data_4FVR # _entry.id 4FVR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4FVR RCSB RCSB073416 WWPDB D_1000073416 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4FVP . unspecified PDB 4FVQ . unspecified # _pdbx_database_status.entry_id 4FVR _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-06-29 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bandaranayake, R.M.' 1 'Hubbard, S.R.' 2 # _citation.id primary _citation.title 'Crystal structures of the JAK2 pseudokinase domain and the pathogenic mutant V617F.' _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_volume 19 _citation.page_first 754 _citation.page_last 759 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1545-9993 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22820988 _citation.pdbx_database_id_DOI 10.1038/nsmb.2348 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Bandaranayake, R.M.' 1 primary 'Ungureanu, D.' 2 primary 'Shan, Y.' 3 primary 'Shaw, D.E.' 4 primary 'Silvennoinen, O.' 5 primary 'Hubbard, S.R.' 6 # _cell.entry_id 4FVR _cell.length_a 46.900 _cell.length_b 57.326 _cell.length_c 60.555 _cell.angle_alpha 90.00 _cell.angle_beta 111.86 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4FVR _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein kinase JAK2' 33284.133 1 2.7.10.2 'V617F, W777A, F794H' 'Jak2 pseudokinase domain, UNP residues 536-812' ? 2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 111 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Janus kinase 2, JAK-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGV CFCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFI KLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAP KAAELANLINNCMDYEPDHRPSFRAIIRDLNSLFTPDLVPRGSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;VFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGV CFCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFI KLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAP KAAELANLINNCMDYEPDHRPSFRAIIRDLNSLFTPDLVPRGSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 PHE n 1 3 HIS n 1 4 LYS n 1 5 ILE n 1 6 ARG n 1 7 ASN n 1 8 GLU n 1 9 ASP n 1 10 LEU n 1 11 ILE n 1 12 PHE n 1 13 ASN n 1 14 GLU n 1 15 SER n 1 16 LEU n 1 17 GLY n 1 18 GLN n 1 19 GLY n 1 20 THR n 1 21 PHE n 1 22 THR n 1 23 LYS n 1 24 ILE n 1 25 PHE n 1 26 LYS n 1 27 GLY n 1 28 VAL n 1 29 ARG n 1 30 ARG n 1 31 GLU n 1 32 VAL n 1 33 GLY n 1 34 ASP n 1 35 TYR n 1 36 GLY n 1 37 GLN n 1 38 LEU n 1 39 HIS n 1 40 GLU n 1 41 THR n 1 42 GLU n 1 43 VAL n 1 44 LEU n 1 45 LEU n 1 46 LYS n 1 47 VAL n 1 48 LEU n 1 49 ASP n 1 50 LYS n 1 51 ALA n 1 52 HIS n 1 53 ARG n 1 54 ASN n 1 55 TYR n 1 56 SER n 1 57 GLU n 1 58 SER n 1 59 PHE n 1 60 PHE n 1 61 GLU n 1 62 ALA n 1 63 ALA n 1 64 SER n 1 65 MET n 1 66 MET n 1 67 SER n 1 68 LYS n 1 69 LEU n 1 70 SER n 1 71 HIS n 1 72 LYS n 1 73 HIS n 1 74 LEU n 1 75 VAL n 1 76 LEU n 1 77 ASN n 1 78 TYR n 1 79 GLY n 1 80 VAL n 1 81 CYS n 1 82 PHE n 1 83 CYS n 1 84 GLY n 1 85 ASP n 1 86 GLU n 1 87 ASN n 1 88 ILE n 1 89 LEU n 1 90 VAL n 1 91 GLN n 1 92 GLU n 1 93 PHE n 1 94 VAL n 1 95 LYS n 1 96 PHE n 1 97 GLY n 1 98 SER n 1 99 LEU n 1 100 ASP n 1 101 THR n 1 102 TYR n 1 103 LEU n 1 104 LYS n 1 105 LYS n 1 106 ASN n 1 107 LYS n 1 108 ASN n 1 109 CYS n 1 110 ILE n 1 111 ASN n 1 112 ILE n 1 113 LEU n 1 114 TRP n 1 115 LYS n 1 116 LEU n 1 117 GLU n 1 118 VAL n 1 119 ALA n 1 120 LYS n 1 121 GLN n 1 122 LEU n 1 123 ALA n 1 124 TRP n 1 125 ALA n 1 126 MET n 1 127 HIS n 1 128 PHE n 1 129 LEU n 1 130 GLU n 1 131 GLU n 1 132 ASN n 1 133 THR n 1 134 LEU n 1 135 ILE n 1 136 HIS n 1 137 GLY n 1 138 ASN n 1 139 VAL n 1 140 CYS n 1 141 ALA n 1 142 LYS n 1 143 ASN n 1 144 ILE n 1 145 LEU n 1 146 LEU n 1 147 ILE n 1 148 ARG n 1 149 GLU n 1 150 GLU n 1 151 ASP n 1 152 ARG n 1 153 LYS n 1 154 THR n 1 155 GLY n 1 156 ASN n 1 157 PRO n 1 158 PRO n 1 159 PHE n 1 160 ILE n 1 161 LYS n 1 162 LEU n 1 163 SER n 1 164 ASP n 1 165 PRO n 1 166 GLY n 1 167 ILE n 1 168 SER n 1 169 ILE n 1 170 THR n 1 171 VAL n 1 172 LEU n 1 173 PRO n 1 174 LYS n 1 175 ASP n 1 176 ILE n 1 177 LEU n 1 178 GLN n 1 179 GLU n 1 180 ARG n 1 181 ILE n 1 182 PRO n 1 183 TRP n 1 184 VAL n 1 185 PRO n 1 186 PRO n 1 187 GLU n 1 188 CYS n 1 189 ILE n 1 190 GLU n 1 191 ASN n 1 192 PRO n 1 193 LYS n 1 194 ASN n 1 195 LEU n 1 196 ASN n 1 197 LEU n 1 198 ALA n 1 199 THR n 1 200 ASP n 1 201 LYS n 1 202 TRP n 1 203 SER n 1 204 PHE n 1 205 GLY n 1 206 THR n 1 207 THR n 1 208 LEU n 1 209 TRP n 1 210 GLU n 1 211 ILE n 1 212 CYS n 1 213 SER n 1 214 GLY n 1 215 GLY n 1 216 ASP n 1 217 LYS n 1 218 PRO n 1 219 LEU n 1 220 SER n 1 221 ALA n 1 222 LEU n 1 223 ASP n 1 224 SER n 1 225 GLN n 1 226 ARG n 1 227 LYS n 1 228 LEU n 1 229 GLN n 1 230 PHE n 1 231 TYR n 1 232 GLU n 1 233 ASP n 1 234 ARG n 1 235 HIS n 1 236 GLN n 1 237 LEU n 1 238 PRO n 1 239 ALA n 1 240 PRO n 1 241 LYS n 1 242 ALA n 1 243 ALA n 1 244 GLU n 1 245 LEU n 1 246 ALA n 1 247 ASN n 1 248 LEU n 1 249 ILE n 1 250 ASN n 1 251 ASN n 1 252 CYS n 1 253 MET n 1 254 ASP n 1 255 TYR n 1 256 GLU n 1 257 PRO n 1 258 ASP n 1 259 HIS n 1 260 ARG n 1 261 PRO n 1 262 SER n 1 263 PHE n 1 264 ARG n 1 265 ALA n 1 266 ILE n 1 267 ILE n 1 268 ARG n 1 269 ASP n 1 270 LEU n 1 271 ASN n 1 272 SER n 1 273 LEU n 1 274 PHE n 1 275 THR n 1 276 PRO n 1 277 ASP n 1 278 LEU n 1 279 VAL n 1 280 PRO n 1 281 ARG n 1 282 GLY n 1 283 SER n 1 284 HIS n 1 285 HIS n 1 286 HIS n 1 287 HIS n 1 288 HIS n 1 289 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene JAK2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pFastBac _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code JAK2_HUMAN _struct_ref.pdbx_db_accession O60674 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGV CVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFI KLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAP KWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPD ; _struct_ref.pdbx_align_begin 536 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4FVR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 277 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O60674 _struct_ref_seq.db_align_beg 536 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 812 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 536 _struct_ref_seq.pdbx_auth_seq_align_end 812 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4FVR PHE A 82 ? UNP O60674 VAL 617 'ENGINEERED MUTATION' 617 1 1 4FVR ALA A 242 ? UNP O60674 TRP 777 'ENGINEERED MUTATION' 777 2 1 4FVR HIS A 259 ? UNP O60674 PHE 794 'ENGINEERED MUTATION' 794 3 1 4FVR LEU A 278 ? UNP O60674 ? ? 'EXPRESSION TAG' 813 4 1 4FVR VAL A 279 ? UNP O60674 ? ? 'EXPRESSION TAG' 814 5 1 4FVR PRO A 280 ? UNP O60674 ? ? 'EXPRESSION TAG' 815 6 1 4FVR ARG A 281 ? UNP O60674 ? ? 'EXPRESSION TAG' 816 7 1 4FVR GLY A 282 ? UNP O60674 ? ? 'EXPRESSION TAG' 817 8 1 4FVR SER A 283 ? UNP O60674 ? ? 'EXPRESSION TAG' 818 9 1 4FVR HIS A 284 ? UNP O60674 ? ? 'EXPRESSION TAG' 819 10 1 4FVR HIS A 285 ? UNP O60674 ? ? 'EXPRESSION TAG' 820 11 1 4FVR HIS A 286 ? UNP O60674 ? ? 'EXPRESSION TAG' 821 12 1 4FVR HIS A 287 ? UNP O60674 ? ? 'EXPRESSION TAG' 822 13 1 4FVR HIS A 288 ? UNP O60674 ? ? 'EXPRESSION TAG' 823 14 1 4FVR HIS A 289 ? UNP O60674 ? ? 'EXPRESSION TAG' 824 15 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ATP non-polymer . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4FVR _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 44.32 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details '100 mM Tris/HCl, PEG 4000, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2012-02-12 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X25' _diffrn_source.pdbx_wavelength_list 1.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X25 # _reflns.entry_id 4FVR _reflns.d_resolution_high 1.750 _reflns.d_resolution_low 50.000 _reflns.number_obs 29027 _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_netI_over_sigmaI 6.300 _reflns.pdbx_chi_squared 0.770 _reflns.pdbx_redundancy 6.400 _reflns.percent_possible_obs 99.300 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.750 1.780 ? ? ? 0.431 ? ? 0.548 5.300 ? 1376 93.600 1 1 1.780 1.810 ? ? ? 0.416 ? ? 0.534 5.600 ? 1374 96.000 2 1 1.810 1.850 ? ? ? 0.368 ? ? 0.529 5.600 ? 1403 97.400 3 1 1.850 1.890 ? ? ? 0.339 ? ? 0.501 6.200 ? 1435 99.300 4 1 1.890 1.930 ? ? ? 0.271 ? ? 0.537 6.300 ? 1468 99.900 5 1 1.930 1.970 ? ? ? 0.238 ? ? 0.577 6.400 ? 1473 100.000 6 1 1.970 2.020 ? ? ? 0.217 ? ? 0.595 6.200 ? 1431 99.800 7 1 2.020 2.070 ? ? ? 0.177 ? ? 0.613 6.700 ? 1449 99.900 8 1 2.070 2.140 ? ? ? 0.156 ? ? 0.631 6.700 ? 1474 100.000 9 1 2.140 2.200 ? ? ? 0.128 ? ? 0.685 6.400 ? 1459 100.000 10 1 2.200 2.280 ? ? ? 0.112 ? ? 0.677 6.600 ? 1443 99.900 11 1 2.280 2.380 ? ? ? 0.097 ? ? 0.694 6.800 ? 1454 100.000 12 1 2.380 2.480 ? ? ? 0.087 ? ? 0.711 6.600 ? 1460 100.000 13 1 2.480 2.610 ? ? ? 0.079 ? ? 0.760 6.700 ? 1471 100.000 14 1 2.610 2.780 ? ? ? 0.069 ? ? 0.803 6.800 ? 1466 100.000 15 1 2.780 2.990 ? ? ? 0.065 ? ? 0.977 6.600 ? 1447 100.000 16 1 2.990 3.290 ? ? ? 0.056 ? ? 1.062 6.900 ? 1461 100.000 17 1 3.290 3.770 ? ? ? 0.046 ? ? 1.199 6.700 ? 1476 99.900 18 1 3.770 4.750 ? ? ? 0.041 ? ? 1.295 6.700 ? 1482 100.000 19 1 4.750 50.000 ? ? ? 0.036 ? ? 1.198 6.600 ? 1525 100.000 20 1 # _refine.entry_id 4FVR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.0000 _refine.ls_d_res_low 43.5 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 95.5000 _refine.ls_number_reflns_obs 19530 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : WITH TLS ADDED' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1831 _refine.ls_R_factor_R_work 0.1806 _refine.ls_wR_factor_R_work 0.1783 _refine.ls_R_factor_R_free 0.2290 _refine.ls_wR_factor_R_free 0.2260 _refine.ls_percent_reflns_R_free 5.2000 _refine.ls_number_reflns_R_free 1006 _refine.ls_number_reflns_R_work 18524 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 36.7700 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 2.0500 _refine.aniso_B[2][2] -2.5100 _refine.aniso_B[3][3] -2.1700 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -3.5300 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9580 _refine.correlation_coeff_Fo_to_Fc_free 0.9240 _refine.overall_SU_R_Cruickshank_DPI 0.1842 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free 0.1661 _refine.pdbx_overall_ESU_R 0.1840 _refine.pdbx_overall_ESU_R_Free 0.1660 _refine.overall_SU_ML 0.1210 _refine.overall_SU_B 8.5500 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 'PDB ENTRY 4FVP' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8386 _refine.B_iso_max 130.490 _refine.B_iso_min 19.040 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 1.000 _refine.pdbx_diffrn_id 1 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_TLS_residual_ADP_flag ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2147 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 111 _refine_hist.number_atoms_total 2290 _refine_hist.d_res_high 2.0000 _refine_hist.d_res_low 43.5 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' r_bond_refined_d 2231 0.008 0.020 ? ? 'X-RAY DIFFRACTION' r_bond_other_d 1466 0.006 0.020 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 3040 1.281 1.973 ? ? 'X-RAY DIFFRACTION' r_angle_other_deg 3590 0.837 3.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 273 6.718 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 102 40.082 24.902 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 363 14.689 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 9 18.649 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 339 0.072 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 2468 0.008 0.021 ? ? 'X-RAY DIFFRACTION' r_gen_planes_other 444 0.001 0.020 ? ? # _refine_ls_shell.d_res_high 1.9950 _refine_ls_shell.d_res_low 2.0470 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 64.2000 _refine_ls_shell.number_reflns_R_work 921 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2520 _refine_ls_shell.R_factor_R_free 0.2690 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 961 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.redundancy_reflns_obs ? # _struct.entry_id 4FVR _struct.title 'Crystal structure of the Jak2 pseudokinase domain mutant V617F (Mg-ATP-bound form)' _struct.pdbx_descriptor 'Tyrosine-protein kinase JAK2 (E.C.2.7.10.2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4FVR _struct_keywords.text 'JANUS PROTEIN KINASE, PSEUDOKINASE, ATP BINDING, PHOSPHORYLATION, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 6 ? GLU A 8 ? ARG A 541 GLU A 543 5 ? 3 HELX_P HELX_P2 2 ASP A 34 ? GLY A 36 ? ASP A 569 GLY A 571 5 ? 3 HELX_P HELX_P3 3 HIS A 52 ? LYS A 68 ? HIS A 587 LYS A 603 1 ? 17 HELX_P HELX_P4 4 SER A 98 ? ASN A 106 ? SER A 633 ASN A 641 1 ? 9 HELX_P HELX_P5 5 ASN A 111 ? ASN A 132 ? ASN A 646 ASN A 667 1 ? 22 HELX_P HELX_P6 6 CYS A 140 ? LYS A 142 ? CYS A 675 LYS A 677 5 ? 3 HELX_P HELX_P7 7 PRO A 173 ? ARG A 180 ? PRO A 708 ARG A 715 1 ? 8 HELX_P HELX_P8 8 PRO A 185 ? ASN A 191 ? PRO A 720 ASN A 726 1 ? 7 HELX_P HELX_P9 9 PRO A 192 ? LEU A 195 ? PRO A 727 LEU A 730 5 ? 4 HELX_P HELX_P10 10 ASN A 196 ? SER A 213 ? ASN A 731 SER A 748 1 ? 18 HELX_P HELX_P11 11 ASP A 223 ? ASP A 233 ? ASP A 758 ASP A 768 1 ? 11 HELX_P HELX_P12 12 LEU A 245 ? MET A 253 ? LEU A 780 MET A 788 1 ? 9 HELX_P HELX_P13 13 GLU A 256 ? ARG A 260 ? GLU A 791 ARG A 795 5 ? 5 HELX_P HELX_P14 14 SER A 262 ? LEU A 273 ? SER A 797 LEU A 808 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B ATP . O3G ? ? ? 1_555 C MG . MG ? ? A ATP 901 A MG 902 1_555 ? ? ? ? ? ? ? 1.890 ? metalc2 metalc ? ? B ATP . O2A ? ? ? 1_555 C MG . MG ? ? A ATP 901 A MG 902 1_555 ? ? ? ? ? ? ? 1.982 ? metalc3 metalc ? ? A ASN 143 OD1 ? ? ? 1_555 C MG . MG ? ? A ASN 678 A MG 902 1_555 ? ? ? ? ? ? ? 2.001 ? metalc4 metalc ? ? B ATP . O1B ? ? ? 1_555 C MG . MG ? ? A ATP 901 A MG 902 1_555 ? ? ? ? ? ? ? 2.167 ? metalc5 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 902 A HOH 1104 1_555 ? ? ? ? ? ? ? 2.221 ? metalc6 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 902 A HOH 1103 1_555 ? ? ? ? ? ? ? 2.337 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 181 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 716 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 182 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 717 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 7.22 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 10 ? GLY A 19 ? LEU A 545 GLY A 554 A 2 THR A 22 ? VAL A 32 ? THR A 557 VAL A 567 A 3 LEU A 38 ? ASP A 49 ? LEU A 573 ASP A 584 A 4 GLU A 86 ? GLU A 92 ? GLU A 621 GLU A 627 A 5 ASN A 77 ? CYS A 81 ? ASN A 612 CYS A 616 B 1 ILE A 144 ? ARG A 148 ? ILE A 679 ARG A 683 B 2 PHE A 159 ? LEU A 162 ? PHE A 694 LEU A 697 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 17 ? N GLY A 552 O ILE A 24 ? O ILE A 559 A 2 3 N GLU A 31 ? N GLU A 566 O HIS A 39 ? O HIS A 574 A 3 4 N LEU A 48 ? N LEU A 583 O ASN A 87 ? O ASN A 622 A 4 5 O VAL A 90 ? O VAL A 625 N GLY A 79 ? N GLY A 614 B 1 2 N LEU A 145 ? N LEU A 680 O LYS A 161 ? O LYS A 696 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE ATP A 901' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 902' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 23 LEU A 16 ? LEU A 551 . ? 1_555 ? 2 AC1 23 GLY A 19 ? GLY A 554 . ? 1_555 ? 3 AC1 23 THR A 20 ? THR A 555 . ? 1_555 ? 4 AC1 23 THR A 22 ? THR A 557 . ? 1_555 ? 5 AC1 23 ILE A 24 ? ILE A 559 . ? 1_555 ? 6 AC1 23 LEU A 44 ? LEU A 579 . ? 1_555 ? 7 AC1 23 LYS A 46 ? LYS A 581 . ? 1_555 ? 8 AC1 23 GLN A 91 ? GLN A 626 . ? 1_555 ? 9 AC1 23 GLU A 92 ? GLU A 627 . ? 1_555 ? 10 AC1 23 VAL A 94 ? VAL A 629 . ? 1_555 ? 11 AC1 23 SER A 98 ? SER A 633 . ? 1_555 ? 12 AC1 23 ASN A 138 ? ASN A 673 . ? 1_555 ? 13 AC1 23 LYS A 142 ? LYS A 677 . ? 1_555 ? 14 AC1 23 ASN A 143 ? ASN A 678 . ? 1_555 ? 15 AC1 23 LEU A 145 ? LEU A 680 . ? 1_555 ? 16 AC1 23 MG C . ? MG A 902 . ? 1_555 ? 17 AC1 23 HOH D . ? HOH A 1012 . ? 1_555 ? 18 AC1 23 HOH D . ? HOH A 1032 . ? 1_555 ? 19 AC1 23 HOH D . ? HOH A 1058 . ? 1_555 ? 20 AC1 23 HOH D . ? HOH A 1099 . ? 1_555 ? 21 AC1 23 HOH D . ? HOH A 1100 . ? 1_555 ? 22 AC1 23 HOH D . ? HOH A 1103 . ? 1_555 ? 23 AC1 23 HOH D . ? HOH A 1104 . ? 1_555 ? 24 AC2 4 ASN A 143 ? ASN A 678 . ? 1_555 ? 25 AC2 4 ATP B . ? ATP A 901 . ? 1_555 ? 26 AC2 4 HOH D . ? HOH A 1103 . ? 1_555 ? 27 AC2 4 HOH D . ? HOH A 1104 . ? 1_555 ? # _atom_sites.entry_id 4FVR _atom_sites.fract_transf_matrix[1][1] 0.021322 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008554 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017444 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017793 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 536 536 VAL VAL A . n A 1 2 PHE 2 537 537 PHE PHE A . n A 1 3 HIS 3 538 538 HIS HIS A . n A 1 4 LYS 4 539 539 LYS LYS A . n A 1 5 ILE 5 540 540 ILE ILE A . n A 1 6 ARG 6 541 541 ARG ARG A . n A 1 7 ASN 7 542 542 ASN ASN A . n A 1 8 GLU 8 543 543 GLU GLU A . n A 1 9 ASP 9 544 544 ASP ASP A . n A 1 10 LEU 10 545 545 LEU LEU A . n A 1 11 ILE 11 546 546 ILE ILE A . n A 1 12 PHE 12 547 547 PHE PHE A . n A 1 13 ASN 13 548 548 ASN ASN A . n A 1 14 GLU 14 549 549 GLU GLU A . n A 1 15 SER 15 550 550 SER SER A . n A 1 16 LEU 16 551 551 LEU LEU A . n A 1 17 GLY 17 552 552 GLY GLY A . n A 1 18 GLN 18 553 553 GLN GLN A . n A 1 19 GLY 19 554 554 GLY GLY A . n A 1 20 THR 20 555 555 THR THR A . n A 1 21 PHE 21 556 556 PHE PHE A . n A 1 22 THR 22 557 557 THR THR A . n A 1 23 LYS 23 558 558 LYS LYS A . n A 1 24 ILE 24 559 559 ILE ILE A . n A 1 25 PHE 25 560 560 PHE PHE A . n A 1 26 LYS 26 561 561 LYS LYS A . n A 1 27 GLY 27 562 562 GLY GLY A . n A 1 28 VAL 28 563 563 VAL VAL A . n A 1 29 ARG 29 564 564 ARG ARG A . n A 1 30 ARG 30 565 565 ARG ARG A . n A 1 31 GLU 31 566 566 GLU GLU A . n A 1 32 VAL 32 567 567 VAL VAL A . n A 1 33 GLY 33 568 568 GLY GLY A . n A 1 34 ASP 34 569 569 ASP ASP A . n A 1 35 TYR 35 570 570 TYR TYR A . n A 1 36 GLY 36 571 571 GLY GLY A . n A 1 37 GLN 37 572 572 GLN GLN A . n A 1 38 LEU 38 573 573 LEU LEU A . n A 1 39 HIS 39 574 574 HIS HIS A . n A 1 40 GLU 40 575 575 GLU GLU A . n A 1 41 THR 41 576 576 THR THR A . n A 1 42 GLU 42 577 577 GLU GLU A . n A 1 43 VAL 43 578 578 VAL VAL A . n A 1 44 LEU 44 579 579 LEU LEU A . n A 1 45 LEU 45 580 580 LEU LEU A . n A 1 46 LYS 46 581 581 LYS LYS A . n A 1 47 VAL 47 582 582 VAL VAL A . n A 1 48 LEU 48 583 583 LEU LEU A . n A 1 49 ASP 49 584 584 ASP ASP A . n A 1 50 LYS 50 585 585 LYS LYS A . n A 1 51 ALA 51 586 586 ALA ALA A . n A 1 52 HIS 52 587 587 HIS HIS A . n A 1 53 ARG 53 588 588 ARG ARG A . n A 1 54 ASN 54 589 589 ASN ASN A . n A 1 55 TYR 55 590 590 TYR TYR A . n A 1 56 SER 56 591 591 SER SER A . n A 1 57 GLU 57 592 592 GLU GLU A . n A 1 58 SER 58 593 593 SER SER A . n A 1 59 PHE 59 594 594 PHE PHE A . n A 1 60 PHE 60 595 595 PHE PHE A . n A 1 61 GLU 61 596 596 GLU GLU A . n A 1 62 ALA 62 597 597 ALA ALA A . n A 1 63 ALA 63 598 598 ALA ALA A . n A 1 64 SER 64 599 599 SER SER A . n A 1 65 MET 65 600 600 MET MET A . n A 1 66 MET 66 601 601 MET MET A . n A 1 67 SER 67 602 602 SER SER A . n A 1 68 LYS 68 603 603 LYS LYS A . n A 1 69 LEU 69 604 604 LEU LEU A . n A 1 70 SER 70 605 605 SER SER A . n A 1 71 HIS 71 606 606 HIS HIS A . n A 1 72 LYS 72 607 607 LYS LYS A . n A 1 73 HIS 73 608 608 HIS HIS A . n A 1 74 LEU 74 609 609 LEU LEU A . n A 1 75 VAL 75 610 610 VAL VAL A . n A 1 76 LEU 76 611 611 LEU LEU A . n A 1 77 ASN 77 612 612 ASN ASN A . n A 1 78 TYR 78 613 613 TYR TYR A . n A 1 79 GLY 79 614 614 GLY GLY A . n A 1 80 VAL 80 615 615 VAL VAL A . n A 1 81 CYS 81 616 616 CYS CYS A . n A 1 82 PHE 82 617 617 PHE PHE A . n A 1 83 CYS 83 618 618 CYS CYS A . n A 1 84 GLY 84 619 619 GLY GLY A . n A 1 85 ASP 85 620 620 ASP ASP A . n A 1 86 GLU 86 621 621 GLU GLU A . n A 1 87 ASN 87 622 622 ASN ASN A . n A 1 88 ILE 88 623 623 ILE ILE A . n A 1 89 LEU 89 624 624 LEU LEU A . n A 1 90 VAL 90 625 625 VAL VAL A . n A 1 91 GLN 91 626 626 GLN GLN A . n A 1 92 GLU 92 627 627 GLU GLU A . n A 1 93 PHE 93 628 628 PHE PHE A . n A 1 94 VAL 94 629 629 VAL VAL A . n A 1 95 LYS 95 630 630 LYS LYS A . n A 1 96 PHE 96 631 631 PHE PHE A . n A 1 97 GLY 97 632 632 GLY GLY A . n A 1 98 SER 98 633 633 SER SER A . n A 1 99 LEU 99 634 634 LEU LEU A . n A 1 100 ASP 100 635 635 ASP ASP A . n A 1 101 THR 101 636 636 THR THR A . n A 1 102 TYR 102 637 637 TYR TYR A . n A 1 103 LEU 103 638 638 LEU LEU A . n A 1 104 LYS 104 639 639 LYS LYS A . n A 1 105 LYS 105 640 640 LYS LYS A . n A 1 106 ASN 106 641 641 ASN ASN A . n A 1 107 LYS 107 642 642 LYS LYS A . n A 1 108 ASN 108 643 643 ASN ASN A . n A 1 109 CYS 109 644 644 CYS CYS A . n A 1 110 ILE 110 645 645 ILE ILE A . n A 1 111 ASN 111 646 646 ASN ASN A . n A 1 112 ILE 112 647 647 ILE ILE A . n A 1 113 LEU 113 648 648 LEU LEU A . n A 1 114 TRP 114 649 649 TRP TRP A . n A 1 115 LYS 115 650 650 LYS LYS A . n A 1 116 LEU 116 651 651 LEU LEU A . n A 1 117 GLU 117 652 652 GLU GLU A . n A 1 118 VAL 118 653 653 VAL VAL A . n A 1 119 ALA 119 654 654 ALA ALA A . n A 1 120 LYS 120 655 655 LYS LYS A . n A 1 121 GLN 121 656 656 GLN GLN A . n A 1 122 LEU 122 657 657 LEU LEU A . n A 1 123 ALA 123 658 658 ALA ALA A . n A 1 124 TRP 124 659 659 TRP TRP A . n A 1 125 ALA 125 660 660 ALA ALA A . n A 1 126 MET 126 661 661 MET MET A . n A 1 127 HIS 127 662 662 HIS HIS A . n A 1 128 PHE 128 663 663 PHE PHE A . n A 1 129 LEU 129 664 664 LEU LEU A . n A 1 130 GLU 130 665 665 GLU GLU A . n A 1 131 GLU 131 666 666 GLU GLU A . n A 1 132 ASN 132 667 667 ASN ASN A . n A 1 133 THR 133 668 668 THR THR A . n A 1 134 LEU 134 669 669 LEU LEU A . n A 1 135 ILE 135 670 670 ILE ILE A . n A 1 136 HIS 136 671 671 HIS HIS A . n A 1 137 GLY 137 672 672 GLY GLY A . n A 1 138 ASN 138 673 673 ASN ASN A . n A 1 139 VAL 139 674 674 VAL VAL A . n A 1 140 CYS 140 675 675 CYS CYS A . n A 1 141 ALA 141 676 676 ALA ALA A . n A 1 142 LYS 142 677 677 LYS LYS A . n A 1 143 ASN 143 678 678 ASN ASN A . n A 1 144 ILE 144 679 679 ILE ILE A . n A 1 145 LEU 145 680 680 LEU LEU A . n A 1 146 LEU 146 681 681 LEU LEU A . n A 1 147 ILE 147 682 682 ILE ILE A . n A 1 148 ARG 148 683 683 ARG ARG A . n A 1 149 GLU 149 684 684 GLU GLU A . n A 1 150 GLU 150 685 685 GLU GLU A . n A 1 151 ASP 151 686 686 ASP ASP A . n A 1 152 ARG 152 687 687 ARG ARG A . n A 1 153 LYS 153 688 688 LYS LYS A . n A 1 154 THR 154 689 689 THR THR A . n A 1 155 GLY 155 690 690 GLY GLY A . n A 1 156 ASN 156 691 691 ASN ASN A . n A 1 157 PRO 157 692 692 PRO PRO A . n A 1 158 PRO 158 693 693 PRO PRO A . n A 1 159 PHE 159 694 694 PHE PHE A . n A 1 160 ILE 160 695 695 ILE ILE A . n A 1 161 LYS 161 696 696 LYS LYS A . n A 1 162 LEU 162 697 697 LEU LEU A . n A 1 163 SER 163 698 698 SER SER A . n A 1 164 ASP 164 699 699 ASP ASP A . n A 1 165 PRO 165 700 700 PRO PRO A . n A 1 166 GLY 166 701 701 GLY GLY A . n A 1 167 ILE 167 702 702 ILE ILE A . n A 1 168 SER 168 703 703 SER SER A . n A 1 169 ILE 169 704 704 ILE ILE A . n A 1 170 THR 170 705 705 THR THR A . n A 1 171 VAL 171 706 706 VAL VAL A . n A 1 172 LEU 172 707 707 LEU LEU A . n A 1 173 PRO 173 708 708 PRO PRO A . n A 1 174 LYS 174 709 709 LYS LYS A . n A 1 175 ASP 175 710 710 ASP ASP A . n A 1 176 ILE 176 711 711 ILE ILE A . n A 1 177 LEU 177 712 712 LEU LEU A . n A 1 178 GLN 178 713 713 GLN GLN A . n A 1 179 GLU 179 714 714 GLU GLU A . n A 1 180 ARG 180 715 715 ARG ARG A . n A 1 181 ILE 181 716 716 ILE ILE A . n A 1 182 PRO 182 717 717 PRO PRO A . n A 1 183 TRP 183 718 718 TRP TRP A . n A 1 184 VAL 184 719 719 VAL VAL A . n A 1 185 PRO 185 720 720 PRO PRO A . n A 1 186 PRO 186 721 721 PRO PRO A . n A 1 187 GLU 187 722 722 GLU GLU A . n A 1 188 CYS 188 723 723 CYS CYS A . n A 1 189 ILE 189 724 724 ILE ILE A . n A 1 190 GLU 190 725 725 GLU GLU A . n A 1 191 ASN 191 726 726 ASN ASN A . n A 1 192 PRO 192 727 727 PRO PRO A . n A 1 193 LYS 193 728 728 LYS LYS A . n A 1 194 ASN 194 729 729 ASN ASN A . n A 1 195 LEU 195 730 730 LEU LEU A . n A 1 196 ASN 196 731 731 ASN ASN A . n A 1 197 LEU 197 732 732 LEU LEU A . n A 1 198 ALA 198 733 733 ALA ALA A . n A 1 199 THR 199 734 734 THR THR A . n A 1 200 ASP 200 735 735 ASP ASP A . n A 1 201 LYS 201 736 736 LYS LYS A . n A 1 202 TRP 202 737 737 TRP TRP A . n A 1 203 SER 203 738 738 SER SER A . n A 1 204 PHE 204 739 739 PHE PHE A . n A 1 205 GLY 205 740 740 GLY GLY A . n A 1 206 THR 206 741 741 THR THR A . n A 1 207 THR 207 742 742 THR THR A . n A 1 208 LEU 208 743 743 LEU LEU A . n A 1 209 TRP 209 744 744 TRP TRP A . n A 1 210 GLU 210 745 745 GLU GLU A . n A 1 211 ILE 211 746 746 ILE ILE A . n A 1 212 CYS 212 747 747 CYS CYS A . n A 1 213 SER 213 748 748 SER SER A . n A 1 214 GLY 214 749 749 GLY GLY A . n A 1 215 GLY 215 750 750 GLY GLY A . n A 1 216 ASP 216 751 751 ASP ASP A . n A 1 217 LYS 217 752 752 LYS LYS A . n A 1 218 PRO 218 753 753 PRO PRO A . n A 1 219 LEU 219 754 754 LEU LEU A . n A 1 220 SER 220 755 755 SER SER A . n A 1 221 ALA 221 756 756 ALA ALA A . n A 1 222 LEU 222 757 757 LEU LEU A . n A 1 223 ASP 223 758 758 ASP ASP A . n A 1 224 SER 224 759 759 SER SER A . n A 1 225 GLN 225 760 760 GLN GLN A . n A 1 226 ARG 226 761 761 ARG ARG A . n A 1 227 LYS 227 762 762 LYS LYS A . n A 1 228 LEU 228 763 763 LEU LEU A . n A 1 229 GLN 229 764 764 GLN GLN A . n A 1 230 PHE 230 765 765 PHE PHE A . n A 1 231 TYR 231 766 766 TYR TYR A . n A 1 232 GLU 232 767 767 GLU GLU A . n A 1 233 ASP 233 768 768 ASP ASP A . n A 1 234 ARG 234 769 769 ARG ARG A . n A 1 235 HIS 235 770 770 HIS HIS A . n A 1 236 GLN 236 771 771 GLN GLN A . n A 1 237 LEU 237 772 772 LEU LEU A . n A 1 238 PRO 238 773 773 PRO PRO A . n A 1 239 ALA 239 774 774 ALA ALA A . n A 1 240 PRO 240 775 775 PRO PRO A . n A 1 241 LYS 241 776 776 LYS LYS A . n A 1 242 ALA 242 777 777 ALA ALA A . n A 1 243 ALA 243 778 778 ALA ALA A . n A 1 244 GLU 244 779 779 GLU GLU A . n A 1 245 LEU 245 780 780 LEU LEU A . n A 1 246 ALA 246 781 781 ALA ALA A . n A 1 247 ASN 247 782 782 ASN ASN A . n A 1 248 LEU 248 783 783 LEU LEU A . n A 1 249 ILE 249 784 784 ILE ILE A . n A 1 250 ASN 250 785 785 ASN ASN A . n A 1 251 ASN 251 786 786 ASN ASN A . n A 1 252 CYS 252 787 787 CYS CYS A . n A 1 253 MET 253 788 788 MET MET A . n A 1 254 ASP 254 789 789 ASP ASP A . n A 1 255 TYR 255 790 790 TYR TYR A . n A 1 256 GLU 256 791 791 GLU GLU A . n A 1 257 PRO 257 792 792 PRO PRO A . n A 1 258 ASP 258 793 793 ASP ASP A . n A 1 259 HIS 259 794 794 HIS HIS A . n A 1 260 ARG 260 795 795 ARG ARG A . n A 1 261 PRO 261 796 796 PRO PRO A . n A 1 262 SER 262 797 797 SER SER A . n A 1 263 PHE 263 798 798 PHE PHE A . n A 1 264 ARG 264 799 799 ARG ARG A . n A 1 265 ALA 265 800 800 ALA ALA A . n A 1 266 ILE 266 801 801 ILE ILE A . n A 1 267 ILE 267 802 802 ILE ILE A . n A 1 268 ARG 268 803 803 ARG ARG A . n A 1 269 ASP 269 804 804 ASP ASP A . n A 1 270 LEU 270 805 805 LEU LEU A . n A 1 271 ASN 271 806 806 ASN ASN A . n A 1 272 SER 272 807 807 SER SER A . n A 1 273 LEU 273 808 808 LEU LEU A . n A 1 274 PHE 274 809 809 PHE PHE A . n A 1 275 THR 275 810 ? ? ? A . n A 1 276 PRO 276 811 ? ? ? A . n A 1 277 ASP 277 812 ? ? ? A . n A 1 278 LEU 278 813 ? ? ? A . n A 1 279 VAL 279 814 ? ? ? A . n A 1 280 PRO 280 815 ? ? ? A . n A 1 281 ARG 281 816 ? ? ? A . n A 1 282 GLY 282 817 ? ? ? A . n A 1 283 SER 283 818 ? ? ? A . n A 1 284 HIS 284 819 ? ? ? A . n A 1 285 HIS 285 820 ? ? ? A . n A 1 286 HIS 286 821 ? ? ? A . n A 1 287 HIS 287 822 ? ? ? A . n A 1 288 HIS 288 823 ? ? ? A . n A 1 289 HIS 289 824 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ATP 1 901 1 ATP ATP A . C 3 MG 1 902 1 MG MG A . D 4 HOH 1 1001 1 HOH HOH A . D 4 HOH 2 1002 2 HOH HOH A . D 4 HOH 3 1003 3 HOH HOH A . D 4 HOH 4 1004 4 HOH HOH A . D 4 HOH 5 1005 5 HOH HOH A . D 4 HOH 6 1006 6 HOH HOH A . D 4 HOH 7 1007 7 HOH HOH A . D 4 HOH 8 1008 8 HOH HOH A . D 4 HOH 9 1009 9 HOH HOH A . D 4 HOH 10 1010 10 HOH HOH A . D 4 HOH 11 1011 11 HOH HOH A . D 4 HOH 12 1012 12 HOH HOH A . D 4 HOH 13 1013 13 HOH HOH A . D 4 HOH 14 1014 14 HOH HOH A . D 4 HOH 15 1015 15 HOH HOH A . D 4 HOH 16 1016 16 HOH HOH A . D 4 HOH 17 1017 17 HOH HOH A . D 4 HOH 18 1018 18 HOH HOH A . D 4 HOH 19 1019 19 HOH HOH A . D 4 HOH 20 1020 20 HOH HOH A . D 4 HOH 21 1021 21 HOH HOH A . D 4 HOH 22 1022 22 HOH HOH A . D 4 HOH 23 1023 23 HOH HOH A . D 4 HOH 24 1024 24 HOH HOH A . D 4 HOH 25 1025 25 HOH HOH A . D 4 HOH 26 1026 26 HOH HOH A . D 4 HOH 27 1027 27 HOH HOH A . D 4 HOH 28 1028 28 HOH HOH A . D 4 HOH 29 1029 29 HOH HOH A . D 4 HOH 30 1030 30 HOH HOH A . D 4 HOH 31 1031 31 HOH HOH A . D 4 HOH 32 1032 32 HOH HOH A . D 4 HOH 33 1033 33 HOH HOH A . D 4 HOH 34 1034 34 HOH HOH A . D 4 HOH 35 1035 35 HOH HOH A . D 4 HOH 36 1036 36 HOH HOH A . D 4 HOH 37 1037 37 HOH HOH A . D 4 HOH 38 1038 38 HOH HOH A . D 4 HOH 39 1039 39 HOH HOH A . D 4 HOH 40 1040 40 HOH HOH A . D 4 HOH 41 1041 41 HOH HOH A . D 4 HOH 42 1042 42 HOH HOH A . D 4 HOH 43 1043 43 HOH HOH A . D 4 HOH 44 1044 44 HOH HOH A . D 4 HOH 45 1045 45 HOH HOH A . D 4 HOH 46 1046 46 HOH HOH A . D 4 HOH 47 1047 47 HOH HOH A . D 4 HOH 48 1048 48 HOH HOH A . D 4 HOH 49 1049 49 HOH HOH A . D 4 HOH 50 1050 50 HOH HOH A . D 4 HOH 51 1051 51 HOH HOH A . D 4 HOH 52 1052 52 HOH HOH A . D 4 HOH 53 1053 53 HOH HOH A . D 4 HOH 54 1054 54 HOH HOH A . D 4 HOH 55 1055 55 HOH HOH A . D 4 HOH 56 1056 56 HOH HOH A . D 4 HOH 57 1057 57 HOH HOH A . D 4 HOH 58 1058 58 HOH HOH A . D 4 HOH 59 1059 59 HOH HOH A . D 4 HOH 60 1060 60 HOH HOH A . D 4 HOH 61 1061 61 HOH HOH A . D 4 HOH 62 1062 62 HOH HOH A . D 4 HOH 63 1063 63 HOH HOH A . D 4 HOH 64 1064 64 HOH HOH A . D 4 HOH 65 1065 65 HOH HOH A . D 4 HOH 66 1066 66 HOH HOH A . D 4 HOH 67 1067 67 HOH HOH A . D 4 HOH 68 1068 68 HOH HOH A . D 4 HOH 69 1069 69 HOH HOH A . D 4 HOH 70 1070 70 HOH HOH A . D 4 HOH 71 1071 71 HOH HOH A . D 4 HOH 72 1072 72 HOH HOH A . D 4 HOH 73 1073 73 HOH HOH A . D 4 HOH 74 1074 74 HOH HOH A . D 4 HOH 75 1075 75 HOH HOH A . D 4 HOH 76 1076 76 HOH HOH A . D 4 HOH 77 1077 77 HOH HOH A . D 4 HOH 78 1078 78 HOH HOH A . D 4 HOH 79 1079 79 HOH HOH A . D 4 HOH 80 1080 80 HOH HOH A . D 4 HOH 81 1081 81 HOH HOH A . D 4 HOH 82 1082 82 HOH HOH A . D 4 HOH 83 1083 83 HOH HOH A . D 4 HOH 84 1084 84 HOH HOH A . D 4 HOH 85 1085 85 HOH HOH A . D 4 HOH 86 1086 86 HOH HOH A . D 4 HOH 87 1087 87 HOH HOH A . D 4 HOH 88 1088 88 HOH HOH A . D 4 HOH 89 1089 89 HOH HOH A . D 4 HOH 90 1090 90 HOH HOH A . D 4 HOH 91 1091 91 HOH HOH A . D 4 HOH 92 1092 92 HOH HOH A . D 4 HOH 93 1093 93 HOH HOH A . D 4 HOH 94 1094 94 HOH HOH A . D 4 HOH 95 1095 95 HOH HOH A . D 4 HOH 96 1096 96 HOH HOH A . D 4 HOH 97 1097 97 HOH HOH A . D 4 HOH 98 1098 98 HOH HOH A . D 4 HOH 99 1099 99 HOH HOH A . D 4 HOH 100 1100 100 HOH HOH A . D 4 HOH 101 1101 101 HOH HOH A . D 4 HOH 102 1102 102 HOH HOH A . D 4 HOH 103 1103 103 HOH HOH A . D 4 HOH 104 1104 104 HOH HOH A . D 4 HOH 105 1105 105 HOH HOH A . D 4 HOH 106 1106 106 HOH HOH A . D 4 HOH 107 1107 107 HOH HOH A . D 4 HOH 108 1108 108 HOH HOH A . D 4 HOH 109 1109 109 HOH HOH A . D 4 HOH 110 1110 110 HOH HOH A . D 4 HOH 111 1111 111 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O3G ? B ATP . ? A ATP 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O2A ? B ATP . ? A ATP 901 ? 1_555 93.5 ? 2 O3G ? B ATP . ? A ATP 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 OD1 ? A ASN 143 ? A ASN 678 ? 1_555 96.8 ? 3 O2A ? B ATP . ? A ATP 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 OD1 ? A ASN 143 ? A ASN 678 ? 1_555 106.3 ? 4 O3G ? B ATP . ? A ATP 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O1B ? B ATP . ? A ATP 901 ? 1_555 88.7 ? 5 O2A ? B ATP . ? A ATP 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O1B ? B ATP . ? A ATP 901 ? 1_555 80.9 ? 6 OD1 ? A ASN 143 ? A ASN 678 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O1B ? B ATP . ? A ATP 901 ? 1_555 170.6 ? 7 O3G ? B ATP . ? A ATP 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? D HOH . ? A HOH 1104 ? 1_555 97.8 ? 8 O2A ? B ATP . ? A ATP 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? D HOH . ? A HOH 1104 ? 1_555 159.0 ? 9 OD1 ? A ASN 143 ? A ASN 678 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? D HOH . ? A HOH 1104 ? 1_555 90.0 ? 10 O1B ? B ATP . ? A ATP 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? D HOH . ? A HOH 1104 ? 1_555 81.7 ? 11 O3G ? B ATP . ? A ATP 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? D HOH . ? A HOH 1103 ? 1_555 173.6 ? 12 O2A ? B ATP . ? A ATP 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? D HOH . ? A HOH 1103 ? 1_555 82.3 ? 13 OD1 ? A ASN 143 ? A ASN 678 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? D HOH . ? A HOH 1103 ? 1_555 89.1 ? 14 O1B ? B ATP . ? A ATP 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? D HOH . ? A HOH 1103 ? 1_555 85.9 ? 15 O ? D HOH . ? A HOH 1104 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? D HOH . ? A HOH 1103 ? 1_555 84.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-07-25 2 'Structure model' 1 1 2012-08-08 3 'Structure model' 1 2 2012-08-22 4 'Structure model' 1 3 2017-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 4.2960 -24.2770 26.6860 0.1347 0.0754 0.0852 -0.0133 0.0141 0.0379 4.2354 4.4425 1.7610 1.3966 1.5828 -0.6808 0.1548 0.0422 -0.1970 -0.1409 -0.2259 -0.0056 0.1996 0.0574 -0.1680 'X-RAY DIFFRACTION' 2 ? refined 6.4130 -24.4400 22.6960 0.1390 0.0874 0.1537 -0.0054 -0.0035 0.0353 0.6748 3.8161 0.6823 -0.1083 0.3982 -0.3125 0.0633 0.0176 -0.0809 -0.1124 -0.1969 0.0739 0.0238 0.0446 -0.1572 'X-RAY DIFFRACTION' 3 ? refined 11.1090 -33.0900 19.6420 0.2327 0.2742 0.3589 0.0507 0.0423 -0.0668 4.4107 30.8720 5.2190 5.7172 4.7734 7.2495 0.1917 0.4445 -0.6362 0.6579 -0.5464 -1.2167 -0.2710 0.1551 0.7028 'X-RAY DIFFRACTION' 4 ? refined 1.7140 -17.1010 27.7850 0.2068 0.2277 0.1069 0.0085 0.0419 0.0172 8.8219 4.4727 7.3397 0.0411 -2.8771 1.3888 -0.0613 0.0588 0.0024 -0.3840 0.1257 0.0128 0.4942 -0.1656 -0.3176 'X-RAY DIFFRACTION' 5 ? refined -8.2890 -12.1640 31.0940 0.2627 0.4884 0.2038 0.0169 0.1393 -0.0308 4.3953 22.6634 4.4810 -5.4492 -1.5545 -5.9800 -0.1995 0.0609 0.1386 0.1347 -0.2048 0.1194 1.7729 -0.6899 -0.1812 'X-RAY DIFFRACTION' 6 ? refined -2.6400 -19.4440 17.1600 0.0479 0.1392 0.1286 -0.0168 0.0502 0.0130 0.9707 1.0650 2.8528 -0.1363 0.1092 -0.2875 0.0164 0.0678 -0.0842 -0.1396 -0.1540 0.1187 0.0937 0.1611 -0.1719 'X-RAY DIFFRACTION' 7 ? refined 10.3810 -14.7170 18.4010 0.0488 0.1255 0.1293 0.0322 0.0241 -0.0175 3.1903 2.8801 2.4797 1.8442 -0.7330 -1.3454 -0.0349 0.0165 0.0184 -0.0876 0.0515 -0.1212 0.0852 0.0089 0.0688 'X-RAY DIFFRACTION' 8 ? refined 21.4460 -2.7510 7.4770 0.1300 0.7297 0.5522 0.0832 0.1117 0.3632 1.1252 8.0553 16.4315 2.9806 4.1297 11.3889 -0.1915 0.4008 -0.2093 0.0763 -0.2148 -0.3338 -0.1506 -0.1062 1.1487 'X-RAY DIFFRACTION' 9 ? refined 8.1930 -7.3840 1.6560 0.0675 0.1502 0.0797 0.0293 0.0654 0.0038 10.5550 2.7581 0.7651 1.3972 -0.6179 -0.4674 -0.0625 0.0477 0.0147 0.2080 0.0406 -0.1725 -0.2731 0.0459 0.1198 'X-RAY DIFFRACTION' 10 ? refined 2.0730 -10.4110 9.5850 0.0609 0.1177 0.0655 -0.0042 0.0586 0.0201 2.7739 2.7547 1.9906 -1.0515 1.1937 0.4368 -0.0285 0.0133 0.0151 -0.0462 0.0404 -0.0165 0.0735 0.0012 -0.0389 'X-RAY DIFFRACTION' 11 ? refined 21.7100 -14.2920 0.2840 0.3575 0.7592 0.4961 0.1390 0.2240 -0.0629 38.8202 24.5393 38.5681 -12.4446 15.5784 4.8531 0.9051 -0.2507 -0.6544 2.9552 -0.1358 -2.0352 -1.6131 0.4415 2.9882 'X-RAY DIFFRACTION' 12 ? refined 4.6190 -12.6830 12.1840 0.0529 0.1437 0.1368 -0.0017 0.0437 -0.0126 5.5403 1.6992 5.0224 -1.5030 -2.8508 0.8085 -0.0881 0.2283 -0.1402 0.0493 0.2054 -0.0538 0.1857 0.1820 0.0464 'X-RAY DIFFRACTION' 13 ? refined -4.1500 1.6040 20.7830 0.1631 0.2424 0.1282 0.1067 0.0697 -0.0320 2.9654 3.9376 2.8617 0.2438 -1.4315 -3.0317 -0.2262 0.2372 -0.0110 -0.2669 -0.0740 0.0661 0.4229 -0.2304 -0.0807 'X-RAY DIFFRACTION' 14 ? refined -11.6740 1.6610 14.9690 0.1456 0.3343 0.2074 0.1125 0.0868 0.0035 6.0974 5.7541 10.8641 -2.2811 -4.9176 6.2753 -0.3446 -0.2794 0.6240 -0.0395 -0.2318 0.4231 -0.1411 0.1303 -0.9239 'X-RAY DIFFRACTION' 15 ? refined 4.1730 1.1420 9.1950 0.0709 0.1312 0.1054 0.0206 0.0511 -0.0081 3.2067 1.8570 1.6663 -0.9664 1.5144 -0.7621 -0.0876 0.0344 0.0532 -0.0041 0.1475 -0.1057 0.2209 -0.1047 0.0116 'X-RAY DIFFRACTION' 16 ? refined 7.9890 7.7790 20.2760 0.1335 0.0897 0.1565 0.0288 -0.0337 -0.0141 2.3059 5.2203 4.2695 0.1874 0.6595 0.1443 -0.4008 0.1310 0.2698 -0.1207 0.0647 -0.0292 0.1340 -0.3270 0.1857 'X-RAY DIFFRACTION' 17 ? refined -1.7270 14.2930 17.8450 0.1720 0.1102 0.1703 0.1224 -0.0778 -0.0826 4.4939 5.8994 14.4286 2.2353 3.6067 3.8980 -0.2957 -0.0100 0.3057 -0.4808 0.6326 0.0545 0.0791 -0.6598 -0.6980 'X-RAY DIFFRACTION' 18 ? refined 10.3960 8.5880 5.7780 0.1450 0.0868 0.2248 -0.0199 -0.0440 0.0758 7.0986 2.0943 6.0453 2.2799 -0.9332 0.4091 -0.2467 -0.0019 0.2486 0.1750 0.3567 -0.3393 -0.0142 -0.2478 0.4713 'X-RAY DIFFRACTION' 19 ? refined -2.5390 5.0770 2.8860 0.0965 0.1348 0.1127 0.0085 0.0359 0.0111 2.0295 0.3852 1.5505 -0.0701 0.6607 0.1405 0.0073 0.0644 -0.0717 0.0577 0.0701 0.0071 0.0611 0.0526 -0.1195 'X-RAY DIFFRACTION' 20 ? refined 5.7060 -1.9270 -5.6530 0.2205 0.1939 0.1219 0.0094 0.0538 0.0392 12.2201 3.9695 12.3121 -2.7359 -2.0905 2.1163 0.5800 -0.1537 -0.4263 0.7295 0.7130 0.0157 -0.6521 -0.4762 0.3617 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 536 A 554 ? . . . . ? 'X-RAY DIFFRACTION' 2 2 A 555 A 570 ? . . . . ? 'X-RAY DIFFRACTION' 3 3 A 571 A 578 ? . . . . ? 'X-RAY DIFFRACTION' 4 4 A 579 A 585 ? . . . . ? 'X-RAY DIFFRACTION' 5 5 A 586 A 591 ? . . . . ? 'X-RAY DIFFRACTION' 6 6 A 592 A 620 ? . . . . ? 'X-RAY DIFFRACTION' 7 7 A 621 A 639 ? . . . . ? 'X-RAY DIFFRACTION' 8 8 A 640 A 647 ? . . . . ? 'X-RAY DIFFRACTION' 9 9 A 648 A 662 ? . . . . ? 'X-RAY DIFFRACTION' 10 10 A 663 A 684 ? . . . . ? 'X-RAY DIFFRACTION' 11 11 A 685 A 692 ? . . . . ? 'X-RAY DIFFRACTION' 12 12 A 693 A 702 ? . . . . ? 'X-RAY DIFFRACTION' 13 13 A 703 A 723 ? . . . . ? 'X-RAY DIFFRACTION' 14 14 A 724 A 732 ? . . . . ? 'X-RAY DIFFRACTION' 15 15 A 733 A 749 ? . . . . ? 'X-RAY DIFFRACTION' 16 16 A 750 A 759 ? . . . . ? 'X-RAY DIFFRACTION' 17 17 A 760 A 770 ? . . . . ? 'X-RAY DIFFRACTION' 18 18 A 771 A 780 ? . . . . ? 'X-RAY DIFFRACTION' 19 19 A 781 A 800 ? . . . . ? 'X-RAY DIFFRACTION' 20 20 A 801 A 809 ? . . . . ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 d*TREK . ? package 'Jim W. Pflugrath' Jim.Pflugrath@Rigaku.com 'data scaling' http://www.rigaku.com/software/dtrek.html ? ? 2 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 3 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 4 PHASER . ? program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 5 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 6 PDB_EXTRACT 3.11 'August 3, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 7 CrystalClear . ? ? ? ? 'data collection' ? ? ? 8 HKL-3000 . ? ? ? ? 'data reduction' ? ? ? 9 HKL-3000 . ? ? ? ? 'data scaling' ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 548 ? ? -112.03 -128.58 2 1 THR A 668 ? ? 38.19 47.76 3 1 ASN A 673 ? ? -154.72 42.38 4 1 LEU A 808 ? ? -77.42 30.94 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 553 ? CG ? A GLN 18 CG 2 1 Y 1 A GLN 553 ? CD ? A GLN 18 CD 3 1 Y 1 A GLN 553 ? OE1 ? A GLN 18 OE1 4 1 Y 1 A GLN 553 ? NE2 ? A GLN 18 NE2 5 1 Y 1 A LYS 558 ? CG ? A LYS 23 CG 6 1 Y 1 A LYS 558 ? CD ? A LYS 23 CD 7 1 Y 1 A LYS 558 ? CE ? A LYS 23 CE 8 1 Y 1 A LYS 558 ? NZ ? A LYS 23 NZ 9 1 Y 1 A ARG 565 ? CG ? A ARG 30 CG 10 1 Y 1 A ARG 565 ? CD ? A ARG 30 CD 11 1 Y 1 A ARG 565 ? NE ? A ARG 30 NE 12 1 Y 1 A ARG 565 ? CZ ? A ARG 30 CZ 13 1 Y 1 A ARG 565 ? NH1 ? A ARG 30 NH1 14 1 Y 1 A ARG 565 ? NH2 ? A ARG 30 NH2 15 1 Y 1 A GLU 596 ? CG ? A GLU 61 CG 16 1 Y 1 A GLU 596 ? CD ? A GLU 61 CD 17 1 Y 1 A GLU 596 ? OE1 ? A GLU 61 OE1 18 1 Y 1 A GLU 596 ? OE2 ? A GLU 61 OE2 19 1 Y 1 A LYS 639 ? CG ? A LYS 104 CG 20 1 Y 1 A LYS 639 ? CD ? A LYS 104 CD 21 1 Y 1 A LYS 639 ? CE ? A LYS 104 CE 22 1 Y 1 A LYS 639 ? NZ ? A LYS 104 NZ 23 1 Y 1 A LYS 640 ? CG ? A LYS 105 CG 24 1 Y 1 A LYS 640 ? CD ? A LYS 105 CD 25 1 Y 1 A LYS 640 ? CE ? A LYS 105 CE 26 1 Y 1 A LYS 640 ? NZ ? A LYS 105 NZ 27 1 Y 1 A LYS 642 ? CG ? A LYS 107 CG 28 1 Y 1 A LYS 642 ? CD ? A LYS 107 CD 29 1 Y 1 A LYS 642 ? CE ? A LYS 107 CE 30 1 Y 1 A LYS 642 ? NZ ? A LYS 107 NZ 31 1 Y 1 A ASN 643 ? CG ? A ASN 108 CG 32 1 Y 1 A ASN 643 ? OD1 ? A ASN 108 OD1 33 1 Y 1 A ASN 643 ? ND2 ? A ASN 108 ND2 34 1 Y 1 A ARG 687 ? CG ? A ARG 152 CG 35 1 Y 1 A ARG 687 ? CD ? A ARG 152 CD 36 1 Y 1 A ARG 687 ? NE ? A ARG 152 NE 37 1 Y 1 A ARG 687 ? CZ ? A ARG 152 CZ 38 1 Y 1 A ARG 687 ? NH1 ? A ARG 152 NH1 39 1 Y 1 A ARG 687 ? NH2 ? A ARG 152 NH2 40 1 Y 1 A LYS 688 ? CG ? A LYS 153 CG 41 1 Y 1 A LYS 688 ? CD ? A LYS 153 CD 42 1 Y 1 A LYS 688 ? CE ? A LYS 153 CE 43 1 Y 1 A LYS 688 ? NZ ? A LYS 153 NZ 44 1 Y 1 A LYS 709 ? CG ? A LYS 174 CG 45 1 Y 1 A LYS 709 ? CD ? A LYS 174 CD 46 1 Y 1 A LYS 709 ? CE ? A LYS 174 CE 47 1 Y 1 A LYS 709 ? NZ ? A LYS 174 NZ 48 1 Y 1 A LYS 728 ? CG ? A LYS 193 CG 49 1 Y 1 A LYS 728 ? CD ? A LYS 193 CD 50 1 Y 1 A LYS 728 ? CE ? A LYS 193 CE 51 1 Y 1 A LYS 728 ? NZ ? A LYS 193 NZ 52 1 Y 1 A GLU 767 ? CG ? A GLU 232 CG 53 1 Y 1 A GLU 767 ? CD ? A GLU 232 CD 54 1 Y 1 A GLU 767 ? OE1 ? A GLU 232 OE1 55 1 Y 1 A GLU 767 ? OE2 ? A GLU 232 OE2 56 1 Y 1 A LYS 776 ? CG ? A LYS 241 CG 57 1 Y 1 A LYS 776 ? CD ? A LYS 241 CD 58 1 Y 1 A LYS 776 ? CE ? A LYS 241 CE 59 1 Y 1 A LYS 776 ? NZ ? A LYS 241 NZ 60 1 Y 1 A ARG 799 ? CG ? A ARG 264 CG 61 1 Y 1 A ARG 799 ? CD ? A ARG 264 CD 62 1 Y 1 A ARG 799 ? NE ? A ARG 264 NE 63 1 Y 1 A ARG 799 ? CZ ? A ARG 264 CZ 64 1 Y 1 A ARG 799 ? NH1 ? A ARG 264 NH1 65 1 Y 1 A ARG 799 ? NH2 ? A ARG 264 NH2 66 1 Y 1 A PHE 809 ? CG ? A PHE 274 CG 67 1 Y 1 A PHE 809 ? CD1 ? A PHE 274 CD1 68 1 Y 1 A PHE 809 ? CD2 ? A PHE 274 CD2 69 1 Y 1 A PHE 809 ? CE1 ? A PHE 274 CE1 70 1 Y 1 A PHE 809 ? CE2 ? A PHE 274 CE2 71 1 Y 1 A PHE 809 ? CZ ? A PHE 274 CZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 810 ? A THR 275 2 1 Y 1 A PRO 811 ? A PRO 276 3 1 Y 1 A ASP 812 ? A ASP 277 4 1 Y 1 A LEU 813 ? A LEU 278 5 1 Y 1 A VAL 814 ? A VAL 279 6 1 Y 1 A PRO 815 ? A PRO 280 7 1 Y 1 A ARG 816 ? A ARG 281 8 1 Y 1 A GLY 817 ? A GLY 282 9 1 Y 1 A SER 818 ? A SER 283 10 1 Y 1 A HIS 819 ? A HIS 284 11 1 Y 1 A HIS 820 ? A HIS 285 12 1 Y 1 A HIS 821 ? A HIS 286 13 1 Y 1 A HIS 822 ? A HIS 287 14 1 Y 1 A HIS 823 ? A HIS 288 15 1 Y 1 A HIS 824 ? A HIS 289 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "ADENOSINE-5'-TRIPHOSPHATE" ATP 3 'MAGNESIUM ION' MG 4 water HOH #