data_4HHG # _entry.id 4HHG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4HHG RCSB RCSB075470 WWPDB D_1000075470 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4HHG _pdbx_database_status.recvd_initial_deposition_date 2012-10-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Herrera, N.' 1 'Warren, J.J.' 2 'Gray, H.B.' 3 # _citation.id primary _citation.title 'Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 135 _citation.page_first 11151 _citation.page_last 11158 _citation.year 2013 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23859602 _citation.pdbx_database_id_DOI 10.1021/ja403734n # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Warren, J.J.' 1 primary 'Herrera, N.' 2 primary 'Hill, M.G.' 3 primary 'Winkler, J.R.' 4 primary 'Gray, H.B.' 5 # _cell.entry_id 4HHG _cell.length_a 49.762 _cell.length_b 67.176 _cell.length_c 81.385 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4HHG _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Azurin 14049.817 1 ? W68F,Y92F,H103Q,Y128F,M129NIY,Q127H ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 non-polymer syn ;DELTA-BIS(2,2'-BIPYRIDINE)IMIDAZOLE RUTHENIUM (II) ; 480.507 1 ? ? ? ? 4 water nat water 18.015 70 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRV IAHTKLIGSGEKDSVTFDVSKLKEEEHF(NIY)FFCTFPGHSALMKGTLTLK ; _entity_poly.pdbx_seq_one_letter_code_can ;AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRV IAHTKLIGSGEKDSVTFDVSKLKEEEHFYFFCTFPGHSALMKGTLTLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 CYS n 1 4 SER n 1 5 VAL n 1 6 ASP n 1 7 ILE n 1 8 GLN n 1 9 GLY n 1 10 ASN n 1 11 ASP n 1 12 GLN n 1 13 MET n 1 14 GLN n 1 15 PHE n 1 16 ASN n 1 17 THR n 1 18 ASN n 1 19 ALA n 1 20 ILE n 1 21 THR n 1 22 VAL n 1 23 ASP n 1 24 LYS n 1 25 SER n 1 26 CYS n 1 27 LYS n 1 28 GLN n 1 29 PHE n 1 30 THR n 1 31 VAL n 1 32 ASN n 1 33 LEU n 1 34 SER n 1 35 HIS n 1 36 PRO n 1 37 GLY n 1 38 ASN n 1 39 LEU n 1 40 PRO n 1 41 LYS n 1 42 ASN n 1 43 VAL n 1 44 MET n 1 45 GLY n 1 46 HIS n 1 47 ASN n 1 48 PHE n 1 49 VAL n 1 50 LEU n 1 51 SER n 1 52 THR n 1 53 ALA n 1 54 ALA n 1 55 ASP n 1 56 MET n 1 57 GLN n 1 58 GLY n 1 59 VAL n 1 60 VAL n 1 61 THR n 1 62 ASP n 1 63 GLY n 1 64 MET n 1 65 ALA n 1 66 SER n 1 67 GLY n 1 68 LEU n 1 69 ASP n 1 70 LYS n 1 71 ASP n 1 72 PHE n 1 73 LEU n 1 74 LYS n 1 75 PRO n 1 76 ASP n 1 77 ASP n 1 78 SER n 1 79 ARG n 1 80 VAL n 1 81 ILE n 1 82 ALA n 1 83 HIS n 1 84 THR n 1 85 LYS n 1 86 LEU n 1 87 ILE n 1 88 GLY n 1 89 SER n 1 90 GLY n 1 91 GLU n 1 92 LYS n 1 93 ASP n 1 94 SER n 1 95 VAL n 1 96 THR n 1 97 PHE n 1 98 ASP n 1 99 VAL n 1 100 SER n 1 101 LYS n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 GLU n 1 106 GLU n 1 107 HIS n 1 108 PHE n 1 109 NIY n 1 110 PHE n 1 111 PHE n 1 112 CYS n 1 113 THR n 1 114 PHE n 1 115 PRO n 1 116 GLY n 1 117 HIS n 1 118 SER n 1 119 ALA n 1 120 LEU n 1 121 MET n 1 122 LYS n 1 123 GLY n 1 124 THR n 1 125 LEU n 1 126 THR n 1 127 LEU n 1 128 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'azu, PA4922' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AZUR_PSEAE _struct_ref.pdbx_db_accession P00282 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRV IAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK ; _struct_ref.pdbx_align_begin 21 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4HHG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00282 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 128 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4HHG PHE A 48 ? UNP P00282 TRP 68 'ENGINEERED MUTATION' 48 1 1 4HHG PHE A 72 ? UNP P00282 TYR 92 'ENGINEERED MUTATION' 72 2 1 4HHG GLU A 105 ? UNP P00282 GLY 125 CONFLICT 105 3 1 4HHG HIS A 107 ? UNP P00282 GLN 127 'ENGINEERED MUTATION' 107 4 1 4HHG PHE A 108 ? UNP P00282 TYR 128 'ENGINEERED MUTATION' 108 5 1 4HHG NIY A 109 ? UNP P00282 MET 129 'ENGINEERED MUTATION' 109 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DRU non-polymer . ;DELTA-BIS(2,2'-BIPYRIDINE)IMIDAZOLE RUTHENIUM (II) ; ? 'C23 H19 N6 Ru 2' 480.507 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NIY 'L-peptide linking' n META-NITRO-TYROSINE ? 'C9 H10 N2 O5' 226.186 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4HHG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.42 _exptl_crystal.density_percent_sol 49.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;26-34% PEG 4000, 100mM Lithium Nitrate, 6.25mM Copper Sulfate and 100 mM Imidazole, pH 7.2, VAPOR DIFFUSION, SITTING DROP, temperature 293.15K ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2012-02-17 _diffrn_detector.details 'K-B focusing mirrors' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Liquid nitrogen-cooled double crystal, Si 111' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.00 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4HHG _reflns.observed_criterion_sigma_I 45.2 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 51.81 _reflns.d_resolution_high 1.18 _reflns.number_obs ? _reflns.number_all 43899 _reflns.percent_possible_obs 97.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4HHG _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 17259 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.59 _refine.ls_d_res_high 1.60 _refine.ls_percent_reflns_obs 98.92 _refine.ls_R_factor_obs 0.23545 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.23415 _refine.ls_R_factor_R_free 0.26052 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 927 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.928 _refine.correlation_coeff_Fo_to_Fc_free 0.925 _refine.B_iso_mean 20.970 _refine.aniso_B[1][1] -0.90 _refine.aniso_B[2][2] 0.66 _refine.aniso_B[3][3] 0.25 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.112 _refine.pdbx_overall_ESU_R_Free 0.107 _refine.overall_SU_ML 0.078 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 2.178 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 982 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.number_atoms_solvent 70 _refine_hist.number_atoms_total 1083 _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 33.59 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.025 0.020 ? 1058 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.682 2.003 ? 1444 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.412 5.000 ? 135 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 40.461 26.364 ? 44 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 16.458 15.000 ? 180 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 12.093 15.000 ? 1 'X-RAY DIFFRACTION' ? r_chiral_restr 0.207 0.200 ? 159 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.015 0.021 ? 802 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.600 _refine_ls_shell.d_res_low 1.641 _refine_ls_shell.number_reflns_R_work 1152 _refine_ls_shell.R_factor_R_work 0.300 _refine_ls_shell.percent_reflns_obs 99.02 _refine_ls_shell.R_factor_R_free 0.299 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 62 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.entry_id 4HHG _pdbx_refine.R_factor_all_no_cutoff ? _pdbx_refine.R_factor_obs_no_cutoff ? _pdbx_refine.free_R_factor_no_cutoff ? _pdbx_refine.free_R_error_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff ? _pdbx_refine.free_R_val_test_set_ct_no_cutoff ? _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff ? # _struct.entry_id 4HHG _struct.title 'Crystal structure of the Pseudomonas aeruginosa azurin, RuH107NO YOH109' _struct.pdbx_descriptor Azurin _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4HHG _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'Greek key, Electron Transfer, Nitrosylated, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 40 ? GLY A 45 ? PRO A 40 GLY A 45 1 ? 6 HELX_P HELX_P2 2 ASP A 55 ? GLY A 67 ? ASP A 55 GLY A 67 1 ? 13 HELX_P HELX_P3 3 LEU A 68 ? ASP A 71 ? LEU A 68 ASP A 71 5 ? 4 HELX_P HELX_P4 4 SER A 100 ? LYS A 103 ? SER A 100 LYS A 103 5 ? 4 HELX_P HELX_P5 5 GLY A 116 ? LEU A 120 ? GLY A 116 LEU A 120 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 3 A CYS 26 1_555 ? ? ? ? ? ? ? 2.087 ? covale1 covale ? ? A PHE 108 C ? ? ? 1_555 A NIY 109 N ? ? A PHE 108 A NIY 109 1_555 ? ? ? ? ? ? ? 1.327 ? covale2 covale ? ? A NIY 109 C ? ? ? 1_555 A PHE 110 N ? ? A NIY 109 A PHE 110 1_555 ? ? ? ? ? ? ? 1.316 ? metalc1 metalc ? ? A HIS 46 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 46 A CU 201 1_555 ? ? ? ? ? ? ? 1.985 ? metalc2 metalc ? ? A HIS 117 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 117 A CU 201 1_555 ? ? ? ? ? ? ? 1.994 ? metalc3 metalc ? ? A HIS 107 NE2 ? ? ? 1_555 C DRU . RU A ? A HIS 107 A DRU 202 1_555 ? ? ? ? ? ? ? 2.056 ? metalc4 metalc ? ? A CYS 112 SG ? ? ? 1_555 B CU . CU ? ? A CYS 112 A CU 201 1_555 ? ? ? ? ? ? ? 2.276 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 4 ? GLN A 8 ? SER A 4 GLN A 8 A 2 GLN A 28 ? SER A 34 ? GLN A 28 SER A 34 A 3 LYS A 92 ? ASP A 98 ? LYS A 92 ASP A 98 B 1 ALA A 19 ? ASP A 23 ? ALA A 19 ASP A 23 B 2 LYS A 122 ? LYS A 128 ? LYS A 122 LYS A 128 B 3 PHE A 108 ? PHE A 111 ? PHE A 108 PHE A 111 B 4 VAL A 49 ? THR A 52 ? VAL A 49 THR A 52 B 5 ALA A 82 ? HIS A 83 ? ALA A 82 HIS A 83 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 5 ? N VAL A 5 O ASN A 32 ? O ASN A 32 A 2 3 N LEU A 33 ? N LEU A 33 O ASP A 93 ? O ASP A 93 B 1 2 N VAL A 22 ? N VAL A 22 O THR A 126 ? O THR A 126 B 2 3 O GLY A 123 ? O GLY A 123 N PHE A 110 ? N PHE A 110 B 3 4 O PHE A 111 ? O PHE A 111 N VAL A 49 ? N VAL A 49 B 4 5 N LEU A 50 ? N LEU A 50 O ALA A 82 ? O ALA A 82 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CU A 201' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE DRU A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLY A 45 ? GLY A 45 . ? 1_555 ? 2 AC1 5 HIS A 46 ? HIS A 46 . ? 1_555 ? 3 AC1 5 CYS A 112 ? CYS A 112 . ? 1_555 ? 4 AC1 5 HIS A 117 ? HIS A 117 . ? 1_555 ? 5 AC1 5 MET A 121 ? MET A 121 . ? 1_555 ? 6 AC2 6 GLN A 28 ? GLN A 28 . ? 8_544 ? 7 AC2 6 THR A 96 ? THR A 96 . ? 8_544 ? 8 AC2 6 GLU A 106 ? GLU A 106 . ? 1_555 ? 9 AC2 6 HIS A 107 ? HIS A 107 . ? 1_555 ? 10 AC2 6 THR A 126 ? THR A 126 . ? 1_555 ? 11 AC2 6 LYS A 128 ? LYS A 128 . ? 1_555 ? # _database_PDB_matrix.entry_id 4HHG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4HHG _atom_sites.fract_transf_matrix[1][1] 0.020096 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014886 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012287 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O RU S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 NIY 109 109 109 NIY NIY A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 CYS 112 112 112 CYS CYS A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LYS 128 128 128 LYS LYS A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id NIY _pdbx_struct_mod_residue.label_seq_id 109 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id NIY _pdbx_struct_mod_residue.auth_seq_id 109 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details META-NITRO-TYROSINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2 A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 1850 ? 2 MORE -18 ? 2 'SSA (A^2)' 12600 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_545 x,-y-1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -67.1760000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 332 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 ND1 ? A HIS 117 ? A HIS 117 ? 1_555 106.0 ? 2 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 SG ? A CYS 112 ? A CYS 112 ? 1_555 135.1 ? 3 ND1 ? A HIS 117 ? A HIS 117 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 SG ? A CYS 112 ? A CYS 112 ? 1_555 118.7 ? 4 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 N13 A C DRU . ? A DRU 202 ? 1_555 86.6 ? 5 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 N2 A C DRU . ? A DRU 202 ? 1_555 88.7 ? 6 N13 A C DRU . ? A DRU 202 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 N2 A C DRU . ? A DRU 202 ? 1_555 90.9 ? 7 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 N37 A C DRU . ? A DRU 202 ? 1_555 90.2 ? 8 N13 A C DRU . ? A DRU 202 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 N37 A C DRU . ? A DRU 202 ? 1_555 88.1 ? 9 N2 A C DRU . ? A DRU 202 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 N37 A C DRU . ? A DRU 202 ? 1_555 178.6 ? 10 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 N26 A C DRU . ? A DRU 202 ? 1_555 176.1 ? 11 N13 A C DRU . ? A DRU 202 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 N26 A C DRU . ? A DRU 202 ? 1_555 92.3 ? 12 N2 A C DRU . ? A DRU 202 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 N26 A C DRU . ? A DRU 202 ? 1_555 95.1 ? 13 N37 A C DRU . ? A DRU 202 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 N26 A C DRU . ? A DRU 202 ? 1_555 85.9 ? 14 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 ND1 A C DRU . ? A DRU 202 ? 1_555 92.0 ? 15 N13 A C DRU . ? A DRU 202 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 ND1 A C DRU . ? A DRU 202 ? 1_555 174.3 ? 16 N2 A C DRU . ? A DRU 202 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 ND1 A C DRU . ? A DRU 202 ? 1_555 83.5 ? 17 N37 A C DRU . ? A DRU 202 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 ND1 A C DRU . ? A DRU 202 ? 1_555 97.4 ? 18 N26 A C DRU . ? A DRU 202 ? 1_555 RU A C DRU . ? A DRU 202 ? 1_555 ND1 A C DRU . ? A DRU 202 ? 1_555 89.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-11-21 2 'Structure model' 1 1 2013-07-31 3 'Structure model' 1 2 2013-08-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal Blu-Ice 'data collection' . ? 1 MOLREP phasing . ? 2 REFMAC refinement 5.6.0117 ? 3 autoXDS 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 32 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 94 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 B _pdbx_validate_close_contact.dist 2.12 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 69 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 330 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_455 _pdbx_validate_symm_contact.dist 1.89 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 35 ? ? CD2 A HIS 35 ? ? 1.410 1.354 0.056 0.009 N 2 1 CG A HIS 83 ? ? CD2 A HIS 83 ? ? 1.410 1.354 0.056 0.009 N 3 1 CG A HIS 107 ? ? CD2 A HIS 107 ? ? 1.411 1.354 0.057 0.009 N 4 1 CG A PHE 110 ? ? CD2 A PHE 110 ? ? 1.496 1.383 0.113 0.015 N 5 1 CG A HIS 117 ? ? CD2 A HIS 117 ? ? 1.423 1.354 0.069 0.009 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id MET _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 44 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -155.08 _pdbx_validate_torsion.psi 43.43 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 ;DELTA-BIS(2,2'-BIPYRIDINE)IMIDAZOLE RUTHENIUM (II) ; DRU 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 201 1 CU CU A . C 3 DRU 1 202 903 DRU DRU A . D 4 HOH 1 301 1 HOH HOH A . D 4 HOH 2 302 2 HOH HOH A . D 4 HOH 3 303 3 HOH HOH A . D 4 HOH 4 304 4 HOH HOH A . D 4 HOH 5 305 5 HOH HOH A . D 4 HOH 6 306 6 HOH HOH A . D 4 HOH 7 307 7 HOH HOH A . D 4 HOH 8 308 8 HOH HOH A . D 4 HOH 9 309 10 HOH HOH A . D 4 HOH 10 310 12 HOH HOH A . D 4 HOH 11 311 13 HOH HOH A . D 4 HOH 12 312 14 HOH HOH A . D 4 HOH 13 313 15 HOH HOH A . D 4 HOH 14 314 16 HOH HOH A . D 4 HOH 15 315 17 HOH HOH A . D 4 HOH 16 316 18 HOH HOH A . D 4 HOH 17 317 19 HOH HOH A . D 4 HOH 18 318 20 HOH HOH A . D 4 HOH 19 319 22 HOH HOH A . D 4 HOH 20 320 23 HOH HOH A . D 4 HOH 21 321 24 HOH HOH A . D 4 HOH 22 322 25 HOH HOH A . D 4 HOH 23 323 26 HOH HOH A . D 4 HOH 24 324 27 HOH HOH A . D 4 HOH 25 325 28 HOH HOH A . D 4 HOH 26 326 29 HOH HOH A . D 4 HOH 27 327 30 HOH HOH A . D 4 HOH 28 328 31 HOH HOH A . D 4 HOH 29 329 32 HOH HOH A . D 4 HOH 30 330 33 HOH HOH A . D 4 HOH 31 331 34 HOH HOH A . D 4 HOH 32 332 35 HOH HOH A . D 4 HOH 33 333 36 HOH HOH A . D 4 HOH 34 334 39 HOH HOH A . D 4 HOH 35 335 41 HOH HOH A . D 4 HOH 36 336 42 HOH HOH A . D 4 HOH 37 337 43 HOH HOH A . D 4 HOH 38 338 44 HOH HOH A . D 4 HOH 39 339 45 HOH HOH A . D 4 HOH 40 340 46 HOH HOH A . D 4 HOH 41 341 47 HOH HOH A . D 4 HOH 42 342 48 HOH HOH A . D 4 HOH 43 343 51 HOH HOH A . D 4 HOH 44 344 52 HOH HOH A . D 4 HOH 45 345 53 HOH HOH A . D 4 HOH 46 346 54 HOH HOH A . D 4 HOH 47 347 55 HOH HOH A . D 4 HOH 48 348 56 HOH HOH A . D 4 HOH 49 349 57 HOH HOH A . D 4 HOH 50 350 58 HOH HOH A . D 4 HOH 51 351 59 HOH HOH A . D 4 HOH 52 352 60 HOH HOH A . D 4 HOH 53 353 61 HOH HOH A . D 4 HOH 54 354 62 HOH HOH A . D 4 HOH 55 355 64 HOH HOH A . D 4 HOH 56 356 65 HOH HOH A . D 4 HOH 57 357 66 HOH HOH A . D 4 HOH 58 358 68 HOH HOH A . D 4 HOH 59 359 70 HOH HOH A . D 4 HOH 60 360 72 HOH HOH A . D 4 HOH 61 361 74 HOH HOH A . D 4 HOH 62 362 75 HOH HOH A . D 4 HOH 63 363 76 HOH HOH A . D 4 HOH 64 364 77 HOH HOH A . D 4 HOH 65 365 80 HOH HOH A . D 4 HOH 66 366 81 HOH HOH A . D 4 HOH 67 367 82 HOH HOH A . D 4 HOH 68 368 83 HOH HOH A . D 4 HOH 69 369 84 HOH HOH A . D 4 HOH 70 370 85 HOH HOH A . #