data_4H8Q # _entry.id 4H8Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4H8Q RCSB RCSB075160 WWPDB D_1000075160 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3SIK 'Holo-IsdX1, a B. anthacis hemophore' unspecified PDB 2ITF 'IsdA, a related NEAT domain protein' unspecified PDB 2O6P 'IsdC, a related NEAT domain protein' unspecified PDB 2Z6F 'IsdH, a related NEAT domain protein' unspecified PDB 3RTL 'IsdB, a related NEAT domain protein' unspecified PDB 3SZ6 'Apo-IsdX1, a B. anthacis hemophore' unspecified PDB 4H8P 'WT-IsdX2 NEAT5' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4H8Q _pdbx_database_status.recvd_initial_deposition_date 2012-09-23 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Owens, C.P.' 1 'Goulding, C.W.' 2 # _citation.id primary _citation.title ;The Near-iron Transporter (NEAT) Domains of the Anthrax Hemophore IsdX2 Require a Critical Glutamine to Extract Heme from Methemoglobin. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 288 _citation.page_first 8479 _citation.page_last 8490 _citation.year 2013 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23364793 _citation.pdbx_database_id_DOI 10.1074/jbc.M112.430009 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Honsa, E.S.' 1 primary 'Owens, C.P.' 2 primary 'Goulding, C.W.' 3 primary 'Maresso, A.W.' 4 # _cell.entry_id 4H8Q _cell.length_a 109.090 _cell.length_b 109.090 _cell.length_c 109.090 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4H8Q _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Iron Transport-associated domain protein' 14679.691 1 ? Q29T 'NEAT5 domain, UNP residues 675-797' ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 water nat water 18.015 130 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name IsdX2 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMASDPKNLKDGQYDIAFKVLKDKTEEISMMNTYVVSPARLTVKDGKKYIAMTLKNSEWITKFQTEKNGGFADAKVVS EDKAANTRVVEFEANDLFAKLNAKVKVDIDSMNYHHFYDVQIQFDPTKI ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMASDPKNLKDGQYDIAFKVLKDKTEEISMMNTYVVSPARLTVKDGKKYIAMTLKNSEWITKFQTEKNGGFADAKVVS EDKAANTRVVEFEANDLFAKLNAKVKVDIDSMNYHHFYDVQIQFDPTKI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 SER n 1 7 ASP n 1 8 PRO n 1 9 LYS n 1 10 ASN n 1 11 LEU n 1 12 LYS n 1 13 ASP n 1 14 GLY n 1 15 GLN n 1 16 TYR n 1 17 ASP n 1 18 ILE n 1 19 ALA n 1 20 PHE n 1 21 LYS n 1 22 VAL n 1 23 LEU n 1 24 LYS n 1 25 ASP n 1 26 LYS n 1 27 THR n 1 28 GLU n 1 29 GLU n 1 30 ILE n 1 31 SER n 1 32 MET n 1 33 MET n 1 34 ASN n 1 35 THR n 1 36 TYR n 1 37 VAL n 1 38 VAL n 1 39 SER n 1 40 PRO n 1 41 ALA n 1 42 ARG n 1 43 LEU n 1 44 THR n 1 45 VAL n 1 46 LYS n 1 47 ASP n 1 48 GLY n 1 49 LYS n 1 50 LYS n 1 51 TYR n 1 52 ILE n 1 53 ALA n 1 54 MET n 1 55 THR n 1 56 LEU n 1 57 LYS n 1 58 ASN n 1 59 SER n 1 60 GLU n 1 61 TRP n 1 62 ILE n 1 63 THR n 1 64 LYS n 1 65 PHE n 1 66 GLN n 1 67 THR n 1 68 GLU n 1 69 LYS n 1 70 ASN n 1 71 GLY n 1 72 GLY n 1 73 PHE n 1 74 ALA n 1 75 ASP n 1 76 ALA n 1 77 LYS n 1 78 VAL n 1 79 VAL n 1 80 SER n 1 81 GLU n 1 82 ASP n 1 83 LYS n 1 84 ALA n 1 85 ALA n 1 86 ASN n 1 87 THR n 1 88 ARG n 1 89 VAL n 1 90 VAL n 1 91 GLU n 1 92 PHE n 1 93 GLU n 1 94 ALA n 1 95 ASN n 1 96 ASP n 1 97 LEU n 1 98 PHE n 1 99 ALA n 1 100 LYS n 1 101 LEU n 1 102 ASN n 1 103 ALA n 1 104 LYS n 1 105 VAL n 1 106 LYS n 1 107 VAL n 1 108 ASP n 1 109 ILE n 1 110 ASP n 1 111 SER n 1 112 MET n 1 113 ASN n 1 114 TYR n 1 115 HIS n 1 116 HIS n 1 117 PHE n 1 118 TYR n 1 119 ASP n 1 120 VAL n 1 121 GLN n 1 122 ILE n 1 123 GLN n 1 124 PHE n 1 125 ASP n 1 126 PRO n 1 127 THR n 1 128 LYS n 1 129 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name anthrax _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BA_4787, BAS4442, GBAA_4787' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus anthracis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1392 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q81L45_BACAN _struct_ref.pdbx_db_accession Q81L45 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DPKNLKDGQYDIAFKVLKDKTEEISMMNQYVVSPARLTVKDGKKYIAMTLKNSEWITKFQTEKNGGFADAKVVSEDKAAN TRVVEFEANDLFAKLNAKVKVDIDSMNYHHFYDVQIQFDPTKI ; _struct_ref.pdbx_align_begin 675 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4H8Q _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 129 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q81L45 _struct_ref_seq.db_align_beg 675 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 797 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 123 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4H8Q GLY A 1 ? UNP Q81L45 ? ? 'EXPRESSION TAG' -5 1 1 4H8Q SER A 2 ? UNP Q81L45 ? ? 'EXPRESSION TAG' -4 2 1 4H8Q HIS A 3 ? UNP Q81L45 ? ? 'EXPRESSION TAG' -3 3 1 4H8Q MET A 4 ? UNP Q81L45 ? ? 'EXPRESSION TAG' -2 4 1 4H8Q ALA A 5 ? UNP Q81L45 ? ? 'EXPRESSION TAG' -1 5 1 4H8Q SER A 6 ? UNP Q81L45 ? ? 'EXPRESSION TAG' 0 6 1 4H8Q THR A 35 ? UNP Q81L45 GLN 703 'ENGINEERED MUTATION' 29 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 4H8Q _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.85 _exptl_crystal.density_percent_sol 68.1 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.25 _exptl_crystal_grow.pdbx_details '5% PEG 3000, 0.2 M Zn acetate and 0.1 M sodium acetate pH 5.25, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 77 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.pdbx_collection_date 2012-06-12 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double crystal monochromator' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1 # _reflns.entry_id 4H8Q _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 38.57 _reflns.d_resolution_high 1.49 _reflns.number_obs 35031 _reflns.number_all ? _reflns.percent_possible_obs 100 _reflns.pdbx_Rmerge_I_obs 0.073 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 44.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 4H8Q _refine.ls_number_reflns_obs 23875 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 38.569 _refine.ls_d_res_high 1.700 _refine.ls_percent_reflns_obs 99.97 _refine.ls_R_factor_obs 0.1909 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1898 _refine.ls_R_factor_R_free 0.2083 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.70 _refine.ls_number_reflns_R_free 1362 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[3][3] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.358 _refine.solvent_model_param_bsol 43.616 _refine.pdbx_solvent_vdw_probe_radii 1.00 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.72 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 4H8P _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.31 _refine.pdbx_overall_phase_error 18.99 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 957 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 44 _refine_hist.number_atoms_solvent 130 _refine_hist.number_atoms_total 1131 _refine_hist.d_res_high 1.700 _refine_hist.d_res_low 38.569 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.006 ? ? 1037 ? 'X-RAY DIFFRACTION' f_angle_d 1.056 ? ? 1409 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 15.706 ? ? 378 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.069 ? ? 147 ? 'X-RAY DIFFRACTION' f_plane_restr 0.003 ? ? 175 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 1.7004 1.7612 2234 0.2024 100.00 0.2156 . . 134 . . . . 'X-RAY DIFFRACTION' . 1.7612 1.8317 2218 0.2038 100.00 0.2722 . . 133 . . . . 'X-RAY DIFFRACTION' . 1.8317 1.9150 2242 0.1931 100.00 0.1997 . . 135 . . . . 'X-RAY DIFFRACTION' . 1.9150 2.0160 2236 0.1907 100.00 0.1885 . . 137 . . . . 'X-RAY DIFFRACTION' . 2.0160 2.1423 2246 0.1865 1.01 0.2374 . . 138 . . . . 'X-RAY DIFFRACTION' . 2.1423 2.3077 2217 0.2009 100.00 0.2315 . . 134 . . . . 'X-RAY DIFFRACTION' . 2.3077 2.5399 2264 0.2115 100.00 0.2059 . . 131 . . . . 'X-RAY DIFFRACTION' . 2.5399 2.9073 2247 0.2016 100.00 0.2188 . . 140 . . . . 'X-RAY DIFFRACTION' . 2.9073 3.6624 2272 0.1892 100.00 0.2308 . . 137 . . . . 'X-RAY DIFFRACTION' . 3.6624 38.5790 2337 0.1733 100.00 0.1731 . . 143 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 4H8Q _struct.title 'Structure of the Q29T IsdX2-NEAT5 mutant in complex with heme' _struct.pdbx_descriptor 'Iron Transport-associated domain protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4H8Q _struct_keywords.pdbx_keywords 'HEME-BINDING PROTEIN' _struct_keywords.text 'NEAT domain, Heme transport Heme scavenging, hemophore, HEME-BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 31 ? VAL A 37 ? SER A 25 VAL A 31 5 ? 7 HELX_P HELX_P2 2 ASN A 58 ? GLU A 60 ? ASN A 52 GLU A 54 5 ? 3 HELX_P HELX_P3 3 ASP A 110 ? ASN A 113 ? ASP A 104 ASN A 107 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A TYR 114 OH ? ? ? 1_555 B HEM . FE ? ? A TYR 108 A HEM 201 1_555 ? ? ? ? ? ? ? 2.058 ? metalc2 metalc ? ? A HIS 116 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 110 A ZN 202 1_555 ? ? ? ? ? ? ? 2.110 ? metalc3 metalc ? ? C ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 202 A HOH 421 1_555 ? ? ? ? ? ? ? 2.357 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 39 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 33 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 40 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 34 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.66 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 72 ? ASP A 75 ? GLY A 66 ASP A 69 A 2 ILE A 62 ? LYS A 69 ? ILE A 56 LYS A 63 A 3 LEU A 101 ? ILE A 109 ? LEU A 95 ILE A 103 A 4 TYR A 114 ? ASP A 125 ? TYR A 108 ASP A 119 A 5 GLY A 14 ? LYS A 24 ? GLY A 8 LYS A 18 A 6 ALA A 41 ? LYS A 46 ? ALA A 35 LYS A 40 A 7 LYS A 49 ? LEU A 56 ? LYS A 43 LEU A 50 A 8 THR A 87 ? ALA A 94 ? THR A 81 ALA A 88 A 9 LYS A 77 ? ASP A 82 ? LYS A 71 ASP A 76 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLY A 72 ? O GLY A 66 N LYS A 69 ? N LYS A 63 A 2 3 N GLN A 66 ? N GLN A 60 O LYS A 104 ? O LYS A 98 A 3 4 N LEU A 101 ? N LEU A 95 O ILE A 122 ? O ILE A 116 A 4 5 O GLN A 121 ? O GLN A 115 N LEU A 23 ? N LEU A 17 A 5 6 N TYR A 16 ? N TYR A 10 O LEU A 43 ? O LEU A 37 A 6 7 N THR A 44 ? N THR A 38 O TYR A 51 ? O TYR A 45 A 7 8 N ILE A 52 ? N ILE A 46 O PHE A 92 ? O PHE A 86 A 8 9 O THR A 87 ? O THR A 81 N ASP A 82 ? N ASP A 76 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE HEM A 201' AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 20 LYS A 24 ? LYS A 18 . ? 1_555 ? 2 AC1 20 SER A 31 ? SER A 25 . ? 1_555 ? 3 AC1 20 MET A 32 ? MET A 26 . ? 1_555 ? 4 AC1 20 MET A 33 ? MET A 27 . ? 1_555 ? 5 AC1 20 TYR A 36 ? TYR A 30 . ? 1_555 ? 6 AC1 20 TRP A 61 ? TRP A 55 . ? 1_555 ? 7 AC1 20 VAL A 105 ? VAL A 99 . ? 1_555 ? 8 AC1 20 VAL A 107 ? VAL A 101 . ? 1_555 ? 9 AC1 20 ILE A 109 ? ILE A 103 . ? 1_555 ? 10 AC1 20 TYR A 114 ? TYR A 108 . ? 1_555 ? 11 AC1 20 TYR A 114 ? TYR A 108 . ? 2_545 ? 12 AC1 20 HIS A 116 ? HIS A 110 . ? 2_545 ? 13 AC1 20 TYR A 118 ? TYR A 112 . ? 1_555 ? 14 AC1 20 VAL A 120 ? VAL A 114 . ? 1_555 ? 15 AC1 20 HOH D . ? HOH A 302 . ? 1_555 ? 16 AC1 20 HOH D . ? HOH A 322 . ? 2_545 ? 17 AC1 20 HOH D . ? HOH A 369 . ? 2_545 ? 18 AC1 20 HOH D . ? HOH A 379 . ? 18_544 ? 19 AC1 20 HOH D . ? HOH A 391 . ? 1_555 ? 20 AC1 20 HOH D . ? HOH A 392 . ? 1_555 ? 21 AC2 3 ASP A 17 ? ASP A 11 . ? 20_444 ? 22 AC2 3 HIS A 116 ? HIS A 110 . ? 1_555 ? 23 AC2 3 HOH D . ? HOH A 421 . ? 1_555 ? # _database_PDB_matrix.entry_id 4H8Q _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4H8Q _atom_sites.fract_transf_matrix[1][1] 0.009167 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009167 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009167 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -5 ? ? ? A . n A 1 2 SER 2 -4 ? ? ? A . n A 1 3 HIS 3 -3 ? ? ? A . n A 1 4 MET 4 -2 ? ? ? A . n A 1 5 ALA 5 -1 ? ? ? A . n A 1 6 SER 6 0 ? ? ? A . n A 1 7 ASP 7 1 ? ? ? A . n A 1 8 PRO 8 2 ? ? ? A . n A 1 9 LYS 9 3 ? ? ? A . n A 1 10 ASN 10 4 ? ? ? A . n A 1 11 LEU 11 5 5 LEU ALA A . n A 1 12 LYS 12 6 6 LYS LYS A . n A 1 13 ASP 13 7 7 ASP ASP A . n A 1 14 GLY 14 8 8 GLY GLY A . n A 1 15 GLN 15 9 9 GLN GLN A . n A 1 16 TYR 16 10 10 TYR TYR A . n A 1 17 ASP 17 11 11 ASP ASP A . n A 1 18 ILE 18 12 12 ILE ILE A . n A 1 19 ALA 19 13 13 ALA ALA A . n A 1 20 PHE 20 14 14 PHE PHE A . n A 1 21 LYS 21 15 15 LYS LYS A . n A 1 22 VAL 22 16 16 VAL VAL A . n A 1 23 LEU 23 17 17 LEU LEU A . n A 1 24 LYS 24 18 18 LYS LYS A . n A 1 25 ASP 25 19 19 ASP ASP A . n A 1 26 LYS 26 20 20 LYS LYS A . n A 1 27 THR 27 21 21 THR THR A . n A 1 28 GLU 28 22 22 GLU GLU A . n A 1 29 GLU 29 23 23 GLU GLU A . n A 1 30 ILE 30 24 24 ILE ILE A . n A 1 31 SER 31 25 25 SER SER A . n A 1 32 MET 32 26 26 MET MET A . n A 1 33 MET 33 27 27 MET MET A . n A 1 34 ASN 34 28 28 ASN ASN A . n A 1 35 THR 35 29 29 THR THR A . n A 1 36 TYR 36 30 30 TYR TYR A . n A 1 37 VAL 37 31 31 VAL VAL A . n A 1 38 VAL 38 32 32 VAL VAL A . n A 1 39 SER 39 33 33 SER SER A . n A 1 40 PRO 40 34 34 PRO PRO A . n A 1 41 ALA 41 35 35 ALA ALA A . n A 1 42 ARG 42 36 36 ARG ARG A . n A 1 43 LEU 43 37 37 LEU LEU A . n A 1 44 THR 44 38 38 THR THR A . n A 1 45 VAL 45 39 39 VAL VAL A . n A 1 46 LYS 46 40 40 LYS LYS A . n A 1 47 ASP 47 41 41 ASP ASP A . n A 1 48 GLY 48 42 42 GLY GLY A . n A 1 49 LYS 49 43 43 LYS LYS A . n A 1 50 LYS 50 44 44 LYS LYS A . n A 1 51 TYR 51 45 45 TYR TYR A . n A 1 52 ILE 52 46 46 ILE ILE A . n A 1 53 ALA 53 47 47 ALA ALA A . n A 1 54 MET 54 48 48 MET MET A . n A 1 55 THR 55 49 49 THR THR A . n A 1 56 LEU 56 50 50 LEU LEU A . n A 1 57 LYS 57 51 51 LYS LYS A . n A 1 58 ASN 58 52 52 ASN ASN A . n A 1 59 SER 59 53 53 SER SER A . n A 1 60 GLU 60 54 54 GLU GLU A . n A 1 61 TRP 61 55 55 TRP TRP A . n A 1 62 ILE 62 56 56 ILE ILE A . n A 1 63 THR 63 57 57 THR THR A . n A 1 64 LYS 64 58 58 LYS LYS A . n A 1 65 PHE 65 59 59 PHE PHE A . n A 1 66 GLN 66 60 60 GLN GLN A . n A 1 67 THR 67 61 61 THR THR A . n A 1 68 GLU 68 62 62 GLU GLU A . n A 1 69 LYS 69 63 63 LYS LYS A . n A 1 70 ASN 70 64 64 ASN ASN A . n A 1 71 GLY 71 65 65 GLY GLY A . n A 1 72 GLY 72 66 66 GLY GLY A . n A 1 73 PHE 73 67 67 PHE PHE A . n A 1 74 ALA 74 68 68 ALA ALA A . n A 1 75 ASP 75 69 69 ASP ASP A . n A 1 76 ALA 76 70 70 ALA ALA A . n A 1 77 LYS 77 71 71 LYS LYS A . n A 1 78 VAL 78 72 72 VAL VAL A . n A 1 79 VAL 79 73 73 VAL VAL A . n A 1 80 SER 80 74 74 SER SER A . n A 1 81 GLU 81 75 75 GLU GLU A . n A 1 82 ASP 82 76 76 ASP ASP A . n A 1 83 LYS 83 77 77 LYS LYS A . n A 1 84 ALA 84 78 78 ALA ALA A . n A 1 85 ALA 85 79 79 ALA ALA A . n A 1 86 ASN 86 80 80 ASN ASN A . n A 1 87 THR 87 81 81 THR THR A . n A 1 88 ARG 88 82 82 ARG ARG A . n A 1 89 VAL 89 83 83 VAL VAL A . n A 1 90 VAL 90 84 84 VAL VAL A . n A 1 91 GLU 91 85 85 GLU GLU A . n A 1 92 PHE 92 86 86 PHE PHE A . n A 1 93 GLU 93 87 87 GLU GLU A . n A 1 94 ALA 94 88 88 ALA ALA A . n A 1 95 ASN 95 89 89 ASN ASN A . n A 1 96 ASP 96 90 90 ASP ASP A . n A 1 97 LEU 97 91 91 LEU LEU A . n A 1 98 PHE 98 92 92 PHE PHE A . n A 1 99 ALA 99 93 93 ALA ALA A . n A 1 100 LYS 100 94 94 LYS LYS A . n A 1 101 LEU 101 95 95 LEU LEU A . n A 1 102 ASN 102 96 96 ASN ASN A . n A 1 103 ALA 103 97 97 ALA ALA A . n A 1 104 LYS 104 98 98 LYS LYS A . n A 1 105 VAL 105 99 99 VAL VAL A . n A 1 106 LYS 106 100 100 LYS LYS A . n A 1 107 VAL 107 101 101 VAL VAL A . n A 1 108 ASP 108 102 102 ASP ASP A . n A 1 109 ILE 109 103 103 ILE ILE A . n A 1 110 ASP 110 104 104 ASP ASP A . n A 1 111 SER 111 105 105 SER SER A . n A 1 112 MET 112 106 106 MET MET A . n A 1 113 ASN 113 107 107 ASN ASN A . n A 1 114 TYR 114 108 108 TYR TYR A . n A 1 115 HIS 115 109 109 HIS HIS A . n A 1 116 HIS 116 110 110 HIS HIS A . n A 1 117 PHE 117 111 111 PHE PHE A . n A 1 118 TYR 118 112 112 TYR TYR A . n A 1 119 ASP 119 113 113 ASP ASP A . n A 1 120 VAL 120 114 114 VAL VAL A . n A 1 121 GLN 121 115 115 GLN GLN A . n A 1 122 ILE 122 116 116 ILE ILE A . n A 1 123 GLN 123 117 117 GLN GLN A . n A 1 124 PHE 124 118 118 PHE PHE A . n A 1 125 ASP 125 119 119 ASP ASP A . n A 1 126 PRO 126 120 120 PRO PRO A . n A 1 127 THR 127 121 121 THR THR A . n A 1 128 LYS 128 122 122 LYS LYS A . n A 1 129 ILE 129 123 123 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 201 154 HEM HEM A . C 3 ZN 1 202 1 ZN ZN A . D 4 HOH 1 301 1 HOH HOH A . D 4 HOH 2 302 2 HOH HOH A . D 4 HOH 3 303 3 HOH HOH A . D 4 HOH 4 304 4 HOH HOH A . D 4 HOH 5 305 5 HOH HOH A . D 4 HOH 6 306 6 HOH HOH A . D 4 HOH 7 307 7 HOH HOH A . D 4 HOH 8 308 8 HOH HOH A . D 4 HOH 9 309 9 HOH HOH A . D 4 HOH 10 310 10 HOH HOH A . D 4 HOH 11 311 11 HOH HOH A . D 4 HOH 12 312 12 HOH HOH A . D 4 HOH 13 313 13 HOH HOH A . D 4 HOH 14 314 14 HOH HOH A . D 4 HOH 15 315 15 HOH HOH A . D 4 HOH 16 316 16 HOH HOH A . D 4 HOH 17 317 17 HOH HOH A . D 4 HOH 18 318 18 HOH HOH A . D 4 HOH 19 319 19 HOH HOH A . D 4 HOH 20 320 20 HOH HOH A . D 4 HOH 21 321 21 HOH HOH A . D 4 HOH 22 322 22 HOH HOH A . D 4 HOH 23 323 23 HOH HOH A . D 4 HOH 24 324 24 HOH HOH A . D 4 HOH 25 325 25 HOH HOH A . D 4 HOH 26 326 26 HOH HOH A . D 4 HOH 27 327 27 HOH HOH A . D 4 HOH 28 328 28 HOH HOH A . D 4 HOH 29 329 29 HOH HOH A . D 4 HOH 30 330 30 HOH HOH A . D 4 HOH 31 331 31 HOH HOH A . D 4 HOH 32 332 32 HOH HOH A . D 4 HOH 33 333 33 HOH HOH A . D 4 HOH 34 334 34 HOH HOH A . D 4 HOH 35 335 35 HOH HOH A . D 4 HOH 36 336 36 HOH HOH A . D 4 HOH 37 337 37 HOH HOH A . D 4 HOH 38 338 38 HOH HOH A . D 4 HOH 39 339 39 HOH HOH A . D 4 HOH 40 340 40 HOH HOH A . D 4 HOH 41 341 41 HOH HOH A . D 4 HOH 42 342 42 HOH HOH A . D 4 HOH 43 343 43 HOH HOH A . D 4 HOH 44 344 44 HOH HOH A . D 4 HOH 45 345 45 HOH HOH A . D 4 HOH 46 346 46 HOH HOH A . D 4 HOH 47 347 47 HOH HOH A . D 4 HOH 48 348 48 HOH HOH A . D 4 HOH 49 349 49 HOH HOH A . D 4 HOH 50 350 50 HOH HOH A . D 4 HOH 51 351 51 HOH HOH A . D 4 HOH 52 352 52 HOH HOH A . D 4 HOH 53 353 53 HOH HOH A . D 4 HOH 54 354 54 HOH HOH A . D 4 HOH 55 355 55 HOH HOH A . D 4 HOH 56 356 56 HOH HOH A . D 4 HOH 57 357 57 HOH HOH A . D 4 HOH 58 358 58 HOH HOH A . D 4 HOH 59 359 59 HOH HOH A . D 4 HOH 60 360 60 HOH HOH A . D 4 HOH 61 361 61 HOH HOH A . D 4 HOH 62 362 62 HOH HOH A . D 4 HOH 63 363 63 HOH HOH A . D 4 HOH 64 364 64 HOH HOH A . D 4 HOH 65 365 65 HOH HOH A . D 4 HOH 66 366 66 HOH HOH A . D 4 HOH 67 367 67 HOH HOH A . D 4 HOH 68 368 68 HOH HOH A . D 4 HOH 69 369 69 HOH HOH A . D 4 HOH 70 370 70 HOH HOH A . D 4 HOH 71 371 71 HOH HOH A . D 4 HOH 72 372 72 HOH HOH A . D 4 HOH 73 373 73 HOH HOH A . D 4 HOH 74 374 74 HOH HOH A . D 4 HOH 75 375 75 HOH HOH A . D 4 HOH 76 376 76 HOH HOH A . D 4 HOH 77 377 77 HOH HOH A . D 4 HOH 78 378 78 HOH HOH A . D 4 HOH 79 379 79 HOH HOH A . D 4 HOH 80 380 80 HOH HOH A . D 4 HOH 81 381 81 HOH HOH A . D 4 HOH 82 382 82 HOH HOH A . D 4 HOH 83 383 83 HOH HOH A . D 4 HOH 84 384 84 HOH HOH A . D 4 HOH 85 385 85 HOH HOH A . D 4 HOH 86 386 86 HOH HOH A . D 4 HOH 87 387 87 HOH HOH A . D 4 HOH 88 388 88 HOH HOH A . D 4 HOH 89 389 89 HOH HOH A . D 4 HOH 90 390 90 HOH HOH A . D 4 HOH 91 391 91 HOH HOH A . D 4 HOH 92 392 92 HOH HOH A . D 4 HOH 93 393 93 HOH HOH A . D 4 HOH 94 394 94 HOH HOH A . D 4 HOH 95 395 95 HOH HOH A . D 4 HOH 96 396 96 HOH HOH A . D 4 HOH 97 397 97 HOH HOH A . D 4 HOH 98 398 98 HOH HOH A . D 4 HOH 99 399 99 HOH HOH A . D 4 HOH 100 400 100 HOH HOH A . D 4 HOH 101 401 101 HOH HOH A . D 4 HOH 102 402 102 HOH HOH A . D 4 HOH 103 403 103 HOH HOH A . D 4 HOH 104 404 104 HOH HOH A . D 4 HOH 105 405 105 HOH HOH A . D 4 HOH 106 406 106 HOH HOH A . D 4 HOH 107 407 107 HOH HOH A . D 4 HOH 108 408 108 HOH HOH A . D 4 HOH 109 409 109 HOH HOH A . D 4 HOH 110 410 110 HOH HOH A . D 4 HOH 111 411 111 HOH HOH A . D 4 HOH 112 412 112 HOH HOH A . D 4 HOH 113 413 113 HOH HOH A . D 4 HOH 114 414 114 HOH HOH A . D 4 HOH 115 415 115 HOH HOH A . D 4 HOH 116 416 116 HOH HOH A . D 4 HOH 117 417 117 HOH HOH A . D 4 HOH 118 418 118 HOH HOH A . D 4 HOH 119 419 119 HOH HOH A . D 4 HOH 120 420 120 HOH HOH A . D 4 HOH 121 421 121 HOH HOH A . D 4 HOH 122 422 122 HOH HOH A . D 4 HOH 123 423 123 HOH HOH A . D 4 HOH 124 424 124 HOH HOH A . D 4 HOH 125 425 125 HOH HOH A . D 4 HOH 126 426 126 HOH HOH A . D 4 HOH 127 427 127 HOH HOH A . D 4 HOH 128 428 128 HOH HOH A . D 4 HOH 129 429 129 HOH HOH A . D 4 HOH 130 430 130 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OH ? A TYR 114 ? A TYR 108 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NA ? B HEM . ? A HEM 201 ? 1_555 94.2 ? 2 OH ? A TYR 114 ? A TYR 108 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NB ? B HEM . ? A HEM 201 ? 1_555 98.0 ? 3 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NB ? B HEM . ? A HEM 201 ? 1_555 90.2 ? 4 OH ? A TYR 114 ? A TYR 108 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 99.3 ? 5 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 166.5 ? 6 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 88.4 ? 7 OH ? A TYR 114 ? A TYR 108 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 94.4 ? 8 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 88.4 ? 9 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 167.6 ? 10 NC ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 90.1 ? 11 ND1 ? A HIS 116 ? A HIS 110 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O ? D HOH . ? A HOH 421 ? 1_555 92.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-02-06 2 'Structure model' 1 1 2013-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal Web-ice 'data collection' . ? 1 PHENIX refinement '(phenix.refine: 1.7.1_743)' ? 2 MOSFLM 'data reduction' . ? 3 SCALA 'data scaling' . ? 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 410 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 411 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 18_544 _pdbx_validate_symm_contact.dist 2.07 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 89 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -109.49 _pdbx_validate_torsion.psi -83.92 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 5 ? CG ? A LEU 11 CG 2 1 Y 1 A LEU 5 ? CD1 ? A LEU 11 CD1 3 1 Y 1 A LEU 5 ? CD2 ? A LEU 11 CD2 4 1 Y 0 A MET 26 ? CA B A MET 32 CA 5 1 Y 0 A MET 26 ? CB B A MET 32 CB 6 1 Y 0 A MET 26 ? CG B A MET 32 CG 7 1 Y 0 A MET 26 ? SD B A MET 32 SD 8 1 Y 0 A MET 26 ? CE B A MET 32 CE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -5 ? A GLY 1 2 1 Y 1 A SER -4 ? A SER 2 3 1 Y 1 A HIS -3 ? A HIS 3 4 1 Y 1 A MET -2 ? A MET 4 5 1 Y 1 A ALA -1 ? A ALA 5 6 1 Y 1 A SER 0 ? A SER 6 7 1 Y 1 A ASP 1 ? A ASP 7 8 1 Y 1 A PRO 2 ? A PRO 8 9 1 Y 1 A LYS 3 ? A LYS 9 10 1 Y 1 A ASN 4 ? A ASN 10 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 'ZINC ION' ZN 4 water HOH #