data_4H1D # _entry.id 4H1D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4H1D RCSB RCSB074895 WWPDB D_1000074895 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4H1D _pdbx_database_status.recvd_initial_deposition_date 2012-09-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xue, Y.' 1 'Ha, Y.' 2 # _citation.id primary _citation.title ;Large lateral movement of transmembrane helix s5 is not required for substrate access to the active site of rhomboid intramembrane protease. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 288 _citation.page_first 16645 _citation.page_last 16654 _citation.year 2013 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23609444 _citation.pdbx_database_id_DOI 10.1074/jbc.M112.438127 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Xue, Y.' 1 primary 'Ha, Y.' 2 # _cell.entry_id 4H1D _cell.length_a 110.073 _cell.length_b 110.073 _cell.length_c 123.995 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4H1D _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Rhomboid protease GlpG' 20214.020 1 3.4.21.105 ? 'UNP Residues 92-270' ? 2 non-polymer syn 'DIISOPROPYL PHOSPHONATE' 166.155 1 ? ? ? ? 3 water nat water 18.015 27 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Intramembrane serine protease' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGS GKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMAN GAHIAGLAVGLAMAFVDSL ; _entity_poly.pdbx_seq_one_letter_code_can ;RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGS GKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMAN GAHIAGLAVGLAMAFVDSL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 ALA n 1 3 GLY n 1 4 PRO n 1 5 VAL n 1 6 THR n 1 7 TRP n 1 8 VAL n 1 9 MET n 1 10 MET n 1 11 ILE n 1 12 ALA n 1 13 CYS n 1 14 VAL n 1 15 VAL n 1 16 VAL n 1 17 PHE n 1 18 ILE n 1 19 ALA n 1 20 MET n 1 21 GLN n 1 22 ILE n 1 23 LEU n 1 24 GLY n 1 25 ASP n 1 26 GLN n 1 27 GLU n 1 28 VAL n 1 29 MET n 1 30 LEU n 1 31 TRP n 1 32 LEU n 1 33 ALA n 1 34 TRP n 1 35 PRO n 1 36 PHE n 1 37 ASP n 1 38 PRO n 1 39 THR n 1 40 LEU n 1 41 LYS n 1 42 PHE n 1 43 GLU n 1 44 PHE n 1 45 TRP n 1 46 ARG n 1 47 TYR n 1 48 PHE n 1 49 THR n 1 50 HIS n 1 51 ALA n 1 52 LEU n 1 53 MET n 1 54 HIS n 1 55 PHE n 1 56 SER n 1 57 LEU n 1 58 MET n 1 59 HIS n 1 60 ILE n 1 61 LEU n 1 62 PHE n 1 63 ASN n 1 64 LEU n 1 65 LEU n 1 66 TRP n 1 67 TRP n 1 68 TRP n 1 69 TYR n 1 70 LEU n 1 71 GLY n 1 72 GLY n 1 73 ALA n 1 74 VAL n 1 75 GLU n 1 76 LYS n 1 77 ARG n 1 78 LEU n 1 79 GLY n 1 80 SER n 1 81 GLY n 1 82 LYS n 1 83 LEU n 1 84 ILE n 1 85 VAL n 1 86 ILE n 1 87 THR n 1 88 LEU n 1 89 ILE n 1 90 SER n 1 91 ALA n 1 92 LEU n 1 93 LEU n 1 94 SER n 1 95 GLY n 1 96 TYR n 1 97 VAL n 1 98 GLN n 1 99 GLN n 1 100 LYS n 1 101 PHE n 1 102 SER n 1 103 GLY n 1 104 PRO n 1 105 TRP n 1 106 PHE n 1 107 GLY n 1 108 GLY n 1 109 LEU n 1 110 SER n 1 111 GLY n 1 112 VAL n 1 113 VAL n 1 114 TYR n 1 115 ALA n 1 116 LEU n 1 117 MET n 1 118 GLY n 1 119 TYR n 1 120 VAL n 1 121 TRP n 1 122 LEU n 1 123 ARG n 1 124 GLY n 1 125 GLU n 1 126 ARG n 1 127 ASP n 1 128 PRO n 1 129 GLN n 1 130 SER n 1 131 GLY n 1 132 ILE n 1 133 TYR n 1 134 LEU n 1 135 GLN n 1 136 ARG n 1 137 GLY n 1 138 LEU n 1 139 ILE n 1 140 ILE n 1 141 PHE n 1 142 ALA n 1 143 LEU n 1 144 ILE n 1 145 TRP n 1 146 ILE n 1 147 VAL n 1 148 ALA n 1 149 GLY n 1 150 TRP n 1 151 PHE n 1 152 ASP n 1 153 LEU n 1 154 PHE n 1 155 GLY n 1 156 MET n 1 157 SER n 1 158 MET n 1 159 ALA n 1 160 ASN n 1 161 GLY n 1 162 ALA n 1 163 HIS n 1 164 ILE n 1 165 ALA n 1 166 GLY n 1 167 LEU n 1 168 ALA n 1 169 VAL n 1 170 GLY n 1 171 LEU n 1 172 ALA n 1 173 MET n 1 174 ALA n 1 175 PHE n 1 176 VAL n 1 177 ASP n 1 178 SER n 1 179 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'glpG, b3424, JW5687' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLPG_ECOLI _struct_ref.pdbx_db_accession P09391 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGS GKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMAN GAHIAGLAVGLAMAFVDSL ; _struct_ref.pdbx_align_begin 92 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4H1D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 179 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P09391 _struct_ref_seq.db_align_beg 92 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 270 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 92 _struct_ref_seq.pdbx_auth_seq_align_end 270 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DFP non-polymer . 'DIISOPROPYL PHOSPHONATE' ? 'C6 H15 O3 P' 166.155 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4H1D _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.58 _exptl_crystal.density_percent_sol 65.60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pdbx_details ;0.1 M bis-tris propane 1.5 M NH4Cl, pH 7, EVAPORATION, temperature 298K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2011-12-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X25' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X25 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.1 # _reflns.entry_id 4H1D _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 40 _reflns.d_resolution_high 2.8975 _reflns.number_obs 6580 _reflns.number_all 6580 _reflns.percent_possible_obs 99 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 4H1D _refine.ls_number_reflns_obs 6580 _refine.ls_number_reflns_all 6580 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.92 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 37.787 _refine.ls_d_res_high 2.8975 _refine.ls_percent_reflns_obs 99.71 _refine.ls_R_factor_obs 0.2339 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2322 _refine.ls_R_factor_R_free 0.2693 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.73 _refine.ls_number_reflns_R_free 311 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] -14.6827 _refine.aniso_B[2][2] -14.6827 _refine.aniso_B[3][3] 29.3653 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.296 _refine.solvent_model_param_bsol 69.251 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.36 _refine.pdbx_overall_phase_error 32.59 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1354 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 1391 _refine_hist.d_res_high 2.8975 _refine_hist.d_res_low 37.787 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.009 ? ? 1410 ? 'X-RAY DIFFRACTION' f_angle_d 1.158 ? ? 1922 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 17.293 ? ? 461 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.068 ? ? 210 ? 'X-RAY DIFFRACTION' f_plane_restr 0.005 ? ? 226 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 2.8975 3.6501 3064 0.2087 100.00 0.2668 . . 162 . . . . 'X-RAY DIFFRACTION' . 3.6501 37.7901 3205 0.2391 100.00 0.2702 . . 149 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 4H1D _struct.title 'Cocrystal structure of GlpG and DFP' _struct.pdbx_descriptor 'Rhomboid protease GlpG (E.C.3.4.21.105)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4H1D _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'intramembrane protease, serine protease, DFP, membrane protein, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 3 ? GLY A 24 ? GLY A 94 GLY A 115 1 ? 22 HELX_P HELX_P2 2 GLY A 24 ? ALA A 33 ? GLY A 115 ALA A 124 1 ? 10 HELX_P HELX_P3 3 ASP A 37 ? LYS A 41 ? ASP A 128 LYS A 132 5 ? 5 HELX_P HELX_P4 4 TRP A 45 ? HIS A 50 ? TRP A 136 HIS A 141 1 ? 6 HELX_P HELX_P5 5 ALA A 51 ? MET A 53 ? ALA A 142 MET A 144 5 ? 3 HELX_P HELX_P6 6 SER A 56 ? GLY A 79 ? SER A 147 GLY A 170 1 ? 24 HELX_P HELX_P7 7 GLY A 79 ? SER A 102 ? GLY A 170 SER A 193 1 ? 24 HELX_P HELX_P8 8 LEU A 109 ? ASP A 127 ? LEU A 200 ASP A 218 1 ? 19 HELX_P HELX_P9 9 PRO A 128 ? GLY A 131 ? PRO A 219 GLY A 222 5 ? 4 HELX_P HELX_P10 10 GLN A 135 ? PHE A 151 ? GLN A 226 PHE A 242 1 ? 17 HELX_P HELX_P11 11 ALA A 162 ? SER A 178 ? ALA A 253 SER A 269 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 110 _struct_conn.ptnr1_label_atom_id OG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id DFP _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id P _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 201 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id DFP _struct_conn.ptnr2_auth_seq_id 301 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.628 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'BINDING SITE FOR RESIDUE DFP A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 HIS A 59 ? HIS A 150 . ? 1_555 ? 2 AC1 10 ASN A 63 ? ASN A 154 . ? 1_555 ? 3 AC1 10 GLY A 107 ? GLY A 198 . ? 1_555 ? 4 AC1 10 GLY A 108 ? GLY A 199 . ? 1_555 ? 5 AC1 10 LEU A 109 ? LEU A 200 . ? 1_555 ? 6 AC1 10 SER A 110 ? SER A 201 . ? 1_555 ? 7 AC1 10 GLY A 111 ? GLY A 202 . ? 1_555 ? 8 AC1 10 TYR A 114 ? TYR A 205 . ? 1_555 ? 9 AC1 10 TRP A 145 ? TRP A 236 . ? 1_555 ? 10 AC1 10 HIS A 163 ? HIS A 254 . ? 1_555 ? # _database_PDB_matrix.entry_id 4H1D _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4H1D _atom_sites.fract_transf_matrix[1][1] 0.009085 _atom_sites.fract_transf_matrix[1][2] 0.005245 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010490 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008065 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 92 92 ARG ARG A . n A 1 2 ALA 2 93 93 ALA ALA A . n A 1 3 GLY 3 94 94 GLY GLY A . n A 1 4 PRO 4 95 95 PRO PRO A . n A 1 5 VAL 5 96 96 VAL VAL A . n A 1 6 THR 6 97 97 THR THR A . n A 1 7 TRP 7 98 98 TRP TRP A . n A 1 8 VAL 8 99 99 VAL VAL A . n A 1 9 MET 9 100 100 MET MET A . n A 1 10 MET 10 101 101 MET MET A . n A 1 11 ILE 11 102 102 ILE ILE A . n A 1 12 ALA 12 103 103 ALA ALA A . n A 1 13 CYS 13 104 104 CYS CYS A . n A 1 14 VAL 14 105 105 VAL VAL A . n A 1 15 VAL 15 106 106 VAL VAL A . n A 1 16 VAL 16 107 107 VAL VAL A . n A 1 17 PHE 17 108 108 PHE PHE A . n A 1 18 ILE 18 109 109 ILE ILE A . n A 1 19 ALA 19 110 110 ALA ALA A . n A 1 20 MET 20 111 111 MET MET A . n A 1 21 GLN 21 112 112 GLN GLN A . n A 1 22 ILE 22 113 113 ILE ILE A . n A 1 23 LEU 23 114 114 LEU LEU A . n A 1 24 GLY 24 115 115 GLY GLY A . n A 1 25 ASP 25 116 116 ASP ASP A . n A 1 26 GLN 26 117 117 GLN GLN A . n A 1 27 GLU 27 118 118 GLU GLU A . n A 1 28 VAL 28 119 119 VAL VAL A . n A 1 29 MET 29 120 120 MET MET A . n A 1 30 LEU 30 121 121 LEU LEU A . n A 1 31 TRP 31 122 122 TRP TRP A . n A 1 32 LEU 32 123 123 LEU LEU A . n A 1 33 ALA 33 124 124 ALA ALA A . n A 1 34 TRP 34 125 125 TRP TRP A . n A 1 35 PRO 35 126 126 PRO PRO A . n A 1 36 PHE 36 127 127 PHE PHE A . n A 1 37 ASP 37 128 128 ASP ASP A . n A 1 38 PRO 38 129 129 PRO PRO A . n A 1 39 THR 39 130 130 THR THR A . n A 1 40 LEU 40 131 131 LEU LEU A . n A 1 41 LYS 41 132 132 LYS LYS A . n A 1 42 PHE 42 133 133 PHE PHE A . n A 1 43 GLU 43 134 134 GLU GLU A . n A 1 44 PHE 44 135 135 PHE PHE A . n A 1 45 TRP 45 136 136 TRP TRP A . n A 1 46 ARG 46 137 137 ARG ARG A . n A 1 47 TYR 47 138 138 TYR TYR A . n A 1 48 PHE 48 139 139 PHE PHE A . n A 1 49 THR 49 140 140 THR THR A . n A 1 50 HIS 50 141 141 HIS HIS A . n A 1 51 ALA 51 142 142 ALA ALA A . n A 1 52 LEU 52 143 143 LEU LEU A . n A 1 53 MET 53 144 144 MET MET A . n A 1 54 HIS 54 145 145 HIS HIS A . n A 1 55 PHE 55 146 146 PHE PHE A . n A 1 56 SER 56 147 147 SER SER A . n A 1 57 LEU 57 148 148 LEU LEU A . n A 1 58 MET 58 149 149 MET MET A . n A 1 59 HIS 59 150 150 HIS HIS A . n A 1 60 ILE 60 151 151 ILE ILE A . n A 1 61 LEU 61 152 152 LEU LEU A . n A 1 62 PHE 62 153 153 PHE PHE A . n A 1 63 ASN 63 154 154 ASN ASN A . n A 1 64 LEU 64 155 155 LEU LEU A . n A 1 65 LEU 65 156 156 LEU LEU A . n A 1 66 TRP 66 157 157 TRP TRP A . n A 1 67 TRP 67 158 158 TRP TRP A . n A 1 68 TRP 68 159 159 TRP TRP A . n A 1 69 TYR 69 160 160 TYR TYR A . n A 1 70 LEU 70 161 161 LEU LEU A . n A 1 71 GLY 71 162 162 GLY GLY A . n A 1 72 GLY 72 163 163 GLY GLY A . n A 1 73 ALA 73 164 164 ALA ALA A . n A 1 74 VAL 74 165 165 VAL VAL A . n A 1 75 GLU 75 166 166 GLU GLU A . n A 1 76 LYS 76 167 167 LYS LYS A . n A 1 77 ARG 77 168 168 ARG ARG A . n A 1 78 LEU 78 169 169 LEU LEU A . n A 1 79 GLY 79 170 170 GLY GLY A . n A 1 80 SER 80 171 171 SER SER A . n A 1 81 GLY 81 172 172 GLY GLY A . n A 1 82 LYS 82 173 173 LYS LYS A . n A 1 83 LEU 83 174 174 LEU LEU A . n A 1 84 ILE 84 175 175 ILE ILE A . n A 1 85 VAL 85 176 176 VAL VAL A . n A 1 86 ILE 86 177 177 ILE ILE A . n A 1 87 THR 87 178 178 THR THR A . n A 1 88 LEU 88 179 179 LEU LEU A . n A 1 89 ILE 89 180 180 ILE ILE A . n A 1 90 SER 90 181 181 SER SER A . n A 1 91 ALA 91 182 182 ALA ALA A . n A 1 92 LEU 92 183 183 LEU LEU A . n A 1 93 LEU 93 184 184 LEU LEU A . n A 1 94 SER 94 185 185 SER SER A . n A 1 95 GLY 95 186 186 GLY GLY A . n A 1 96 TYR 96 187 187 TYR TYR A . n A 1 97 VAL 97 188 188 VAL VAL A . n A 1 98 GLN 98 189 189 GLN GLN A . n A 1 99 GLN 99 190 190 GLN GLN A . n A 1 100 LYS 100 191 191 LYS LYS A . n A 1 101 PHE 101 192 192 PHE PHE A . n A 1 102 SER 102 193 193 SER SER A . n A 1 103 GLY 103 194 194 GLY GLY A . n A 1 104 PRO 104 195 195 PRO PRO A . n A 1 105 TRP 105 196 196 TRP TRP A . n A 1 106 PHE 106 197 197 PHE PHE A . n A 1 107 GLY 107 198 198 GLY GLY A . n A 1 108 GLY 108 199 199 GLY GLY A . n A 1 109 LEU 109 200 200 LEU LEU A . n A 1 110 SER 110 201 201 SER SER A . n A 1 111 GLY 111 202 202 GLY GLY A . n A 1 112 VAL 112 203 203 VAL VAL A . n A 1 113 VAL 113 204 204 VAL VAL A . n A 1 114 TYR 114 205 205 TYR TYR A . n A 1 115 ALA 115 206 206 ALA ALA A . n A 1 116 LEU 116 207 207 LEU LEU A . n A 1 117 MET 117 208 208 MET MET A . n A 1 118 GLY 118 209 209 GLY GLY A . n A 1 119 TYR 119 210 210 TYR TYR A . n A 1 120 VAL 120 211 211 VAL VAL A . n A 1 121 TRP 121 212 212 TRP TRP A . n A 1 122 LEU 122 213 213 LEU LEU A . n A 1 123 ARG 123 214 214 ARG ARG A . n A 1 124 GLY 124 215 215 GLY GLY A . n A 1 125 GLU 125 216 216 GLU GLU A . n A 1 126 ARG 126 217 217 ARG ARG A . n A 1 127 ASP 127 218 218 ASP ASP A . n A 1 128 PRO 128 219 219 PRO PRO A . n A 1 129 GLN 129 220 220 GLN GLN A . n A 1 130 SER 130 221 221 SER SER A . n A 1 131 GLY 131 222 222 GLY GLY A . n A 1 132 ILE 132 223 223 ILE ILE A . n A 1 133 TYR 133 224 224 TYR TYR A . n A 1 134 LEU 134 225 225 LEU LEU A . n A 1 135 GLN 135 226 226 GLN GLN A . n A 1 136 ARG 136 227 227 ARG ARG A . n A 1 137 GLY 137 228 228 GLY GLY A . n A 1 138 LEU 138 229 229 LEU LEU A . n A 1 139 ILE 139 230 230 ILE ILE A . n A 1 140 ILE 140 231 231 ILE ILE A . n A 1 141 PHE 141 232 232 PHE PHE A . n A 1 142 ALA 142 233 233 ALA ALA A . n A 1 143 LEU 143 234 234 LEU LEU A . n A 1 144 ILE 144 235 235 ILE ILE A . n A 1 145 TRP 145 236 236 TRP TRP A . n A 1 146 ILE 146 237 237 ILE ILE A . n A 1 147 VAL 147 238 238 VAL VAL A . n A 1 148 ALA 148 239 239 ALA ALA A . n A 1 149 GLY 149 240 240 GLY GLY A . n A 1 150 TRP 150 241 241 TRP TRP A . n A 1 151 PHE 151 242 242 PHE PHE A . n A 1 152 ASP 152 243 243 ASP ASP A . n A 1 153 LEU 153 244 244 LEU LEU A . n A 1 154 PHE 154 245 ? ? ? A . n A 1 155 GLY 155 246 ? ? ? A . n A 1 156 MET 156 247 ? ? ? A . n A 1 157 SER 157 248 ? ? ? A . n A 1 158 MET 158 249 ? ? ? A . n A 1 159 ALA 159 250 ? ? ? A . n A 1 160 ASN 160 251 251 ASN ASN A . n A 1 161 GLY 161 252 252 GLY GLY A . n A 1 162 ALA 162 253 253 ALA ALA A . n A 1 163 HIS 163 254 254 HIS HIS A . n A 1 164 ILE 164 255 255 ILE ILE A . n A 1 165 ALA 165 256 256 ALA ALA A . n A 1 166 GLY 166 257 257 GLY GLY A . n A 1 167 LEU 167 258 258 LEU LEU A . n A 1 168 ALA 168 259 259 ALA ALA A . n A 1 169 VAL 169 260 260 VAL VAL A . n A 1 170 GLY 170 261 261 GLY GLY A . n A 1 171 LEU 171 262 262 LEU LEU A . n A 1 172 ALA 172 263 263 ALA ALA A . n A 1 173 MET 173 264 264 MET MET A . n A 1 174 ALA 174 265 265 ALA ALA A . n A 1 175 PHE 175 266 266 PHE PHE A . n A 1 176 VAL 176 267 267 VAL VAL A . n A 1 177 ASP 177 268 268 ASP ASP A . n A 1 178 SER 178 269 269 SER SER A . n A 1 179 LEU 179 270 270 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DFP 1 301 1 DFP DFP A . C 3 HOH 1 401 1 HOH HOH A . C 3 HOH 2 402 2 HOH HOH A . C 3 HOH 3 403 3 HOH HOH A . C 3 HOH 4 404 5 HOH HOH A . C 3 HOH 5 405 6 HOH HOH A . C 3 HOH 6 406 7 HOH HOH A . C 3 HOH 7 407 8 HOH HOH A . C 3 HOH 8 408 10 HOH HOH A . C 3 HOH 9 409 12 HOH HOH A . C 3 HOH 10 410 13 HOH HOH A . C 3 HOH 11 411 14 HOH HOH A . C 3 HOH 12 412 15 HOH HOH A . C 3 HOH 13 413 16 HOH HOH A . C 3 HOH 14 414 17 HOH HOH A . C 3 HOH 15 415 18 HOH HOH A . C 3 HOH 16 416 19 HOH HOH A . C 3 HOH 17 417 20 HOH HOH A . C 3 HOH 18 418 21 HOH HOH A . C 3 HOH 19 419 22 HOH HOH A . C 3 HOH 20 420 23 HOH HOH A . C 3 HOH 21 421 24 HOH HOH A . C 3 HOH 22 422 25 HOH HOH A . C 3 HOH 23 423 26 HOH HOH A . C 3 HOH 24 424 27 HOH HOH A . C 3 HOH 25 425 28 HOH HOH A . C 3 HOH 26 426 29 HOH HOH A . C 3 HOH 27 427 30 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA hexameric 6 3 software_defined_assembly PISA trimeric 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 2 1,2,3,4,5,6 A,B,C 3 1,2,3 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 11500 ? 2 MORE -129 ? 2 'SSA (A^2)' 43470 ? 3 'ABSA (A^2)' 4650 ? 3 MORE -57 ? 3 'SSA (A^2)' 22830 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 55.0365000000 0.8660254038 -0.5000000000 0.0000000000 95.3260142708 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -55.0365000000 -0.8660254038 -0.5000000000 0.0000000000 95.3260142708 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 10_455 y-1/3,x+1/3,-z+1/3 -0.5000000000 0.8660254038 0.0000000000 -55.0365000000 0.8660254038 0.5000000000 0.0000000000 31.7753380903 0.0000000000 0.0000000000 -1.0000000000 41.3316666667 5 'crystal symmetry operation' 11_565 x-y+2/3,-y+4/3,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 127.1013523610 0.0000000000 0.0000000000 -1.0000000000 41.3316666667 6 'crystal symmetry operation' 12_555 -x+2/3,-x+y+1/3,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 55.0365000000 -0.8660254038 0.5000000000 0.0000000000 31.7753380903 0.0000000000 0.0000000000 -1.0000000000 41.3316666667 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 413 ? C HOH . 2 1 A HOH 424 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-05-01 2 'Structure model' 1 1 2013-05-15 3 'Structure model' 1 2 2013-06-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CBASS 'data collection' . ? 1 CCP4 'model building' . ? 2 PHENIX refinement '(phenix.refine: 1.7.3_928)' ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 CCP4 phasing . ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 113 ? ? -73.52 -70.37 2 1 GLU A 134 ? ? -63.42 93.76 3 1 PHE A 139 ? ? -131.86 -38.06 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHE 135 ? CG ? A PHE 44 CG 2 1 Y 1 A PHE 135 ? CD1 ? A PHE 44 CD1 3 1 Y 1 A PHE 135 ? CD2 ? A PHE 44 CD2 4 1 Y 1 A PHE 135 ? CE1 ? A PHE 44 CE1 5 1 Y 1 A PHE 135 ? CE2 ? A PHE 44 CE2 6 1 Y 1 A PHE 135 ? CZ ? A PHE 44 CZ 7 1 Y 1 A LYS 167 ? CG ? A LYS 76 CG 8 1 Y 1 A LYS 167 ? CD ? A LYS 76 CD 9 1 Y 1 A LYS 167 ? CE ? A LYS 76 CE 10 1 Y 1 A LYS 167 ? NZ ? A LYS 76 NZ 11 1 Y 1 A ARG 168 ? CG ? A ARG 77 CG 12 1 Y 1 A ARG 168 ? CD ? A ARG 77 CD 13 1 Y 1 A ARG 168 ? NE ? A ARG 77 NE 14 1 Y 1 A ARG 168 ? CZ ? A ARG 77 CZ 15 1 Y 1 A ARG 168 ? NH1 ? A ARG 77 NH1 16 1 Y 1 A ARG 168 ? NH2 ? A ARG 77 NH2 17 1 Y 1 A GLU 216 ? CG ? A GLU 125 CG 18 1 Y 1 A GLU 216 ? CD ? A GLU 125 CD 19 1 Y 1 A GLU 216 ? OE1 ? A GLU 125 OE1 20 1 Y 1 A GLU 216 ? OE2 ? A GLU 125 OE2 21 1 Y 1 A GLN 220 ? CG ? A GLN 129 CG 22 1 Y 1 A GLN 220 ? CD ? A GLN 129 CD 23 1 Y 1 A GLN 220 ? OE1 ? A GLN 129 OE1 24 1 Y 1 A GLN 220 ? NE2 ? A GLN 129 NE2 25 1 Y 1 A ASP 243 ? CG ? A ASP 152 CG 26 1 Y 1 A ASP 243 ? OD1 ? A ASP 152 OD1 27 1 Y 1 A ASP 243 ? OD2 ? A ASP 152 OD2 28 1 Y 1 A ASN 251 ? CG ? A ASN 160 CG 29 1 Y 1 A ASN 251 ? OD1 ? A ASN 160 OD1 30 1 Y 1 A ASN 251 ? ND2 ? A ASN 160 ND2 31 1 Y 1 A ILE 255 ? CG1 ? A ILE 164 CG1 32 1 Y 1 A ILE 255 ? CG2 ? A ILE 164 CG2 33 1 Y 1 A ILE 255 ? CD1 ? A ILE 164 CD1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PHE 245 ? A PHE 154 2 1 Y 1 A GLY 246 ? A GLY 155 3 1 Y 1 A MET 247 ? A MET 156 4 1 Y 1 A SER 248 ? A SER 157 5 1 Y 1 A MET 249 ? A MET 158 6 1 Y 1 A ALA 250 ? A ALA 159 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DIISOPROPYL PHOSPHONATE' DFP 3 water HOH #