 1 266 SER n 1 267 LEU n 1 268 PRO n 1 269 HIS n 1 270 LYS n 1 271 ASN n 1 272 LYS n 1 273 VAL n 1 274 PRO n 1 275 TRP n 1 276 ASN n 1 277 ARG n 1 278 LEU n 1 279 PHE n 1 280 PRO n 1 281 ASN n 1 282 ALA n 1 283 ASP n 1 284 SER n 1 285 LYS n 1 286 ALA n 1 287 LEU n 1 288 ASP n 1 289 LEU n 1 290 LEU n 1 291 ASP n 1 292 LYS n 1 293 MET n 1 294 LEU n 1 295 THR n 1 296 PHE n 1 297 ASN n 1 298 PRO n 1 299 HIS n 1 300 LYS n 1 301 ARG n 1 302 ILE n 1 303 GLU n 1 304 VAL n 1 305 GLU n 1 306 GLN n 1 307 ALA n 1 308 LEU n 1 309 ALA n 1 310 HIS n 1 311 PRO n 1 312 TYR n 1 313 LEU n 1 314 GLU n 1 315 GLN n 1 316 TYR n 1 317 TYR n 1 318 ASP n 1 319 PRO n 1 320 SER n 1 321 ASP n 1 322 GLU n 1 323 PRO n 1 324 ILE n 1 325 ALA n 1 326 GLU n 1 327 ALA n 1 328 PRO n 1 329 PHE n 1 330 LYS n 1 331 PHE n 1 332 ASP n 1 333 MET n 1 334 GLU n 1 335 LEU n 1 336 ASP n 1 337 ASP n 1 338 LEU n 1 339 PRO n 1 340 LYS n 1 341 GLU n 1 342 LYS n 1 343 LEU n 1 344 LYS n 1 345 GLU n 1 346 LEU n 1 347 ILE n 1 348 PHE n 1 349 GLU n 1 350 GLU n 1 351 THR n 1 352 ALA n 1 353 ARG n 1 354 PHE n 1 355 GLN n 1 356 PRO n 1 357 GLY n 1 358 TYR n 1 359 ARG n 1 360 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ERK2, MAPK1, PRKM1, PRKM2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain human _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pT7Blue _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MK01_HUMAN _struct_ref.pdbx_db_accession P28482 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRH ENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT CDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPS DEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4FUX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 360 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P28482 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 360 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -1 _struct_ref_seq.pdbx_auth_seq_align_end 358 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' ? 'C5 H11 N O3 S2' 197.276 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 E75 non-polymer . 'trans-4-{[4-(5-methyl-3-phenyl-1,2-oxazol-4-yl)pyrimidin-2-yl]amino}cyclohexanol' ? 'C20 H22 N4 O2' 350.414 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4FUX _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.35 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 47.70 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.temp 298 _exptl_crystal_grow.pdbx_details ;100 mM MES buffer, pH 6.5, 26-28% PEG-MME 2000, 200 mM ammonium sulfate and 20 mM 2-mercaptoethanol, vapor diffusion, temperature 298K ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.entry_id 4FUX _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 55.000 _reflns.number_obs 18031 _reflns.pdbx_Rmerge_I_obs 0.033 _reflns.pdbx_netI_over_sigmaI 23.800 _reflns.pdbx_chi_squared 1.078 _reflns.percent_possible_obs 92.100 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.200 2.260 ? ? ? 0.088 ? ? 1.597 ? ? 1489 92.800 1 1 2.260 2.340 ? ? ? 0.075 ? ? 1.531 ? ? 1572 96.600 2 1 2.340 2.420 ? ? ? 0.061 ? ? 1.368 ? ? 1575 97.000 3 1 2.420 2.520 ? ? ? 0.055 ? ? 1.297 ? ? 1568 96.200 4 1 2.520 2.630 ? ? ? 0.047 ? ? 1.204 ? ? 1551 96.000 5 1 2.630 2.770 ? ? ? 0.043 ? ? 1.187 ? ? 1545 95.000 6 1 2.770 2.950 ? ? ? 0.042 ? ? 1.132 ? ? 1522 94.000 7 1 2.950 3.170 ? ? ? 0.033 ? ? 0.984 ? ? 1536 92.700 8 1 3.170 3.490 ? ? ? 0.028 ? ? 0.792 ? ? 1463 90.700 9 1 3.490 4.000 ? ? ? 0.027 ? ? 0.689 ? ? 1437 87.300 10 1 4.000 5.040 ? ? ? 0.026 ? ? 0.677 ? ? 1395 84.900 11 1 5.040 55.000 ? ? ? 0.029 ? ? 0.730 ? ? 1378 82.000 12 1 # _refine.entry_id 4FUX _refine.ls_d_res_high 2.2000 _refine.ls_d_res_low 23.33 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 90.7500 _refine.ls_number_reflns_obs 17830 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ? _refine.ls_R_factor_obs 0.1893 _refine.ls_R_factor_R_work 0.1874 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2230 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0800 _refine.ls_number_reflns_R_free 906 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 34.0422 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 2.4305 _refine.aniso_B[2][2] -3.9810 _refine.aniso_B[3][3] 1.5505 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 5.1042 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9287 _refine.correlation_coeff_Fo_to_Fc_free 0.9079 _refine.overall_SU_R_Cruickshank_DPI 0.3010 _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.solvent_model_details ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 117.190 _refine.B_iso_min 13.880 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.000 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.ls_R_factor_all ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 4FUX _refine_analyze.Luzzati_coordinate_error_obs 0.250 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2763 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.number_atoms_solvent 160 _refine_hist.number_atoms_total 2963 _refine_hist.d_res_high 2.2000 _refine_hist.d_res_low 23.33 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id t_dihedral_angle_d 1318 ? ? 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' t_trig_c_planes 68 ? ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_gen_planes 436 ? ? 5.000 HARMONIC 'X-RAY DIFFRACTION' t_it 2892 ? ? 20.000 HARMONIC 'X-RAY DIFFRACTION' t_nbd ? ? ? ? ? 'X-RAY DIFFRACTION' t_improper_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_pseud_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_chiral_improper_torsion 370 ? ? 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_sum_occupancies ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_distance ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_ideal_dist_contact 3480 ? ? 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_bond_d 2892 0.010 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_angle_deg 3941 0.990 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_omega_torsion ? 2.950 ? ? ? 'X-RAY DIFFRACTION' t_other_torsion ? 2.900 ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 2.2000 _refine_ls_shell.d_res_low 2.3300 _refine_ls_shell.pdbx_total_number_of_bins_used 9 _refine_ls_shell.percent_reflns_obs 90.7500 _refine_ls_shell.number_reflns_R_work 2677 _refine_ls_shell.R_factor_all 0.1916 _refine_ls_shell.R_factor_R_work 0.1896 _refine_ls_shell.R_factor_R_free 0.2292 _refine_ls_shell.percent_reflns_R_free 5.0000 _refine_ls_shell.number_reflns_R_free 141 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 2818 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4FUX _struct.title 'Crystal Structure of the ERK2 complexed with E75' _struct.pdbx_descriptor 'Mitogen-activated protein kinase 1 (E.C.2.7.11.24)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4FUX _struct_keywords.text TRANSFERASE _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 61 ? PHE A 78 ? HIS A 59 PHE A 76 1 ? 18 HELX_P HELX_P2 2 LEU A 112 ? GLN A 119 ? LEU A 110 GLN A 117 1 ? 8 HELX_P HELX_P3 3 SER A 122 ? ALA A 143 ? SER A 120 ALA A 141 1 ? 22 HELX_P HELX_P4 4 LYS A 151 ? SER A 153 ? LYS A 149 SER A 151 5 ? 3 HELX_P HELX_P5 5 ASP A 175 ? ASP A 179 ? ASP A 173 ASP A 177 5 ? 5 HELX_P HELX_P6 6 THR A 190 ? ARG A 194 ? THR A 188 ARG A 192 5 ? 5 HELX_P HELX_P7 7 ALA A 195 ? MET A 199 ? ALA A 193 MET A 197 5 ? 5 HELX_P HELX_P8 8 LYS A 207 ? ASN A 224 ? LYS A 205 ASN A 222 1 ? 18 HELX_P HELX_P9 9 LEU A 234 ? GLY A 245 ? LEU A 232 GLY A 243 1 ? 12 HELX_P HELX_P10 10 SER A 248 ? CYS A 254 ? SER A 246 CYS A 252 1 ? 7 HELX_P HELX_P11 11 ASN A 257 ? SER A 266 ? ASN A 255 SER A 264 1 ? 10 HELX_P HELX_P12 12 PRO A 274 ? PHE A 279 ? PRO A 272 PHE A 277 1 ? 6 HELX_P HELX_P13 13 ASP A 283 ? LEU A 294 ? ASP A 281 LEU A 292 1 ? 12 HELX_P HELX_P14 14 GLU A 303 ? ALA A 309 ? GLU A 301 ALA A 307 1 ? 7 HELX_P HELX_P15 15 HIS A 310 ? GLU A 314 ? HIS A 308 GLU A 312 5 ? 5 HELX_P HELX_P16 16 ASP A 318 ? GLU A 322 ? ASP A 316 GLU A 320 5 ? 5 HELX_P HELX_P17 17 PRO A 339 ? THR A 351 ? PRO A 337 THR A 349 1 ? 13 HELX_P HELX_P18 18 ALA A 352 ? GLN A 355 ? ALA A 350 GLN A 353 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A THR 160 C ? ? ? 1_555 A CME 161 N ? ? A THR 158 A CME 159 1_555 ? ? ? ? ? ? ? 1.326 ? covale2 covale ? ? A CME 161 C ? ? ? 1_555 A ASP 162 N ? ? A CME 159 A ASP 160 1_555 ? ? ? ? ? ? ? 1.350 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 5 ? C ? 3 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 13 ? VAL A 14 ? MET A 11 VAL A 12 A 2 GLN A 17 ? VAL A 18 ? GLN A 15 VAL A 16 B 1 TYR A 25 ? GLU A 33 ? TYR A 23 GLU A 31 B 2 MET A 38 ? ASP A 44 ? MET A 36 ASP A 42 B 3 VAL A 49 ? ILE A 56 ? VAL A 47 ILE A 54 B 4 VAL A 101 ? ASP A 106 ? VAL A 99 ASP A 104 B 5 ASP A 88 ? ILE A 90 ? ASP A 86 ILE A 88 C 1 THR A 110 ? ASP A 111 ? THR A 108 ASP A 109 C 2 LEU A 155 ? LEU A 157 ? LEU A 153 LEU A 155 C 3 LEU A 163 ? ILE A 165 ? LEU A 161 ILE A 163 D 1 VAL A 145 ? LEU A 146 ? VAL A 143 LEU A 144 D 2 ARG A 172 ? VAL A 173 ? ARG A 170 VAL A 171 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 14 ? N VAL A 12 O GLN A 17 ? O GLN A 15 B 1 2 N THR A 26 ? N THR A 24 O TYR A 43 ? O TYR A 41 B 2 3 N ALA A 42 ? N ALA A 40 O VAL A 51 ? O VAL A 49 B 3 4 N ILE A 56 ? N ILE A 54 O VAL A 101 ? O VAL A 99 B 4 5 O VAL A 104 ? O VAL A 102 N ASP A 88 ? N ASP A 86 C 1 2 N THR A 110 ? N THR A 108 O LEU A 157 ? O LEU A 155 C 2 3 N LEU A 156 ? N LEU A 154 O LYS A 164 ? O LYS A 162 D 1 2 N LEU A 146 ? N LEU A 144 O ARG A 172 ? O ARG A 170 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE E75 A 401' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 402' AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 403' AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE EDO A 404' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 ILE A 31 ? ILE A 29 . ? 1_555 ? 2 AC1 12 VAL A 39 ? VAL A 37 . ? 1_555 ? 3 AC1 12 ALA A 52 ? ALA A 50 . ? 1_555 ? 4 AC1 12 LYS A 54 ? LYS A 52 . ? 1_555 ? 5 AC1 12 ILE A 103 ? ILE A 101 . ? 1_555 ? 6 AC1 12 GLN A 105 ? GLN A 103 . ? 1_555 ? 7 AC1 12 ASP A 106 ? ASP A 104 . ? 1_555 ? 8 AC1 12 MET A 108 ? MET A 106 . ? 1_555 ? 9 AC1 12 GLU A 109 ? GLU A 107 . ? 1_555 ? 10 AC1 12 THR A 110 ? THR A 108 . ? 1_555 ? 11 AC1 12 LEU A 156 ? LEU A 154 . ? 1_555 ? 12 AC1 12 HOH F . ? HOH A 657 . ? 1_555 ? 13 AC2 4 ARG A 191 ? ARG A 189 . ? 1_555 ? 14 AC2 4 ARG A 194 ? ARG A 192 . ? 1_555 ? 15 AC2 4 TYR A 233 ? TYR A 231 . ? 1_555 ? 16 AC2 4 HOH F . ? HOH A 546 . ? 1_555 ? 17 AC3 5 TYR A 113 ? TYR A 111 . ? 1_555 ? 18 AC3 5 LYS A 151 ? LYS A 149 . ? 1_555 ? 19 AC3 5 SER A 153 ? SER A 151 . ? 1_555 ? 20 AC3 5 HOH F . ? HOH A 551 . ? 1_555 ? 21 AC3 5 HOH F . ? HOH A 614 . ? 1_555 ? 22 AC4 2 LYS A 292 ? LYS A 290 . ? 1_555 ? 23 AC4 2 ILE A 302 ? ILE A 300 . ? 1_555 ? # _atom_sites.entry_id 4FUX _atom_sites.fract_transf_matrix[1][1] 0.020533 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007106 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014228 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017528 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -1 ? ? ? A . n A 1 2 ALA 2 0 ? ? ? A . n A 1 3 ALA 3 1 ? ? ? A . n A 1 4 ALA 4 2 ? ? ? A . n A 1 5 ALA 5 3 ? ? ? A . n A 1 6 ALA 6 4 ? ? ? A . n A 1 7 ALA 7 5 ? ? ? A . n A 1 8 GLY 8 6 ? ? ? A . n A 1 9 ALA 9 7 ? ? ? A . n A 1 10 GLY 10 8 ? ? ? A . n A 1 11 PRO 11 9 9 PRO PRO A . n A 1 12 GLU 12 10 10 GLU GLU A . n A 1 13 MET 13 11 11 MET MET A . n A 1 14 VAL 14 12 12 VAL VAL A . n A 1 15 ARG 15 13 13 ARG ARG A . n A 1 16 GLY 16 14 14 GLY GLY A . n A 1 17 GLN 17 15 15 GLN GLN A . n A 1 18 VAL 18 16 16 VAL VAL A . n A 1 19 PHE 19 17 17 PHE PHE A . n A 1 20 ASP 20 18 18 ASP ASP A . n A 1 21 VAL 21 19 19 VAL VAL A . n A 1 22 GLY 22 20 20 GLY GLY A . n A 1 23 PRO 23 21 21 PRO PRO A . n A 1 24 ARG 24 22 22 ARG ARG A . n A 1 25 TYR 25 23 23 TYR TYR A . n A 1 26 THR 26 24 24 THR THR A . n A 1 27 ASN 27 25 25 ASN ASN A . n A 1 28 LEU 28 26 26 LEU LEU A . n A 1 29 SER 29 27 27 SER SER A . n A 1 30 TYR 30 28 28 TYR TYR A . n A 1 31 ILE 31 29 29 ILE ILE A . n A 1 32 GLY 32 30 30 GLY GLY A . n A 1 33 GLU 33 31 31 GLU GLU A . n A 1 34 GLY 34 32 32 GLY GLY A . n A 1 35 ALA 35 33 33 ALA ALA A . n A 1 36 TYR 36 34 34 TYR TYR A . n A 1 37 GLY 37 35 35 GLY GLY A . n A 1 38 MET 38 36 36 MET MET A . n A 1 39 VAL 39 37 37 VAL VAL A . n A 1 40 CYS 40 38 38 CYS CYS A . n A 1 41 SER 41 39 39 SER SER A . n A 1 42 ALA 42 40 40 ALA ALA A . n A 1 43 TYR 43 41 41 TYR TYR A . n A 1 44 ASP 44 42 42 ASP ASP A . n A 1 45 ASN 45 43 43 ASN ASN A . n A 1 46 VAL 46 44 44 VAL VAL A . n A 1 47 ASN 47 45 45 ASN ASN A . n A 1 48 LYS 48 46 46 LYS LYS A . n A 1 49 VAL 49 47 47 VAL VAL A . n A 1 50 ARG 50 48 48 ARG ARG A . n A 1 51 VAL 51 49 49 VAL VAL A . n A 1 52 ALA 52 50 50 ALA ALA A . n A 1 53 ILE 53 51 51 ILE ILE A . n A 1 54 LYS 54 52 52 LYS LYS A . n A 1 55 LYS 55 53 53 LYS LYS A . n A 1 56 ILE 56 54 54 ILE ILE A . n A 1 57 SER 57 55 55 SER SER A . n A 1 58 PRO 58 56 56 PRO PRO A . n A 1 59 PHE 59 57 57 PHE PHE A . n A 1 60 GLU 60 58 58 GLU GLU A . n A 1 61 HIS 61 59 59 HIS HIS A . n A 1 62 GLN 62 60 60 GLN GLN A . n A 1 63 THR 63 61 61 THR THR A . n A 1 64 TYR 64 62 62 TYR TYR A . n A 1 65 CYS 65 63 63 CYS CYS A . n A 1 66 GLN 66 64 64 GLN GLN A . n A 1 67 ARG 67 65 65 ARG ARG A . n A 1 68 THR 68 66 66 THR THR A . n A 1 69 LEU 69 67 67 LEU LEU A . n A 1 70 ARG 70 68 68 ARG ARG A . n A 1 71 GLU 71 69 69 GLU GLU A . n A 1 72 ILE 72 70 70 ILE ILE A . n A 1 73 LYS 73 71 71 LYS LYS A . n A 1 74 ILE 74 72 72 ILE ILE A . n A 1 75 LEU 75 73 73 LEU LEU A . n A 1 76 LEU 76 74 74 LEU LEU A . n A 1 77 ARG 77 75 75 ARG ARG A . n A 1 78 PHE 78 76 76 PHE PHE A . n A 1 79 ARG 79 77 77 ARG ARG A . n A 1 80 HIS 80 78 78 HIS HIS A . n A 1 81 GLU 81 79 79 GLU GLU A . n A 1 82 ASN 82 80 80 ASN ASN A . n A 1 83 ILE 83 81 81 ILE ILE A . n A 1 84 ILE 84 82 82 ILE ILE A . n A 1 85 GLY 85 83 83 GLY GLY A . n A 1 86 ILE 86 84 84 ILE ILE A . n A 1 87 ASN 87 85 85 ASN ASN A . n A 1 88 ASP 88 86 86 ASP ASP A . n A 1 89 ILE 89 87 87 ILE ILE A . n A 1 90 ILE 90 88 88 ILE ILE A . n A 1 91 ARG 91 89 89 ARG ARG A . n A 1 92 ALA 92 90 90 ALA ALA A . n A 1 93 PRO 93 91 91 PRO PRO A . n A 1 94 THR 94 92 92 THR THR A . n A 1 95 ILE 95 93 93 ILE ILE A . n A 1 96 GLU 96 94 94 GLU GLU A . n A 1 97 GLN 97 95 95 GLN GLN A . n A 1 98 MET 98 96 96 MET MET A . n A 1 99 LYS 99 97 97 LYS LYS A . n A 1 100 ASP 100 98 98 ASP ASP A . n A 1 101 VAL 101 99 99 VAL VAL A . n A 1 102 TYR 102 100 100 TYR TYR A . n A 1 103 ILE 103 101 101 ILE ILE A . n A 1 104 VAL 104 102 102 VAL VAL A . n A 1 105 GLN 105 103 103 GLN GLN A . n A 1 106 ASP 106 104 104 ASP ASP A . n A 1 107 LEU 107 105 105 LEU LEU A . n A 1 108 MET 108 106 106 MET MET A . n A 1 109 GLU 109 107 107 GLU GLU A . n A 1 110 THR 110 108 108 THR THR A . n A 1 111 ASP 111 109 109 ASP ASP A . n A 1 112 LEU 112 110 110 LEU LEU A . n A 1 113 TYR 113 111 111 TYR TYR A . n A 1 114 LYS 114 112 112 LYS LYS A . n A 1 115 LEU 115 113 113 LEU LEU A . n A 1 116 LEU 116 114 114 LEU LEU A . n A 1 117 LYS 117 115 115 LYS LYS A . n A 1 118 THR 118 116 116 THR THR A . n A 1 119 GLN 119 117 117 GLN GLN A . n A 1 120 HIS 120 118 118 HIS HIS A . n A 1 121 LEU 121 119 119 LEU LEU A . n A 1 122 SER 122 120 120 SER SER A . n A 1 123 ASN 123 121 121 ASN ASN A . n A 1 124 ASP 124 122 122 ASP ASP A . n A 1 125 HIS 125 123 123 HIS HIS A . n A 1 126 ILE 126 124 124 ILE ILE A . n A 1 127 CYS 127 125 125 CYS CYS A . n A 1 128 TYR 128 126 126 TYR TYR A . n A 1 129 PHE 129 127 127 PHE PHE A . n A 1 130 LEU 130 128 128 LEU LEU A . n A 1 131 TYR 131 129 129 TYR TYR A . n A 1 132 GLN 132 130 130 GLN GLN A . n A 1 133 ILE 133 131 131 ILE ILE A . n A 1 134 LEU 134 132 132 LEU LEU A . n A 1 135 ARG 135 133 133 ARG ARG A . n A 1 136 GLY 136 134 134 GLY GLY A . n A 1 137 LEU 137 135 135 LEU LEU A . n A 1 138 LYS 138 136 136 LYS LYS A . n A 1 139 TYR 139 137 137 TYR TYR A . n A 1 140 ILE 140 138 138 ILE ILE A . n A 1 141 HIS 141 139 139 HIS HIS A . n A 1 142 SER 142 140 140 SER SER A . n A 1 143 ALA 143 141 141 ALA ALA A . n A 1 144 ASN 144 142 142 ASN ASN A . n A 1 145 VAL 145 143 143 VAL VAL A . n A 1 146 LEU 146 144 144 LEU LEU A . n A 1 147 HIS 147 145 145 HIS HIS A . n A 1 148 ARG 148 146 146 ARG ARG A . n A 1 149 ASP 149 147 147 ASP ASP A . n A 1 150 LEU 150 148 148 LEU LEU A . n A 1 151 LYS 151 149 149 LYS LYS A . n A 1 152 PRO 152 150 150 PRO PRO A . n A 1 153 SER 153 151 151 SER SER A . n A 1 154 ASN 154 152 152 ASN ASN A . n A 1 155 LEU 155 153 153 LEU LEU A . n A 1 156 LEU 156 154 154 LEU LEU A . n A 1 157 LEU 157 155 155 LEU LEU A . n A 1 158 ASN 158 156 156 ASN ASN A . n A 1 159 THR 159 157 157 THR THR A . n A 1 160 THR 160 158 158 THR THR A . n A 1 161 CME 161 159 159 CME CME A . n A 1 162 ASP 162 160 160 ASP ASP A . n A 1 163 LEU 163 161 161 LEU LEU A . n A 1 164 LYS 164 162 162 LYS LYS A . n A 1 165 ILE 165 163 163 ILE ILE A . n A 1 166 CYS 166 164 164 CYS CYS A . n A 1 167 ASP 167 165 165 ASP ASP A . n A 1 168 PHE 168 166 166 PHE PHE A . n A 1 169 GLY 169 167 167 GLY GLY A . n A 1 170 LEU 170 168 168 LEU LEU A . n A 1 171 ALA 171 169 169 ALA ALA A . n A 1 172 ARG 172 170 170 ARG ARG A . n A 1 173 VAL 173 171 171 VAL VAL A . n A 1 174 ALA 174 172 172 ALA ALA A . n A 1 175 ASP 175 173 173 ASP ASP A . n A 1 176 PRO 176 174 174 PRO PRO A . n A 1 177 ASP 177 175 175 ASP ASP A . n A 1 178 HIS 178 176 176 HIS HIS A . n A 1 179 ASP 179 177 177 ASP ASP A . n A 1 180 HIS 180 178 178 HIS HIS A . n A 1 181 THR 181 179 179 THR THR A . n A 1 182 GLY 182 180 180 GLY GLY A . n A 1 183 PHE 183 181 181 PHE PHE A . n A 1 184 LEU 184 182 182 LEU LEU A . n A 1 185 THR 185 183 183 THR THR A . n A 1 186 GLU 186 184 184 GLU GLU A . n A 1 187 TYR 187 185 185 TYR TYR A . n A 1 188 VAL 188 186 186 VAL VAL A . n A 1 189 ALA 189 187 187 ALA ALA A . n A 1 190 THR 190 188 188 THR THR A . n A 1 191 ARG 191 189 189 ARG ARG A . n A 1 192 TRP 192 190 190 TRP TRP A . n A 1 193 TYR 193 191 191 TYR TYR A . n A 1 194 ARG 194 192 192 ARG ARG A . n A 1 195 ALA 195 193 193 ALA ALA A . n A 1 196 PRO 196 194 194 PRO PRO A . n A 1 197 GLU 197 195 195 GLU GLU A . n A 1 198 ILE 198 196 196 ILE ILE A . n A 1 199 MET 199 197 197 MET MET A . n A 1 200 LEU 200 198 198 LEU LEU A . n A 1 201 ASN 201 199 199 ASN ASN A . n A 1 202 SER 202 200 200 SER SER A . n A 1 203 LYS 203 201 201 LYS LYS A . n A 1 204 GLY 204 202 202 GLY GLY A . n A 1 205 TYR 205 203 203 TYR TYR A . n A 1 206 THR 206 204 204 THR THR A . n A 1 207 LYS 207 205 205 LYS LYS A . n A 1 208 SER 208 206 206 SER SER A . n A 1 209 ILE 209 207 207 ILE ILE A . n A 1 210 ASP 210 208 208 ASP ASP A . n A 1 211 ILE 211 209 209 ILE ILE A . n A 1 212 TRP 212 210 210 TRP TRP A . n A 1 213 SER 213 211 211 SER SER A . n A 1 214 VAL 214 212 212 VAL VAL A . n A 1 215 GLY 215 213 213 GLY GLY A . n A 1 216 CYS 216 214 214 CYS CYS A . n A 1 217 ILE 217 215 215 ILE ILE A . n A 1 218 LEU 218 216 216 LEU LEU A . n A 1 219 ALA 219 217 217 ALA ALA A . n A 1 220 GLU 220 218 218 GLU GLU A . n A 1 221 MET 221 219 219 MET MET A . n A 1 222 LEU 222 220 220 LEU LEU A . n A 1 223 SER 223 221 221 SER SER A . n A 1 224 ASN 224 222 222 ASN ASN A . n A 1 225 ARG 225 223 223 ARG ARG A . n A 1 226 PRO 226 224 224 PRO PRO A . n A 1 227 ILE 227 225 225 ILE ILE A . n A 1 228 PHE 228 226 226 PHE PHE A . n A 1 229 PRO 229 227 227 PRO PRO A . n A 1 230 GLY 230 228 228 GLY GLY A . n A 1 231 LYS 231 229 229 LYS LYS A . n A 1 232 HIS 232 230 230 HIS HIS A . n A 1 233 TYR 233 231 231 TYR TYR A . n A 1 234 LEU 234 232 232 LEU LEU A . n A 1 235 ASP 235 233 233 ASP ASP A . n A 1 236 GLN 236 234 234 GLN GLN A . n A 1 237 LEU 237 235 235 LEU LEU A . n A 1 238 ASN 238 236 236 ASN ASN A . n A 1 239 HIS 239 237 237 HIS HIS A . n A 1 240 ILE 240 238 238 ILE ILE A . n A 1 241 LEU 241 239 239 LEU LEU A . n A 1 242 GLY 242 240 240 GLY GLY A . n A 1 243 ILE 243 241 241 ILE ILE A . n A 1 244 LEU 244 242 242 LEU LEU A . n A 1 245 GLY 245 243 243 GLY GLY A . n A 1 246 SER 246 244 244 SER SER A . n A 1 247 PRO 247 245 245 PRO PRO A . n A 1 248 SER 248 246 246 SER SER A . n A 1 249 GLN 249 247 247 GLN GLN A . n A 1 250 GLU 250 248 248 GLU GLU A . n A 1 251 ASP 251 249 249 ASP ASP A . n A 1 252 LEU 252 250 250 LEU LEU A . n A 1 253 ASN 253 251 251 ASN ASN A . n A 1 254 CYS 254 252 252 CYS CYS A . n A 1 255 ILE 255 253 253 ILE ILE A . n A 1 256 ILE 256 254 254 ILE ILE A . n A 1 257 ASN 257 255 255 ASN ASN A . n A 1 258 LEU 258 256 256 LEU LEU A . n A 1 259 LYS 259 257 257 LYS LYS A . n A 1 260 ALA 260 258 258 ALA ALA A . n A 1 261 ARG 261 259 259 ARG ARG A . n A 1 262 ASN 262 260 260 ASN ASN A . n A 1 263 TYR 263 261 261 TYR TYR A . n A 1 264 LEU 264 262 262 LEU LEU A . n A 1 265 LEU 265 263 263 LEU LEU A . n A 1 266 SER 266 264 264 SER SER A . n A 1 267 LEU 267 265 265 LEU LEU A . n A 1 268 PRO 268 266 266 PRO PRO A . n A 1 269 HIS 269 267 267 HIS HIS A . n A 1 270 LYS 270 268 268 LYS LYS A . n A 1 271 ASN 271 269 269 ASN ASN A . n A 1 272 LYS 272 270 270 LYS LYS A . n A 1 273 VAL 273 271 271 VAL VAL A . n A 1 274 PRO 274 272 272 PRO PRO A . n A 1 275 TRP 275 273 273 TRP TRP A . n A 1 276 ASN 276 274 274 ASN ASN A . n A 1 277 ARG 277 275 275 ARG ARG A . n A 1 278 LEU 278 276 276 LEU LEU A . n A 1 279 PHE 279 277 277 PHE PHE A . n A 1 280 PRO 280 278 278 PRO PRO A . n A 1 281 ASN 281 279 279 ASN ASN A . n A 1 282 ALA 282 280 280 ALA ALA A . n A 1 283 ASP 283 281 281 ASP ASP A . n A 1 284 SER 284 282 282 SER SER A . n A 1 285 LYS 285 283 283 LYS LYS A . n A 1 286 ALA 286 284 284 ALA ALA A . n A 1 287 LEU 287 285 285 LEU LEU A . n A 1 288 ASP 288 286 286 ASP ASP A . n A 1 289 LEU 289 287 287 LEU LEU A . n A 1 290 LEU 290 288 288 LEU LEU A . n A 1 291 ASP 291 289 289 ASP ASP A . n A 1 292 LYS 292 290 290 LYS LYS A . n A 1 293 MET 293 291 291 MET MET A . n A 1 294 LEU 294 292 292 LEU LEU A . n A 1 295 THR 295 293 293 THR THR A . n A 1 296 PHE 296 294 294 PHE PHE A . n A 1 297 ASN 297 295 295 ASN ASN A . n A 1 298 PRO 298 296 296 PRO PRO A . n A 1 299 HIS 299 297 297 HIS HIS A . n A 1 300 LYS 300 298 298 LYS LYS A . n A 1 301 ARG 301 299 299 ARG ARG A . n A 1 302 ILE 302 300 300 ILE ILE A . n A 1 303 GLU 303 301 301 GLU GLU A . n A 1 304 VAL 304 302 302 VAL VAL A . n A 1 305 GLU 305 303 303 GLU GLU A . n A 1 306 GLN 306 304 304 GLN GLN A . n A 1 307 ALA 307 305 305 ALA ALA A . n A 1 308 LEU 308 306 306 LEU LEU A . n A 1 309 ALA 309 307 307 ALA ALA A . n A 1 310 HIS 310 308 308 HIS HIS A . n A 1 311 PRO 311 309 309 PRO PRO A . n A 1 312 TYR 312 310 310 TYR TYR A . n A 1 313 LEU 313 311 311 LEU LEU A . n A 1 314 GLU 314 312 312 GLU GLU A . n A 1 315 GLN 315 313 313 GLN GLN A . n A 1 316 TYR 316 314 314 TYR TYR A . n A 1 317 TYR 317 315 315 TYR TYR A . n A 1 318 ASP 318 316 316 ASP ASP A . n A 1 319 PRO 319 317 317 PRO PRO A . n A 1 320 SER 320 318 318 SER SER A . n A 1 321 ASP 321 319 319 ASP ASP A . n A 1 322 GLU 322 320 320 GLU GLU A . n A 1 323 PRO 323 321 321 PRO PRO A . n A 1 324 ILE 324 322 322 ILE ILE A . n A 1 325 ALA 325 323 323 ALA ALA A . n A 1 326 GLU 326 324 324 GLU GLU A . n A 1 327 ALA 327 325 325 ALA ALA A . n A 1 328 PRO 328 326 326 PRO PRO A . n A 1 329 PHE 329 327 327 PHE PHE A . n A 1 330 LYS 330 328 328 LYS LYS A . n A 1 331 PHE 331 329 329 PHE PHE A . n A 1 332 ASP 332 330 ? ? ? A . n A 1 333 MET 333 331 ? ? ? A . n A 1 334 GLU 334 332 ? ? ? A . n A 1 335 LEU 335 333 ? ? ? A . n A 1 336 ASP 336 334 334 ASP ASP A . n A 1 337 ASP 337 335 335 ASP ASP A . n A 1 338 LEU 338 336 336 LEU LEU A . n A 1 339 PRO 339 337 337 PRO PRO A . n A 1 340 LYS 340 338 338 LYS LYS A . n A 1 341 GLU 341 339 339 GLU GLU A . n A 1 342 LYS 342 340 340 LYS LYS A . n A 1 343 LEU 343 341 341 LEU LEU A . n A 1 344 LYS 344 342 342 LYS LYS A . n A 1 345 GLU 345 343 343 GLU GLU A . n A 1 346 LEU 346 344 344 LEU LEU A . n A 1 347 ILE 347 345 345 ILE ILE A . n A 1 348 PHE 348 346 346 PHE PHE A . n A 1 349 GLU 349 347 347 GLU GLU A . n A 1 350 GLU 350 348 348 GLU GLU A . n A 1 351 THR 351 349 349 THR THR A . n A 1 352 ALA 352 350 350 ALA ALA A . n A 1 353 ARG 353 351 351 ARG ARG A . n A 1 354 PHE 354 352 352 PHE PHE A . n A 1 355 GLN 355 353 353 GLN GLN A . n A 1 356 PRO 356 354 354 PRO PRO A . n A 1 357 GLY 357 355 355 GLY GLY A . n A 1 358 TYR 358 356 ? ? ? A . n A 1 359 ARG 359 357 ? ? ? A . n A 1 360 SER 360 358 ? ? ? A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CME _pdbx_struct_mod_residue.label_seq_id 161 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CME _pdbx_struct_mod_residue.auth_seq_id 159 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-08-22 2 'Structure model' 1 1 2014-09-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Structure summary' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 19.8950 8.3665 25.6889 0.0382 0.0102 -0.1030 0.0150 -0.0506 -0.0769 -0.2564 0.8921 1.1172 0.9686 0.3188 0.3558 0.0183 0.0036 -0.0219 -0.0013 0.0107 0.0221 0.0251 -0.0880 0.0183 'X-RAY DIFFRACTION' 2 ? refined 15.7651 -1.1585 24.5296 0.0133 0.0342 -0.0571 0.0174 -0.0024 -0.0494 -0.3885 0.0255 1.4380 0.2801 1.0928 0.0048 -0.0057 0.0159 -0.0102 -0.0038 0.0077 -0.0314 0.0389 -0.0183 -0.0135 'X-RAY DIFFRACTION' 3 ? refined 5.2417 -0.5831 0.0755 -0.0491 -0.0611 -0.0148 -0.0094 0.0016 -0.0050 1.6696 0.4378 0.8779 -0.6283 0.2489 -0.1096 0.0071 0.0343 -0.0414 -0.0038 0.0513 0.0303 -0.0469 0.0298 -0.0244 'X-RAY DIFFRACTION' 4 ? refined 7.0549 -1.7192 32.6182 -0.0192 0.0268 -0.0168 0.0088 0.0038 -0.0024 0.0923 0.0022 0.5221 -0.1035 -0.2236 -0.1496 -0.0005 0.0071 -0.0066 0.0006 -0.0027 0.0096 0.0068 0.0082 -0.0079 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 9 A 67 '{A|9 - 67}' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 68 A 107 '{A|68 - 107}' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 108 A 328 '{A|108 - 328}' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 329 A 355 '{A|329 - 355}' ? ? ? ? ? # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SCALEPACK . ? program 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 2 BUSTER-TNT 'BUSTER 2.11.1' ? program 'Gerard Bricogne' buster-develop@GlobalPhasing.com refinement http://www.globalphasing.com/buster/ ? ? 3 PDB_EXTRACT 3.11 'August 3, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 BUSTER 2.11.1 ? ? ? ? refinement ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 29 ? ? -120.04 -53.87 2 1 ARG A 146 ? ? 68.98 -0.58 3 1 ASP A 165 ? ? 64.18 92.42 4 1 ASN A 199 ? ? -158.95 14.55 5 1 LEU A 292 ? ? -98.29 49.24 6 1 ASP A 316 ? ? -159.61 89.05 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 10 ? CG ? A GLU 12 CG 2 1 Y 1 A GLU 10 ? CD ? A GLU 12 CD 3 1 Y 1 A GLU 10 ? OE1 ? A GLU 12 OE1 4 1 Y 1 A GLU 10 ? OE2 ? A GLU 12 OE2 5 1 Y 1 A ASN 25 ? CG ? A ASN 27 CG 6 1 Y 1 A ASN 25 ? OD1 ? A ASN 27 OD1 7 1 Y 1 A ASN 25 ? ND2 ? A ASN 27 ND2 8 1 Y 1 A TYR 34 ? CG ? A TYR 36 CG 9 1 Y 1 A TYR 34 ? CD1 ? A TYR 36 CD1 10 1 Y 1 A TYR 34 ? CD2 ? A TYR 36 CD2 11 1 Y 1 A TYR 34 ? CE1 ? A TYR 36 CE1 12 1 Y 1 A TYR 34 ? CE2 ? A TYR 36 CE2 13 1 Y 1 A TYR 34 ? CZ ? A TYR 36 CZ 14 1 Y 1 A TYR 34 ? OH ? A TYR 36 OH 15 1 Y 1 A GLN 60 ? CG ? A GLN 62 CG 16 1 Y 1 A GLN 60 ? CD ? A GLN 62 CD 17 1 Y 1 A GLN 60 ? OE1 ? A GLN 62 OE1 18 1 Y 1 A GLN 60 ? NE2 ? A GLN 62 NE2 19 1 Y 1 A GLN 64 ? CG ? A GLN 66 CG 20 1 Y 1 A GLN 64 ? CD ? A GLN 66 CD 21 1 Y 1 A GLN 64 ? OE1 ? A GLN 66 OE1 22 1 Y 1 A GLN 64 ? NE2 ? A GLN 66 NE2 23 1 Y 1 A LYS 115 ? CG ? A LYS 117 CG 24 1 Y 1 A LYS 115 ? CD ? A LYS 117 CD 25 1 Y 1 A LYS 115 ? CE ? A LYS 117 CE 26 1 Y 1 A LYS 115 ? NZ ? A LYS 117 NZ 27 1 Y 1 A ARG 223 ? CG ? A ARG 225 CG 28 1 Y 1 A ARG 223 ? CD ? A ARG 225 CD 29 1 Y 1 A ARG 223 ? NE ? A ARG 225 NE 30 1 Y 1 A ARG 223 ? CZ ? A ARG 225 CZ 31 1 Y 1 A ARG 223 ? NH1 ? A ARG 225 NH1 32 1 Y 1 A ARG 223 ? NH2 ? A ARG 225 NH2 33 1 Y 1 A LYS 328 ? CG ? A LYS 330 CG 34 1 Y 1 A LYS 328 ? CD ? A LYS 330 CD 35 1 Y 1 A LYS 328 ? CE ? A LYS 330 CE 36 1 Y 1 A LYS 328 ? NZ ? A LYS 330 NZ 37 1 Y 1 A ASP 334 ? CG ? A ASP 336 CG 38 1 Y 1 A ASP 334 ? OD1 ? A ASP 336 OD1 39 1 Y 1 A ASP 334 ? OD2 ? A ASP 336 OD2 40 1 Y 1 A ASP 335 ? CG ? A ASP 337 CG 41 1 Y 1 A ASP 335 ? OD1 ? A ASP 337 OD1 42 1 Y 1 A ASP 335 ? OD2 ? A ASP 337 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -1 ? A MET 1 2 1 Y 1 A ALA 0 ? A ALA 2 3 1 Y 1 A ALA 1 ? A ALA 3 4 1 Y 1 A ALA 2 ? A ALA 4 5 1 Y 1 A ALA 3 ? A ALA 5 6 1 Y 1 A ALA 4 ? A ALA 6 7 1 Y 1 A ALA 5 ? A ALA 7 8 1 Y 1 A GLY 6 ? A GLY 8 9 1 Y 1 A ALA 7 ? A ALA 9 10 1 Y 1 A GLY 8 ? A GLY 10 11 1 Y 1 A ASP 330 ? A ASP 332 12 1 Y 1 A MET 331 ? A MET 333 13 1 Y 1 A GLU 332 ? A GLU 334 14 1 Y 1 A LEU 333 ? A LEU 335 15 1 Y 1 A TYR 356 ? A TYR 358 16 1 Y 1 A ARG 357 ? A ARG 359 17 1 Y 1 A SER 358 ? A SER 360 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'trans-4-{[4-(5-methyl-3-phenyl-1,2-oxazol-4-yl)pyrimidin-2-yl]amino}cyclohexanol' E75 3 'SULFATE ION' SO4 4 1,2-ETHANEDIOL EDO 5 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 E75 1 401 1 E75 E75 A . C 3 SO4 1 402 1 SO4 SO4 A . D 3 SO4 1 403 2 SO4 SO4 A . E 4 EDO 1 404 3 EDO EDO A . F 5 HOH 1 501 1 HOH HOH A . F 5 HOH 2 502 2 HOH HOH A . F 5 HOH 3 503 3 HOH HOH A . F 5 HOH 4 504 4 HOH HOH A . F 5 HOH 5 505 5 HOH HOH A . F 5 HOH 6 506 6 HOH HOH A . F 5 HOH 7 507 7 HOH HOH A . F 5 HOH 8 508 8 HOH HOH A . F 5 HOH 9 509 9 HOH HOH A . F 5 HOH 10 510 10 HOH HOH A . F 5 HOH 11 511 11 HOH HOH A . F 5 HOH 12 512 12 HOH HOH A . F 5 HOH 13 513 13 HOH HOH A . F 5 HOH 14 514 14 HOH HOH A . F 5 HOH 15 515 15 HOH HOH A . F 5 HOH 16 516 16 HOH HOH A . F 5 HOH 17 517 17 HOH HOH A . F 5 HOH 18 518 18 HOH HOH A . F 5 HOH 19 519 19 HOH HOH A . F 5 HOH 20 520 20 HOH HOH A . F 5 HOH 21 521 21 HOH HOH A . F 5 HOH 22 522 22 HOH HOH A . F 5 HOH 23 523 23 HOH HOH A . F 5 HOH 24 524 24 HOH HOH A . F 5 HOH 25 525 25 HOH HOH A . F 5 HOH 26 526 26 HOH HOH A . F 5 HOH 27 527 27 HOH HOH A . F 5 HOH 28 528 28 HOH HOH A . F 5 HOH 29 529 29 HOH HOH A . F 5 HOH 30 530 30 HOH HOH A . F 5 HOH 31 531 31 HOH HOH A . F 5 HOH 32 532 32 HOH HOH A . F 5 HOH 33 533 33 HOH HOH A . F 5 HOH 34 534 34 HOH HOH A . F 5 HOH 35 535 35 HOH HOH A . F 5 HOH 36 536 36 HOH HOH A . F 5 HOH 37 537 37 HOH HOH A . F 5 HOH 38 538 38 HOH HOH A . F 5 HOH 39 539 39 HOH HOH A . F 5 HOH 40 540 40 HOH HOH A . F 5 HOH 41 541 41 HOH HOH A . F 5 HOH 42 542 42 HOH HOH A . F 5 HOH 43 543 43 HOH HOH A . F 5 HOH 44 544 44 HOH HOH A . F 5 HOH 45 545 45 HOH HOH A . F 5 HOH 46 546 46 HOH HOH A . F 5 HOH 47 547 47 HOH HOH A . F 5 HOH 48 548 48 HOH HOH A . F 5 HOH 49 549 50 HOH HOH A . F 5 HOH 50 550 51 HOH HOH A . F 5 HOH 51 551 52 HOH HOH A . F 5 HOH 52 552 53 HOH HOH A . F 5 HOH 53 553 54 HOH HOH A . F 5 HOH 54 554 55 HOH HOH A . F 5 HOH 55 555 56 HOH HOH A . F 5 HOH 56 556 57 HOH HOH A . F 5 HOH 57 557 58 HOH HOH A . F 5 HOH 58 558 59 HOH HOH A . F 5 HOH 59 559 60 HOH HOH A . F 5 HOH 60 560 61 HOH HOH A . F 5 HOH 61 561 62 HOH HOH A . F 5 HOH 62 562 63 HOH HOH A . F 5 HOH 63 563 64 HOH HOH A . F 5 HOH 64 564 66 HOH HOH A . F 5 HOH 65 565 67 HOH HOH A . F 5 HOH 66 566 68 HOH HOH A . F 5 HOH 67 567 69 HOH HOH A . F 5 HOH 68 568 71 HOH HOH A . F 5 HOH 69 569 72 HOH HOH A . F 5 HOH 70 570 73 HOH HOH A . F 5 HOH 71 571 74 HOH HOH A . F 5 HOH 72 572 76 HOH HOH A . F 5 HOH 73 573 77 HOH HOH A . F 5 HOH 74 574 78 HOH HOH A . F 5 HOH 75 575 79 HOH HOH A . F 5 HOH 76 576 80 HOH HOH A . F 5 HOH 77 577 81 HOH HOH A . F 5 HOH 78 578 82 HOH HOH A . F 5 HOH 79 579 83 HOH HOH A . F 5 HOH 80 580 84 HOH HOH A . F 5 HOH 81 581 85 HOH HOH A . F 5 HOH 82 582 86 HOH HOH A . F 5 HOH 83 583 87 HOH HOH A . F 5 HOH 84 584 88 HOH HOH A . F 5 HOH 85 585 89 HOH HOH A . F 5 HOH 86 586 90 HOH HOH A . F 5 HOH 87 587 91 HOH HOH A . F 5 HOH 88 588 92 HOH HOH A . F 5 HOH 89 589 93 HOH HOH A . F 5 HOH 90 590 94 HOH HOH A . F 5 HOH 91 591 95 HOH HOH A . F 5 HOH 92 592 96 HOH HOH A . F 5 HOH 93 593 97 HOH HOH A . F 5 HOH 94 594 98 HOH HOH A . F 5 HOH 95 595 99 HOH HOH A . F 5 HOH 96 596 100 HOH HOH A . F 5 HOH 97 597 101 HOH HOH A . F 5 HOH 98 598 102 HOH HOH A . F 5 HOH 99 599 103 HOH HOH A . F 5 HOH 100 600 105 HOH HOH A . F 5 HOH 101 601 106 HOH HOH A . F 5 HOH 102 602 107 HOH HOH A . F 5 HOH 103 603 108 HOH HOH A . F 5 HOH 104 604 109 HOH HOH A . F 5 HOH 105 605 110 HOH HOH A . F 5 HOH 106 606 111 HOH HOH A . F 5 HOH 107 607 112 HOH HOH A . F 5 HOH 108 608 113 HOH HOH A . F 5 HOH 109 609 114 HOH HOH A . F 5 HOH 110 610 115 HOH HOH A . F 5 HOH 111 611 116 HOH HOH A . F 5 HOH 112 612 117 HOH HOH A . F 5 HOH 113 613 118 HOH HOH A . F 5 HOH 114 614 119 HOH HOH A . F 5 HOH 115 615 121 HOH HOH A . F 5 HOH 116 616 123 HOH HOH A . F 5 HOH 117 617 124 HOH HOH A . F 5 HOH 118 618 125 HOH HOH A . F 5 HOH 119 619 126 HOH HOH A . F 5 HOH 120 620 127 HOH HOH A . F 5 HOH 121 621 128 HOH HOH A . F 5 HOH 122 622 129 HOH HOH A . F 5 HOH 123 623 130 HOH HOH A . F 5 HOH 124 624 131 HOH HOH A . F 5 HOH 125 625 132 HOH HOH A . F 5 HOH 126 626 133 HOH HOH A . F 5 HOH 127 627 134 HOH HOH A . F 5 HOH 128 628 135 HOH HOH A . F 5 HOH 129 629 136 HOH HOH A . F 5 HOH 130 630 137 HOH HOH A . F 5 HOH 131 631 138 HOH HOH A . F 5 HOH 132 632 139 HOH HOH A . F 5 HOH 133 633 140 HOH HOH A . F 5 HOH 134 634 141 HOH HOH A . F 5 HOH 135 635 142 HOH HOH A . F 5 HOH 136 636 143 HOH HOH A . F 5 HOH 137 637 144 HOH HOH A . F 5 HOH 138 638 145 HOH HOH A . F 5 HOH 139 639 146 HOH HOH A . F 5 HOH 140 640 147 HOH HOH A . F 5 HOH 141 641 148 HOH HOH A . F 5 HOH 142 642 149 HOH HOH A . F 5 HOH 143 643 150 HOH HOH A . F 5 HOH 144 644 151 HOH HOH A . F 5 HOH 145 645 152 HOH HOH A . F 5 HOH 146 646 153 HOH HOH A . F 5 HOH 147 647 154 HOH HOH A . F 5 HOH 148 648 155 HOH HOH A . F 5 HOH 149 649 156 HOH HOH A . F 5 HOH 150 650 157 HOH HOH A . F 5 HOH 151 651 158 HOH HOH A . F 5 HOH 152 652 159 HOH HOH A . F 5 HOH 153 653 160 HOH HOH A . F 5 HOH 154 654 161 HOH HOH A . F 5 HOH 155 655 162 HOH HOH A . F 5 HOH 156 656 163 HOH HOH A . F 5 HOH 157 657 164 HOH HOH A . F 5 HOH 158 658 165 HOH HOH A . F 5 HOH 159 659 166 HOH HOH A . F 5 HOH 160 660 167 HOH HOH A . #