data_4H47 # _entry.id 4H47 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4H47 RCSB RCSB074997 WWPDB D_1000074997 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3I19 'The same protein at pH8.5' unspecified PDB 3LA1 'The same protein with A167I mutatation' unspecified PDB 4H48 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4H47 _pdbx_database_status.recvd_initial_deposition_date 2012-09-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hu, X.-J.' 1 'Liu, R.' 2 # _citation.id primary _citation.title 'Structural insights of the fluorescent states of CyPet' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Liu, R.' 1 primary 'Zhou, Y.-B.' 2 primary 'Ding, Y.' 3 primary 'Hu, X.-J.' 4 # _cell.entry_id 4H47 _cell.length_a 51.060 _cell.length_b 62.640 _cell.length_c 70.950 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4H47 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Green fluorescent protein' 26887.344 1 ? 'T9G, V11I, D19E, A87V, I167A, E172T, L194I' ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 4 water nat water 18.015 94 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MVSKGEELFGGIVPILVELEGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTL(CRF)VQCFSRYPDH MKQHDFFKSVMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQ KNGIKANFKARHNITDGSVQLADHYQQNTPIGDGPVILPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELY K ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSKGEELFGGIVPILVELEGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMK QHDFFKSVMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKN GIKANFKARHNITDGSVQLADHYQQNTPIGDGPVILPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 SER n 1 4 LYS n 1 5 GLY n 1 6 GLU n 1 7 GLU n 1 8 LEU n 1 9 PHE n 1 10 GLY n 1 11 GLY n 1 12 ILE n 1 13 VAL n 1 14 PRO n 1 15 ILE n 1 16 LEU n 1 17 VAL n 1 18 GLU n 1 19 LEU n 1 20 GLU n 1 21 GLY n 1 22 ASP n 1 23 VAL n 1 24 ASN n 1 25 GLY n 1 26 HIS n 1 27 LYS n 1 28 PHE n 1 29 SER n 1 30 VAL n 1 31 SER n 1 32 GLY n 1 33 GLU n 1 34 GLY n 1 35 GLU n 1 36 GLY n 1 37 ASP n 1 38 ALA n 1 39 THR n 1 40 TYR n 1 41 GLY n 1 42 LYS n 1 43 LEU n 1 44 THR n 1 45 LEU n 1 46 LYS n 1 47 PHE n 1 48 ILE n 1 49 CYS n 1 50 THR n 1 51 THR n 1 52 GLY n 1 53 LYS n 1 54 LEU n 1 55 PRO n 1 56 VAL n 1 57 PRO n 1 58 TRP n 1 59 PRO n 1 60 THR n 1 61 LEU n 1 62 VAL n 1 63 THR n 1 64 THR n 1 65 LEU n 1 66 CRF n 1 67 VAL n 1 68 GLN n 1 69 CYS n 1 70 PHE n 1 71 SER n 1 72 ARG n 1 73 TYR n 1 74 PRO n 1 75 ASP n 1 76 HIS n 1 77 MET n 1 78 LYS n 1 79 GLN n 1 80 HIS n 1 81 ASP n 1 82 PHE n 1 83 PHE n 1 84 LYS n 1 85 SER n 1 86 VAL n 1 87 MET n 1 88 PRO n 1 89 GLU n 1 90 GLY n 1 91 TYR n 1 92 VAL n 1 93 GLN n 1 94 GLU n 1 95 ARG n 1 96 THR n 1 97 ILE n 1 98 PHE n 1 99 PHE n 1 100 LYS n 1 101 ASP n 1 102 ASP n 1 103 GLY n 1 104 ASN n 1 105 TYR n 1 106 LYS n 1 107 THR n 1 108 ARG n 1 109 ALA n 1 110 GLU n 1 111 VAL n 1 112 LYS n 1 113 PHE n 1 114 GLU n 1 115 GLY n 1 116 ASP n 1 117 THR n 1 118 LEU n 1 119 VAL n 1 120 ASN n 1 121 ARG n 1 122 ILE n 1 123 GLU n 1 124 LEU n 1 125 LYS n 1 126 GLY n 1 127 ILE n 1 128 ASP n 1 129 PHE n 1 130 LYS n 1 131 GLU n 1 132 ASP n 1 133 GLY n 1 134 ASN n 1 135 ILE n 1 136 LEU n 1 137 GLY n 1 138 HIS n 1 139 LYS n 1 140 LEU n 1 141 GLU n 1 142 TYR n 1 143 ASN n 1 144 TYR n 1 145 ILE n 1 146 SER n 1 147 HIS n 1 148 ASN n 1 149 VAL n 1 150 TYR n 1 151 ILE n 1 152 THR n 1 153 ALA n 1 154 ASP n 1 155 LYS n 1 156 GLN n 1 157 LYS n 1 158 ASN n 1 159 GLY n 1 160 ILE n 1 161 LYS n 1 162 ALA n 1 163 ASN n 1 164 PHE n 1 165 LYS n 1 166 ALA n 1 167 ARG n 1 168 HIS n 1 169 ASN n 1 170 ILE n 1 171 THR n 1 172 ASP n 1 173 GLY n 1 174 SER n 1 175 VAL n 1 176 GLN n 1 177 LEU n 1 178 ALA n 1 179 ASP n 1 180 HIS n 1 181 TYR n 1 182 GLN n 1 183 GLN n 1 184 ASN n 1 185 THR n 1 186 PRO n 1 187 ILE n 1 188 GLY n 1 189 ASP n 1 190 GLY n 1 191 PRO n 1 192 VAL n 1 193 ILE n 1 194 LEU n 1 195 PRO n 1 196 ASP n 1 197 ASN n 1 198 HIS n 1 199 TYR n 1 200 LEU n 1 201 SER n 1 202 THR n 1 203 GLN n 1 204 SER n 1 205 ALA n 1 206 LEU n 1 207 SER n 1 208 LYS n 1 209 ASP n 1 210 PRO n 1 211 ASN n 1 212 GLU n 1 213 LYS n 1 214 ARG n 1 215 ASP n 1 216 HIS n 1 217 MET n 1 218 VAL n 1 219 LEU n 1 220 LEU n 1 221 GLU n 1 222 PHE n 1 223 VAL n 1 224 THR n 1 225 ALA n 1 226 ALA n 1 227 GLY n 1 228 ILE n 1 229 THR n 1 230 HIS n 1 231 GLY n 1 232 MET n 1 233 ASP n 1 234 GLU n 1 235 LEU n 1 236 TYR n 1 237 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Jellyfish _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GFP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aequorea victoria' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6100 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GFP_AEQVI _struct_ref.pdbx_db_accession P42212 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4H47 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 237 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P42212 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4H47 MET A 1 ? UNP P42212 ? ? 'EXPRESSION TAG' 0 1 1 4H47 VAL A 2 ? UNP P42212 MET 1 'SEE REMARK 999' 1 2 1 4H47 GLY A 10 ? UNP P42212 THR 9 'ENGINEERED MUTATION' 9 3 1 4H47 ILE A 12 ? UNP P42212 VAL 11 'ENGINEERED MUTATION' 11 4 1 4H47 GLU A 20 ? UNP P42212 ASP 19 'ENGINEERED MUTATION' 19 5 1 4H47 LEU A 65 ? UNP P42212 PHE 64 'SEE REMARK 999' 64 6 1 4H47 CRF A 66 ? UNP P42212 SER 65 CHROMOPHORE 66 7 1 4H47 CRF A 66 ? UNP P42212 TYR 66 CHROMOPHORE 66 8 1 4H47 CRF A 66 ? UNP P42212 BLY 67 CHROMOPHORE 66 9 1 4H47 VAL A 86 ? UNP P42212 ALA 87 'ENGINEERED MUTATION' 87 10 1 4H47 ILE A 145 ? UNP P42212 ASN 146 'SEE REMARK 999' 146 11 1 4H47 THR A 152 ? UNP P42212 MET 153 'SEE REMARK 999' 153 12 1 4H47 ALA A 162 ? UNP P42212 VAL 163 'SEE REMARK 999' 163 13 1 4H47 ALA A 166 ? UNP P42212 ILE 167 'ENGINEERED MUTATION' 167 14 1 4H47 THR A 171 ? UNP P42212 GLU 172 'ENGINEERED MUTATION' 172 15 1 4H47 ILE A 193 ? UNP P42212 LEU 194 'ENGINEERED MUTATION' 194 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BLY peptide-like n 'LYSINE BORONIC ACID' ? 'C5 H16 B N2 O2 1' 147.004 CRF 'L-peptide linking' n '[(4Z)-2-[(1R,2R)-1-amino-2-hydroxypropyl]-4-(1H-indol-3-ylmethylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl]acetic acid' ? 'C17 H18 N4 O4' 342.349 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4H47 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_percent_sol 41.70 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.2 _exptl_crystal_grow.pdbx_details '30% PEG 4000, 0.1M Sodium Acetate, 0.2M Lithium sulfate, pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2012-06-02 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97923 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.pdbx_synchrotron_site SSRF _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97923 # _reflns.entry_id 4H47 _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 46.96 _reflns.d_resolution_high 1.90 _reflns.number_obs 17577 _reflns.number_all 18366 _reflns.percent_possible_obs 95.7 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.9 _reflns_shell.d_res_low 2.0 _reflns_shell.percent_possible_all 93.5 _reflns_shell.Rmerge_I_obs 0.557 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.9 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 2434 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4H47 _refine.ls_number_reflns_obs 16636 _refine.ls_number_reflns_all 17544 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40.00 _refine.ls_d_res_high 1.90 _refine.ls_percent_reflns_obs 94.82 _refine.ls_R_factor_obs 0.18456 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.18160 _refine.ls_R_factor_R_free 0.24268 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.2 _refine.ls_number_reflns_R_free 913 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.958 _refine.correlation_coeff_Fo_to_Fc_free 0.936 _refine.B_iso_mean 28.792 _refine.aniso_B[1][1] -2.05 _refine.aniso_B[2][2] -0.84 _refine.aniso_B[3][3] 2.89 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.157 _refine.pdbx_overall_ESU_R_Free 0.167 _refine.overall_SU_ML 0.116 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 4.024 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1819 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 94 _refine_hist.number_atoms_total 1922 _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 40.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.017 0.019 ? 1991 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.001 0.020 ? 1850 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 2.049 1.967 ? 2708 ? 'X-RAY DIFFRACTION' r_angle_other_deg 0.871 3.000 ? 4279 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 7.332 5.000 ? 248 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 36.473 25.306 ? 98 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 16.045 15.000 ? 339 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 17.244 15.000 ? 7 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.107 0.200 ? 288 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.010 0.021 ? 2319 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.002 0.020 ? 466 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.900 _refine_ls_shell.d_res_low 1.949 _refine_ls_shell.number_reflns_R_work 1127 _refine_ls_shell.R_factor_R_work 0.252 _refine_ls_shell.percent_reflns_obs 91.32 _refine_ls_shell.R_factor_R_free 0.314 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 72 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? # _struct.entry_id 4H47 _struct.title '1.9 angstrom CyPet structure at pH5.2' _struct.pdbx_descriptor 'Green fluorescent protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4H47 _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' _struct_keywords.text 'beta barrel, luminescence, FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? LEU A 8 ? SER A 2 LEU A 7 1 ? 6 HELX_P HELX_P2 2 ALA A 38 ? TYR A 40 ? ALA A 37 TYR A 39 5 ? 3 HELX_P HELX_P3 3 PRO A 57 ? VAL A 62 ? PRO A 56 VAL A 61 5 ? 6 HELX_P HELX_P4 4 VAL A 67 ? SER A 71 ? VAL A 68 SER A 72 5 ? 5 HELX_P HELX_P5 5 PRO A 74 ? HIS A 80 ? PRO A 75 HIS A 81 5 ? 7 HELX_P HELX_P6 6 ASP A 81 ? VAL A 86 ? ASP A 82 VAL A 87 1 ? 6 HELX_P HELX_P7 7 LYS A 155 ? ASN A 158 ? LYS A 156 ASN A 159 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A LEU 65 C ? ? ? 1_555 A CRF 66 N1 ? ? A LEU 64 A CRF 66 1_555 ? ? ? ? ? ? ? 1.364 ? covale2 covale ? ? A CRF 66 C3 ? ? ? 1_555 A VAL 67 N ? ? A CRF 66 A VAL 68 1_555 ? ? ? ? ? ? ? 1.524 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 87 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 88 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 88 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 89 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 17.43 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel A 10 11 ? anti-parallel A 11 12 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 13 ? VAL A 23 ? VAL A 12 VAL A 22 A 2 HIS A 26 ? ASP A 37 ? HIS A 25 ASP A 36 A 3 LYS A 42 ? CYS A 49 ? LYS A 41 CYS A 48 A 4 HIS A 216 ? ALA A 226 ? HIS A 217 ALA A 227 A 5 HIS A 198 ? SER A 207 ? HIS A 199 SER A 208 A 6 HIS A 147 ? ASP A 154 ? HIS A 148 ASP A 155 A 7 GLY A 159 ? ASN A 169 ? GLY A 160 ASN A 170 A 8 VAL A 175 ? PRO A 186 ? VAL A 176 PRO A 187 A 9 TYR A 91 ? PHE A 99 ? TYR A 92 PHE A 100 A 10 ASN A 104 ? GLU A 114 ? ASN A 105 GLU A 115 A 11 THR A 117 ? ILE A 127 ? THR A 118 ILE A 128 A 12 VAL A 13 ? VAL A 23 ? VAL A 12 VAL A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 19 ? N LEU A 18 O VAL A 30 ? O VAL A 29 A 2 3 N ASP A 37 ? N ASP A 36 O LYS A 42 ? O LYS A 41 A 3 4 N LEU A 45 ? N LEU A 44 O LEU A 219 ? O LEU A 220 A 4 5 O LEU A 220 ? O LEU A 221 N ALA A 205 ? N ALA A 206 A 5 6 O HIS A 198 ? O HIS A 199 N ILE A 151 ? N ILE A 152 A 6 7 N THR A 152 ? N THR A 153 O LYS A 161 ? O LYS A 162 A 7 8 N ALA A 166 ? N ALA A 167 O ALA A 178 ? O ALA A 179 A 8 9 O THR A 185 ? O THR A 186 N VAL A 92 ? N VAL A 93 A 9 10 N GLN A 93 ? N GLN A 94 O ALA A 109 ? O ALA A 110 A 10 11 N LYS A 112 ? N LYS A 113 O VAL A 119 ? O VAL A 120 A 11 12 O ILE A 122 ? O ILE A 123 N GLU A 18 ? N GLU A 17 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 301' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ACT A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 VAL A 56 ? VAL A 55 . ? 1_555 ? 2 AC1 7 PRO A 57 ? PRO A 56 . ? 1_555 ? 3 AC1 7 TRP A 58 ? TRP A 57 . ? 1_555 ? 4 AC1 7 PRO A 59 ? PRO A 58 . ? 1_555 ? 5 AC1 7 HIS A 138 ? HIS A 139 . ? 1_555 ? 6 AC1 7 HOH D . ? HOH A 412 . ? 1_555 ? 7 AC1 7 HOH D . ? HOH A 487 . ? 1_555 ? 8 AC2 5 HIS A 147 ? HIS A 148 . ? 1_555 ? 9 AC2 5 ASN A 148 ? ASN A 149 . ? 1_555 ? 10 AC2 5 TYR A 150 ? TYR A 151 . ? 1_555 ? 11 AC2 5 HOH D . ? HOH A 451 . ? 1_555 ? 12 AC2 5 HOH D . ? HOH A 470 . ? 1_555 ? # _database_PDB_matrix.entry_id 4H47 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4H47 _atom_sites.fract_transf_matrix[1][1] 0.019585 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015964 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014094 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 VAL 2 1 1 VAL VAL A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 LYS 4 3 3 LYS LYS A . n A 1 5 GLY 5 4 4 GLY GLY A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 PHE 9 8 8 PHE PHE A . n A 1 10 GLY 10 9 9 GLY GLY A . n A 1 11 GLY 11 10 10 GLY GLY A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 VAL 13 12 12 VAL VAL A . n A 1 14 PRO 14 13 13 PRO PRO A . n A 1 15 ILE 15 14 14 ILE ILE A . n A 1 16 LEU 16 15 15 LEU LEU A . n A 1 17 VAL 17 16 16 VAL VAL A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 LEU 19 18 18 LEU LEU A . n A 1 20 GLU 20 19 19 GLU GLU A . n A 1 21 GLY 21 20 20 GLY GLY A . n A 1 22 ASP 22 21 21 ASP ASP A . n A 1 23 VAL 23 22 22 VAL VAL A . n A 1 24 ASN 24 23 23 ASN ASN A . n A 1 25 GLY 25 24 24 GLY GLY A . n A 1 26 HIS 26 25 25 HIS HIS A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 PHE 28 27 27 PHE PHE A . n A 1 29 SER 29 28 28 SER SER A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 SER 31 30 30 SER SER A . n A 1 32 GLY 32 31 31 GLY GLY A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 GLY 34 33 33 GLY GLY A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 GLY 36 35 35 GLY GLY A . n A 1 37 ASP 37 36 36 ASP ASP A . n A 1 38 ALA 38 37 37 ALA ALA A . n A 1 39 THR 39 38 38 THR THR A . n A 1 40 TYR 40 39 39 TYR TYR A . n A 1 41 GLY 41 40 40 GLY GLY A . n A 1 42 LYS 42 41 41 LYS LYS A . n A 1 43 LEU 43 42 42 LEU LEU A . n A 1 44 THR 44 43 43 THR THR A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 LYS 46 45 45 LYS LYS A . n A 1 47 PHE 47 46 46 PHE PHE A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 CYS 49 48 48 CYS CYS A . n A 1 50 THR 50 49 49 THR THR A . n A 1 51 THR 51 50 50 THR THR A . n A 1 52 GLY 52 51 51 GLY GLY A . n A 1 53 LYS 53 52 52 LYS LYS A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 PRO 55 54 54 PRO PRO A . n A 1 56 VAL 56 55 55 VAL VAL A . n A 1 57 PRO 57 56 56 PRO PRO A . n A 1 58 TRP 58 57 57 TRP TRP A . n A 1 59 PRO 59 58 58 PRO PRO A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 THR 63 62 62 THR THR A . n A 1 64 THR 64 63 63 THR THR A . n A 1 65 LEU 65 64 64 LEU LEU A . n A 1 66 CRF 66 66 66 CRF CRF A . n A 1 67 VAL 67 68 68 VAL VAL A . n A 1 68 GLN 68 69 69 GLN GLN A . n A 1 69 CYS 69 70 70 CYS CYS A . n A 1 70 PHE 70 71 71 PHE PHE A . n A 1 71 SER 71 72 72 SER SER A . n A 1 72 ARG 72 73 73 ARG ARG A . n A 1 73 TYR 73 74 74 TYR TYR A . n A 1 74 PRO 74 75 75 PRO PRO A . n A 1 75 ASP 75 76 76 ASP ASP A . n A 1 76 HIS 76 77 77 HIS HIS A . n A 1 77 MET 77 78 78 MET MET A . n A 1 78 LYS 78 79 79 LYS LYS A . n A 1 79 GLN 79 80 80 GLN GLN A . n A 1 80 HIS 80 81 81 HIS HIS A . n A 1 81 ASP 81 82 82 ASP ASP A . n A 1 82 PHE 82 83 83 PHE PHE A . n A 1 83 PHE 83 84 84 PHE PHE A . n A 1 84 LYS 84 85 85 LYS LYS A . n A 1 85 SER 85 86 86 SER SER A . n A 1 86 VAL 86 87 87 VAL VAL A . n A 1 87 MET 87 88 88 MET MET A . n A 1 88 PRO 88 89 89 PRO PRO A . n A 1 89 GLU 89 90 90 GLU GLU A . n A 1 90 GLY 90 91 91 GLY GLY A . n A 1 91 TYR 91 92 92 TYR TYR A . n A 1 92 VAL 92 93 93 VAL VAL A . n A 1 93 GLN 93 94 94 GLN GLN A . n A 1 94 GLU 94 95 95 GLU GLU A . n A 1 95 ARG 95 96 96 ARG ARG A . n A 1 96 THR 96 97 97 THR THR A . n A 1 97 ILE 97 98 98 ILE ILE A . n A 1 98 PHE 98 99 99 PHE PHE A . n A 1 99 PHE 99 100 100 PHE PHE A . n A 1 100 LYS 100 101 101 LYS LYS A . n A 1 101 ASP 101 102 102 ASP ASP A . n A 1 102 ASP 102 103 103 ASP ASP A . n A 1 103 GLY 103 104 104 GLY GLY A . n A 1 104 ASN 104 105 105 ASN ASN A . n A 1 105 TYR 105 106 106 TYR TYR A . n A 1 106 LYS 106 107 107 LYS LYS A . n A 1 107 THR 107 108 108 THR THR A . n A 1 108 ARG 108 109 109 ARG ARG A . n A 1 109 ALA 109 110 110 ALA ALA A . n A 1 110 GLU 110 111 111 GLU GLU A . n A 1 111 VAL 111 112 112 VAL VAL A . n A 1 112 LYS 112 113 113 LYS LYS A . n A 1 113 PHE 113 114 114 PHE PHE A . n A 1 114 GLU 114 115 115 GLU GLU A . n A 1 115 GLY 115 116 116 GLY GLY A . n A 1 116 ASP 116 117 117 ASP ASP A . n A 1 117 THR 117 118 118 THR THR A . n A 1 118 LEU 118 119 119 LEU LEU A . n A 1 119 VAL 119 120 120 VAL VAL A . n A 1 120 ASN 120 121 121 ASN ASN A . n A 1 121 ARG 121 122 122 ARG ARG A . n A 1 122 ILE 122 123 123 ILE ILE A . n A 1 123 GLU 123 124 124 GLU GLU A . n A 1 124 LEU 124 125 125 LEU LEU A . n A 1 125 LYS 125 126 126 LYS LYS A . n A 1 126 GLY 126 127 127 GLY GLY A . n A 1 127 ILE 127 128 128 ILE ILE A . n A 1 128 ASP 128 129 129 ASP ASP A . n A 1 129 PHE 129 130 130 PHE PHE A . n A 1 130 LYS 130 131 131 LYS LYS A . n A 1 131 GLU 131 132 132 GLU GLU A . n A 1 132 ASP 132 133 133 ASP ASP A . n A 1 133 GLY 133 134 134 GLY GLY A . n A 1 134 ASN 134 135 135 ASN ASN A . n A 1 135 ILE 135 136 136 ILE ILE A . n A 1 136 LEU 136 137 137 LEU LEU A . n A 1 137 GLY 137 138 138 GLY GLY A . n A 1 138 HIS 138 139 139 HIS HIS A . n A 1 139 LYS 139 140 140 LYS LYS A . n A 1 140 LEU 140 141 141 LEU LEU A . n A 1 141 GLU 141 142 142 GLU GLU A . n A 1 142 TYR 142 143 143 TYR TYR A . n A 1 143 ASN 143 144 144 ASN ASN A . n A 1 144 TYR 144 145 145 TYR TYR A . n A 1 145 ILE 145 146 146 ILE ILE A . n A 1 146 SER 146 147 147 SER SER A . n A 1 147 HIS 147 148 148 HIS HIS A . n A 1 148 ASN 148 149 149 ASN ASN A . n A 1 149 VAL 149 150 150 VAL VAL A . n A 1 150 TYR 150 151 151 TYR TYR A . n A 1 151 ILE 151 152 152 ILE ILE A . n A 1 152 THR 152 153 153 THR THR A . n A 1 153 ALA 153 154 154 ALA ALA A . n A 1 154 ASP 154 155 155 ASP ASP A . n A 1 155 LYS 155 156 156 LYS LYS A . n A 1 156 GLN 156 157 157 GLN GLN A . n A 1 157 LYS 157 158 158 LYS LYS A . n A 1 158 ASN 158 159 159 ASN ASN A . n A 1 159 GLY 159 160 160 GLY GLY A . n A 1 160 ILE 160 161 161 ILE ILE A . n A 1 161 LYS 161 162 162 LYS LYS A . n A 1 162 ALA 162 163 163 ALA ALA A . n A 1 163 ASN 163 164 164 ASN ASN A . n A 1 164 PHE 164 165 165 PHE PHE A . n A 1 165 LYS 165 166 166 LYS LYS A . n A 1 166 ALA 166 167 167 ALA ALA A . n A 1 167 ARG 167 168 168 ARG ARG A . n A 1 168 HIS 168 169 169 HIS HIS A . n A 1 169 ASN 169 170 170 ASN ASN A . n A 1 170 ILE 170 171 171 ILE ILE A . n A 1 171 THR 171 172 172 THR THR A . n A 1 172 ASP 172 173 173 ASP ASP A . n A 1 173 GLY 173 174 174 GLY GLY A . n A 1 174 SER 174 175 175 SER SER A . n A 1 175 VAL 175 176 176 VAL VAL A . n A 1 176 GLN 176 177 177 GLN GLN A . n A 1 177 LEU 177 178 178 LEU LEU A . n A 1 178 ALA 178 179 179 ALA ALA A . n A 1 179 ASP 179 180 180 ASP ASP A . n A 1 180 HIS 180 181 181 HIS HIS A . n A 1 181 TYR 181 182 182 TYR TYR A . n A 1 182 GLN 182 183 183 GLN GLN A . n A 1 183 GLN 183 184 184 GLN GLN A . n A 1 184 ASN 184 185 185 ASN ASN A . n A 1 185 THR 185 186 186 THR THR A . n A 1 186 PRO 186 187 187 PRO PRO A . n A 1 187 ILE 187 188 188 ILE ILE A . n A 1 188 GLY 188 189 189 GLY GLY A . n A 1 189 ASP 189 190 190 ASP ASP A . n A 1 190 GLY 190 191 191 GLY GLY A . n A 1 191 PRO 191 192 192 PRO PRO A . n A 1 192 VAL 192 193 193 VAL VAL A . n A 1 193 ILE 193 194 194 ILE ILE A . n A 1 194 LEU 194 195 195 LEU LEU A . n A 1 195 PRO 195 196 196 PRO PRO A . n A 1 196 ASP 196 197 197 ASP ASP A . n A 1 197 ASN 197 198 198 ASN ASN A . n A 1 198 HIS 198 199 199 HIS HIS A . n A 1 199 TYR 199 200 200 TYR TYR A . n A 1 200 LEU 200 201 201 LEU LEU A . n A 1 201 SER 201 202 202 SER SER A . n A 1 202 THR 202 203 203 THR THR A . n A 1 203 GLN 203 204 204 GLN GLN A . n A 1 204 SER 204 205 205 SER SER A . n A 1 205 ALA 205 206 206 ALA ALA A . n A 1 206 LEU 206 207 207 LEU LEU A . n A 1 207 SER 207 208 208 SER SER A . n A 1 208 LYS 208 209 209 LYS LYS A . n A 1 209 ASP 209 210 210 ASP ASP A . n A 1 210 PRO 210 211 211 PRO PRO A . n A 1 211 ASN 211 212 212 ASN ASN A . n A 1 212 GLU 212 213 213 GLU GLU A . n A 1 213 LYS 213 214 214 LYS LYS A . n A 1 214 ARG 214 215 215 ARG ARG A . n A 1 215 ASP 215 216 216 ASP ASP A . n A 1 216 HIS 216 217 217 HIS HIS A . n A 1 217 MET 217 218 218 MET MET A . n A 1 218 VAL 218 219 219 VAL VAL A . n A 1 219 LEU 219 220 220 LEU LEU A . n A 1 220 LEU 220 221 221 LEU LEU A . n A 1 221 GLU 221 222 222 GLU GLU A . n A 1 222 PHE 222 223 223 PHE PHE A . n A 1 223 VAL 223 224 224 VAL VAL A . n A 1 224 THR 224 225 225 THR THR A . n A 1 225 ALA 225 226 226 ALA ALA A . n A 1 226 ALA 226 227 227 ALA ALA A . n A 1 227 GLY 227 228 228 GLY GLY A . n A 1 228 ILE 228 229 229 ILE ILE A . n A 1 229 THR 229 230 ? ? ? A . n A 1 230 HIS 230 231 ? ? ? A . n A 1 231 GLY 231 232 ? ? ? A . n A 1 232 MET 232 233 ? ? ? A . n A 1 233 ASP 233 234 ? ? ? A . n A 1 234 GLU 234 235 ? ? ? A . n A 1 235 LEU 235 236 ? ? ? A . n A 1 236 TYR 236 237 ? ? ? A . n A 1 237 LYS 237 238 ? ? ? A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CRF 66 A CRF 66 ? THR ? 2 A CRF 66 A CRF 66 ? TRP ? 3 A CRF 66 A CRF 66 ? GLY ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-09-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 PHASES phasing . ? 2 REFMAC refinement 5.7.0029 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # _pdbx_entry_details.sequence_details ;(1) RESIDUES SER 65, TYR 66 HAVE BEEN MUTATED TO THR 65, TRP 66. RESIDUES THR 65, TRP 66 AND GLY 67 CONSTITUTE THE CHROMOPHORE CRF 66. (2) RESIDUES VAL 1, LEU 64, ILE 146, THR 153, ALA 163 ARE THE NEUTRAL MUTATIONS. ; _pdbx_entry_details.entry_id 4H47 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 103 ? ? -156.97 -159.03 2 1 TYR A 145 ? B -28.06 175.32 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 230 ? A THR 229 2 1 Y 1 A HIS 231 ? A HIS 230 3 1 Y 1 A GLY 232 ? A GLY 231 4 1 Y 1 A MET 233 ? A MET 232 5 1 Y 1 A ASP 234 ? A ASP 233 6 1 Y 1 A GLU 235 ? A GLU 234 7 1 Y 1 A LEU 236 ? A LEU 235 8 1 Y 1 A TYR 237 ? A TYR 236 9 1 Y 1 A LYS 238 ? A LYS 237 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'ACETATE ION' ACT 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 250 SO4 SO4 A . C 3 ACT 1 302 251 ACT ACT A . D 4 HOH 1 401 301 HOH HOH A . D 4 HOH 2 402 302 HOH HOH A . D 4 HOH 3 403 303 HOH HOH A . D 4 HOH 4 404 304 HOH HOH A . D 4 HOH 5 405 305 HOH HOH A . D 4 HOH 6 406 306 HOH HOH A . D 4 HOH 7 407 307 HOH HOH A . D 4 HOH 8 408 308 HOH HOH A . D 4 HOH 9 409 309 HOH HOH A . D 4 HOH 10 410 310 HOH HOH A . D 4 HOH 11 411 311 HOH HOH A . D 4 HOH 12 412 312 HOH HOH A . D 4 HOH 13 413 313 HOH HOH A . D 4 HOH 14 414 314 HOH HOH A . D 4 HOH 15 415 315 HOH HOH A . D 4 HOH 16 416 316 HOH HOH A . D 4 HOH 17 417 317 HOH HOH A . D 4 HOH 18 418 318 HOH HOH A . D 4 HOH 19 419 319 HOH HOH A . D 4 HOH 20 420 320 HOH HOH A . D 4 HOH 21 421 321 HOH HOH A . D 4 HOH 22 422 322 HOH HOH A . D 4 HOH 23 423 323 HOH HOH A . D 4 HOH 24 424 324 HOH HOH A . D 4 HOH 25 425 325 HOH HOH A . D 4 HOH 26 426 326 HOH HOH A . D 4 HOH 27 427 327 HOH HOH A . D 4 HOH 28 428 328 HOH HOH A . D 4 HOH 29 429 329 HOH HOH A . D 4 HOH 30 430 330 HOH HOH A . D 4 HOH 31 431 331 HOH HOH A . D 4 HOH 32 432 332 HOH HOH A . D 4 HOH 33 433 333 HOH HOH A . D 4 HOH 34 434 334 HOH HOH A . D 4 HOH 35 435 335 HOH HOH A . D 4 HOH 36 436 336 HOH HOH A . D 4 HOH 37 437 337 HOH HOH A . D 4 HOH 38 438 338 HOH HOH A . D 4 HOH 39 439 339 HOH HOH A . D 4 HOH 40 440 340 HOH HOH A . D 4 HOH 41 441 341 HOH HOH A . D 4 HOH 42 442 342 HOH HOH A . D 4 HOH 43 443 343 HOH HOH A . D 4 HOH 44 444 344 HOH HOH A . D 4 HOH 45 445 345 HOH HOH A . D 4 HOH 46 446 346 HOH HOH A . D 4 HOH 47 447 347 HOH HOH A . D 4 HOH 48 448 348 HOH HOH A . D 4 HOH 49 449 349 HOH HOH A . D 4 HOH 50 450 350 HOH HOH A . D 4 HOH 51 451 351 HOH HOH A . D 4 HOH 52 452 352 HOH HOH A . D 4 HOH 53 453 353 HOH HOH A . D 4 HOH 54 454 354 HOH HOH A . D 4 HOH 55 455 355 HOH HOH A . D 4 HOH 56 456 356 HOH HOH A . D 4 HOH 57 457 357 HOH HOH A . D 4 HOH 58 458 358 HOH HOH A . D 4 HOH 59 459 359 HOH HOH A . D 4 HOH 60 460 360 HOH HOH A . D 4 HOH 61 461 361 HOH HOH A . D 4 HOH 62 462 362 HOH HOH A . D 4 HOH 63 463 363 HOH HOH A . D 4 HOH 64 464 364 HOH HOH A . D 4 HOH 65 465 365 HOH HOH A . D 4 HOH 66 466 366 HOH HOH A . D 4 HOH 67 467 367 HOH HOH A . D 4 HOH 68 468 368 HOH HOH A . D 4 HOH 69 469 369 HOH HOH A . D 4 HOH 70 470 370 HOH HOH A . D 4 HOH 71 471 371 HOH HOH A . D 4 HOH 72 472 372 HOH HOH A . D 4 HOH 73 473 373 HOH HOH A . D 4 HOH 74 474 374 HOH HOH A . D 4 HOH 75 475 375 HOH HOH A . D 4 HOH 76 476 376 HOH HOH A . D 4 HOH 77 477 377 HOH HOH A . D 4 HOH 78 478 378 HOH HOH A . D 4 HOH 79 479 379 HOH HOH A . D 4 HOH 80 480 380 HOH HOH A . D 4 HOH 81 481 381 HOH HOH A . D 4 HOH 82 482 382 HOH HOH A . D 4 HOH 83 483 383 HOH HOH A . D 4 HOH 84 484 384 HOH HOH A . D 4 HOH 85 485 385 HOH HOH A . D 4 HOH 86 486 386 HOH HOH A . D 4 HOH 87 487 387 HOH HOH A . D 4 HOH 88 488 388 HOH HOH A . D 4 HOH 89 489 389 HOH HOH A . D 4 HOH 90 490 390 HOH HOH A . D 4 HOH 91 491 391 HOH HOH A . D 4 HOH 92 492 392 HOH HOH A . D 4 HOH 93 493 393 HOH HOH A . D 4 HOH 94 494 394 HOH HOH A . #