data_4HRS # _entry.id 4HRS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4HRS RCSB RCSB075839 WWPDB D_1000075839 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 4HRO _pdbx_database_related.details 'the protein from the same family' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4HRS _pdbx_database_status.recvd_initial_deposition_date 2012-10-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Hao, B.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Crystal structure of the ubiquitin-like small archaeal modifier protein 2 from Haloferax volcanii.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 22 _citation.page_first 1206 _citation.page_last 1217 _citation.year 2013 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23821306 _citation.pdbx_database_id_DOI 10.1002/pro.2305 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Li, Y.' 1 primary 'Maciejewski, M.W.' 2 primary 'Martin, J.' 3 primary 'Jin, K.' 4 primary 'Zhang, Y.' 5 primary 'Maupin-Furlow, J.A.' 6 primary 'Hao, B.' 7 # _cell.entry_id 4HRS _cell.length_a 24.605 _cell.length_b 64.603 _cell.length_c 104.555 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4HRS _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Small archaeal modifier protein 2' 7207.971 1 ? ? ? ? 2 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SAMP 2, Ubiquitin-like small archaeal modifier protein 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GRNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKGG _entity_poly.pdbx_seq_one_letter_code_can GRNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKGG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ARG n 1 3 ASN n 1 4 VAL n 1 5 THR n 1 6 VAL n 1 7 GLU n 1 8 VAL n 1 9 VAL n 1 10 GLY n 1 11 GLU n 1 12 GLU n 1 13 THR n 1 14 SER n 1 15 GLU n 1 16 VAL n 1 17 ALA n 1 18 VAL n 1 19 ASP n 1 20 ASP n 1 21 ASP n 1 22 GLY n 1 23 THR n 1 24 TYR n 1 25 ALA n 1 26 ASP n 1 27 LEU n 1 28 VAL n 1 29 ARG n 1 30 ALA n 1 31 VAL n 1 32 ASP n 1 33 LEU n 1 34 SER n 1 35 PRO n 1 36 HIS n 1 37 GLU n 1 38 VAL n 1 39 THR n 1 40 VAL n 1 41 LEU n 1 42 VAL n 1 43 ASP n 1 44 GLY n 1 45 ARG n 1 46 PRO n 1 47 VAL n 1 48 PRO n 1 49 GLU n 1 50 ASP n 1 51 GLN n 1 52 SER n 1 53 VAL n 1 54 GLU n 1 55 VAL n 1 56 ASP n 1 57 ARG n 1 58 VAL n 1 59 LYS n 1 60 VAL n 1 61 LEU n 1 62 ARG n 1 63 LEU n 1 64 ILE n 1 65 LYS n 1 66 GLY n 1 67 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HVO_0202 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain DS70 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Haloferax volcanii DS2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 309800 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SAMP2_HALVD _struct_ref.pdbx_db_accession D4GZE7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKGG _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4HRS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D4GZE7 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 66 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4HRS GLY A 1 ? UNP D4GZE7 ? ? 'EXPRESSION TAG' 0 1 1 4HRS ARG A 2 ? UNP D4GZE7 ? ? 'EXPRESSION TAG' 1 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4HRS _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.88 _exptl_crystal.density_percent_sol 57.32 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.8 _exptl_crystal_grow.pdbx_details ;100 mM bis-tris-propane-HCl (pH 6.8), 25-30% (w/v) PEG 400, 0.2 M MgCl2, 0.1 M KCl, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2010-09-10 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator Graphite _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.075 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.075 # _reflns.entry_id 4HRS _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 54.96 _reflns.d_resolution_high 2.01 _reflns.number_obs 5594 _reflns.number_all 5845 _reflns.percent_possible_obs 95.7 _reflns.pdbx_Rmerge_I_obs 0.062 _reflns.pdbx_Rsym_value 0.062 _reflns.pdbx_netI_over_sigmaI 43.4 _reflns.B_iso_Wilson_estimate 40 _reflns.pdbx_redundancy 12.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.01 _reflns_shell.d_res_low 2.04 _reflns_shell.percent_possible_all 97.2 _reflns_shell.Rmerge_I_obs 0.293 _reflns_shell.pdbx_Rsym_value 0.293 _reflns_shell.meanI_over_sigI_obs 6.3 _reflns_shell.pdbx_redundancy 12.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 239 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4HRS _refine.ls_number_reflns_obs 3771 _refine.ls_number_reflns_all 3825 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 54.96 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 99.02 _refine.ls_R_factor_obs 0.21682 _refine.ls_R_factor_all 0.255 _refine.ls_R_factor_R_work 0.21488 _refine.ls_R_factor_R_free 0.25365 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 186 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.940 _refine.correlation_coeff_Fo_to_Fc_free 0.918 _refine.B_iso_mean 36.593 _refine.aniso_B[1][1] -24.18 _refine.aniso_B[2][2] 41.49 _refine.aniso_B[3][3] -17.31 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'CS-Rosetta model' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model isotropic _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.060 _refine.pdbx_overall_ESU_R_Free 0.047 _refine.overall_SU_ML 0.139 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 13.870 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 482 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 516 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 54.96 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.010 0.022 ? 498 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.002 0.020 ? 318 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.214 1.982 ? 682 ? 'X-RAY DIFFRACTION' r_angle_other_deg 0.848 3.000 ? 783 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 5.874 5.000 ? 67 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 33.305 24.000 ? 20 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 16.464 15.000 ? 80 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 16.362 15.000 ? 5 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.066 0.200 ? 88 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.003 0.021 ? 563 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.000 0.020 ? 90 ? 'X-RAY DIFFRACTION' r_mcbond_it 1.588 3.000 ? 333 ? 'X-RAY DIFFRACTION' r_mcbond_other 0.273 3.000 ? 135 ? 'X-RAY DIFFRACTION' r_mcangle_it 3.157 5.000 ? 544 ? 'X-RAY DIFFRACTION' r_scbond_it 4.884 8.000 ? 165 ? 'X-RAY DIFFRACTION' r_scangle_it 8.058 11.000 ? 138 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.299 _refine_ls_shell.d_res_low 2.359 _refine_ls_shell.number_reflns_R_work 255 _refine_ls_shell.R_factor_R_work 0.242 _refine_ls_shell.percent_reflns_obs 97.45 _refine_ls_shell.R_factor_R_free 0.529 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 13 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 255 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4HRS _struct.title 'Crystal structure of H. volcanii small archaeal modifier protein 2' _struct.pdbx_descriptor 'Small archaeal modifier protein 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4HRS _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'beta-grasp fold; beta-hinge motif, small ubiquitin-like modifier, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 23 ? VAL A 31 ? THR A 22 VAL A 30 1 ? 9 HELX_P HELX_P2 2 SER A 34 ? VAL A 38 ? SER A 33 VAL A 37 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 3 ? GLU A 7 ? ASN A 2 GLU A 6 A 2 THR A 13 ? ALA A 17 ? THR A 12 ALA A 16 B 1 VAL A 40 ? VAL A 42 ? VAL A 39 VAL A 41 B 2 ARG A 45 ? VAL A 47 ? ARG A 44 VAL A 46 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 6 ? N VAL A 5 O SER A 14 ? O SER A 13 B 1 2 N VAL A 42 ? N VAL A 41 O ARG A 45 ? O ARG A 44 # _database_PDB_matrix.entry_id 4HRS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4HRS _atom_sites.fract_transf_matrix[1][1] 0.040642 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015479 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009564 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY A . n A 1 2 ARG 2 1 1 ARG ARG A . n A 1 3 ASN 3 2 2 ASN ASN A . n A 1 4 VAL 4 3 3 VAL VAL A . n A 1 5 THR 5 4 4 THR THR A . n A 1 6 VAL 6 5 5 VAL VAL A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 GLY 10 9 9 GLY GLY A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 THR 13 12 12 THR THR A . n A 1 14 SER 14 13 13 SER SER A . n A 1 15 GLU 15 14 14 GLU GLU A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 ALA 17 16 16 ALA ALA A . n A 1 18 VAL 18 17 17 VAL VAL A . n A 1 19 ASP 19 18 18 ASP ASP A . n A 1 20 ASP 20 19 19 ASP ASP A . n A 1 21 ASP 21 20 20 ASP ASP A . n A 1 22 GLY 22 21 21 GLY GLY A . n A 1 23 THR 23 22 22 THR THR A . n A 1 24 TYR 24 23 23 TYR TYR A . n A 1 25 ALA 25 24 24 ALA ALA A . n A 1 26 ASP 26 25 25 ASP ASP A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 VAL 28 27 27 VAL VAL A . n A 1 29 ARG 29 28 28 ARG ARG A . n A 1 30 ALA 30 29 29 ALA ALA A . n A 1 31 VAL 31 30 30 VAL VAL A . n A 1 32 ASP 32 31 31 ASP ASP A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 SER 34 33 33 SER SER A . n A 1 35 PRO 35 34 34 PRO PRO A . n A 1 36 HIS 36 35 35 HIS HIS A . n A 1 37 GLU 37 36 36 GLU GLU A . n A 1 38 VAL 38 37 37 VAL VAL A . n A 1 39 THR 39 38 38 THR THR A . n A 1 40 VAL 40 39 39 VAL VAL A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 VAL 42 41 41 VAL VAL A . n A 1 43 ASP 43 42 42 ASP ASP A . n A 1 44 GLY 44 43 43 GLY GLY A . n A 1 45 ARG 45 44 44 ARG ARG A . n A 1 46 PRO 46 45 45 PRO PRO A . n A 1 47 VAL 47 46 46 VAL VAL A . n A 1 48 PRO 48 47 47 PRO PRO A . n A 1 49 GLU 49 48 48 GLU GLU A . n A 1 50 ASP 50 49 49 ASP ASP A . n A 1 51 GLN 51 50 50 GLN GLN A . n A 1 52 SER 52 51 51 SER SER A . n A 1 53 VAL 53 52 52 VAL VAL A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 VAL 55 54 54 VAL VAL A . n A 1 56 ASP 56 55 55 ASP ASP A . n A 1 57 ARG 57 56 56 ARG ARG A . n A 1 58 VAL 58 57 57 VAL VAL A . n A 1 59 LYS 59 58 58 LYS LYS A . n A 1 60 VAL 60 59 59 VAL VAL A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 ARG 62 61 61 ARG ARG A . n A 1 63 LEU 63 62 62 LEU LEU A . n A 1 64 ILE 64 63 63 ILE ILE A . n A 1 65 LYS 65 64 64 LYS LYS A . n A 1 66 GLY 66 65 65 GLY GLY A . n A 1 67 GLY 67 66 ? ? ? A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2 A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 3470 ? 2 MORE -16 ? 2 'SSA (A^2)' 7670 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 24.6050000000 0.0000000000 -1.0000000000 0.0000000000 64.6030000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-08-07 2 'Structure model' 1 1 2013-08-21 3 'Structure model' 1 2 2013-10-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 9.5391 _pdbx_refine_tls.origin_y 26.8931 _pdbx_refine_tls.origin_z 14.9536 _pdbx_refine_tls.T[1][1] 0.0895 _pdbx_refine_tls.T[2][2] 0.1685 _pdbx_refine_tls.T[3][3] -0.0098 _pdbx_refine_tls.T[1][2] 0.0178 _pdbx_refine_tls.T[1][3] 0.0003 _pdbx_refine_tls.T[2][3] 0.0300 _pdbx_refine_tls.L[1][1] 1.0896 _pdbx_refine_tls.L[2][2] 2.1591 _pdbx_refine_tls.L[3][3] 0.3239 _pdbx_refine_tls.L[1][2] 0.4866 _pdbx_refine_tls.L[1][3] 0.3713 _pdbx_refine_tls.L[2][3] 0.4262 _pdbx_refine_tls.S[1][1] 0.0608 _pdbx_refine_tls.S[2][2] -0.0828 _pdbx_refine_tls.S[3][3] 0.0220 _pdbx_refine_tls.S[1][2] -0.0267 _pdbx_refine_tls.S[1][3] -0.0335 _pdbx_refine_tls.S[2][3] 0.0672 _pdbx_refine_tls.S[2][1] -0.0944 _pdbx_refine_tls.S[3][1] -0.0188 _pdbx_refine_tls.S[3][2] -0.0382 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 0 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 64 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id . _pdbx_refine_tls_group.beg_label_seq_id . _pdbx_refine_tls_group.end_label_asym_id . _pdbx_refine_tls_group.end_label_seq_id . _pdbx_refine_tls_group.selection ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 PHASER phasing . ? 2 REFMAC refinement 5.5.0102 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 10 ? ? -131.36 -131.31 2 1 ILE A 63 ? ? -89.74 -107.34 3 1 LYS A 64 ? ? 173.62 156.06 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 11 ? CG ? A GLU 12 CG 2 1 Y 1 A GLU 11 ? CD ? A GLU 12 CD 3 1 Y 1 A GLU 11 ? OE1 ? A GLU 12 OE1 4 1 Y 1 A GLU 11 ? OE2 ? A GLU 12 OE2 5 1 Y 1 A ASP 19 ? CG ? A ASP 20 CG 6 1 Y 1 A ASP 19 ? OD1 ? A ASP 20 OD1 7 1 Y 1 A ASP 19 ? OD2 ? A ASP 20 OD2 8 1 Y 1 A ARG 44 ? CG ? A ARG 45 CG 9 1 Y 1 A ARG 44 ? CD ? A ARG 45 CD 10 1 Y 1 A ARG 44 ? NE ? A ARG 45 NE 11 1 Y 1 A ARG 44 ? CZ ? A ARG 45 CZ 12 1 Y 1 A ARG 44 ? NH1 ? A ARG 45 NH1 13 1 Y 1 A ARG 44 ? NH2 ? A ARG 45 NH2 14 1 Y 1 A ASP 49 ? CG ? A ASP 50 CG 15 1 Y 1 A ASP 49 ? OD1 ? A ASP 50 OD1 16 1 Y 1 A ASP 49 ? OD2 ? A ASP 50 OD2 17 1 Y 1 A GLU 53 ? CD ? A GLU 54 CD 18 1 Y 1 A GLU 53 ? OE1 ? A GLU 54 OE1 19 1 Y 1 A GLU 53 ? OE2 ? A GLU 54 OE2 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id 66 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 67 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 101 1 HOH HOH A . B 2 HOH 2 102 2 HOH HOH A . B 2 HOH 3 103 3 HOH HOH A . B 2 HOH 4 104 4 HOH HOH A . B 2 HOH 5 105 5 HOH HOH A . B 2 HOH 6 106 6 HOH HOH A . B 2 HOH 7 107 7 HOH HOH A . B 2 HOH 8 108 8 HOH HOH A . B 2 HOH 9 109 9 HOH HOH A . B 2 HOH 10 110 10 HOH HOH A . B 2 HOH 11 111 11 HOH HOH A . B 2 HOH 12 112 12 HOH HOH A . B 2 HOH 13 113 13 HOH HOH A . B 2 HOH 14 114 14 HOH HOH A . B 2 HOH 15 115 15 HOH HOH A . B 2 HOH 16 116 16 HOH HOH A . B 2 HOH 17 117 17 HOH HOH A . B 2 HOH 18 118 18 HOH HOH A . B 2 HOH 19 119 19 HOH HOH A . B 2 HOH 20 120 20 HOH HOH A . B 2 HOH 21 121 21 HOH HOH A . B 2 HOH 22 122 22 HOH HOH A . B 2 HOH 23 123 23 HOH HOH A . B 2 HOH 24 124 24 HOH HOH A . B 2 HOH 25 125 25 HOH HOH A . B 2 HOH 26 126 26 HOH HOH A . B 2 HOH 27 127 27 HOH HOH A . B 2 HOH 28 128 28 HOH HOH A . B 2 HOH 29 129 29 HOH HOH A . B 2 HOH 30 130 30 HOH HOH A . B 2 HOH 31 131 31 HOH HOH A . B 2 HOH 32 132 32 HOH HOH A . B 2 HOH 33 133 33 HOH HOH A . B 2 HOH 34 134 34 HOH HOH A . #