data_4HTI # _entry.id 4HTI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4HTI RCSB RCSB075900 WWPDB D_1000075900 # _pdbx_database_status.entry_id 4HTI _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-11-01 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Noguera, M.E.' 1 'Jakoncic, J.' 2 'Poskus, E.' 3 'Ermacora, M.R.' 4 # _citation.id primary _citation.title 'X-ray structure of the mature ectodomain of phogrin.' _citation.journal_abbrev J.Struct.Funct.Genom. _citation.journal_volume 16 _citation.page_first 1 _citation.page_last 9 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country NE _citation.journal_id_ISSN 1345-711X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25421040 _citation.pdbx_database_id_DOI 10.1007/s10969-014-9191-0 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Noguera, M.E.' 1 primary 'Primo, M.E.' 2 primary 'Jakoncic, J.' 3 primary 'Poskus, E.' 4 primary 'Solimena, M.' 5 primary 'Ermacora, M.R.' 6 # _cell.length_a 55.133 _cell.length_b 55.133 _cell.length_c 148.391 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4HTI _cell.pdbx_unique_axis ? _cell.Z_PDB 12 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.entry_id 4HTI _symmetry.Int_Tables_number 178 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Receptor-type tyrosine-protein phosphatase N2' 10826.067 1 3.1.3.48 ? 'sequence database residues 502 - 599' ? 2 water nat water 18.015 40 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'R-PTP-N2, Islet cell autoantigen-related protein, IAR, ICAAR, Phogrin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEVQPSEEEARGYIVTDRDPLRPEEGRRLVEDVARLLQVPSSAFADVEVLGPAVTFKVSANVQNVTTEDVEKATVDNKDK LEETSGLKILQTGVGSKSK ; _entity_poly.pdbx_seq_one_letter_code_can ;MEVQPSEEEARGYIVTDRDPLRPEEGRRLVEDVARLLQVPSSAFADVEVLGPAVTFKVSANVQNVTTEDVEKATVDNKDK LEETSGLKILQTGVGSKSK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 VAL n 1 4 GLN n 1 5 PRO n 1 6 SER n 1 7 GLU n 1 8 GLU n 1 9 GLU n 1 10 ALA n 1 11 ARG n 1 12 GLY n 1 13 TYR n 1 14 ILE n 1 15 VAL n 1 16 THR n 1 17 ASP n 1 18 ARG n 1 19 ASP n 1 20 PRO n 1 21 LEU n 1 22 ARG n 1 23 PRO n 1 24 GLU n 1 25 GLU n 1 26 GLY n 1 27 ARG n 1 28 ARG n 1 29 LEU n 1 30 VAL n 1 31 GLU n 1 32 ASP n 1 33 VAL n 1 34 ALA n 1 35 ARG n 1 36 LEU n 1 37 LEU n 1 38 GLN n 1 39 VAL n 1 40 PRO n 1 41 SER n 1 42 SER n 1 43 ALA n 1 44 PHE n 1 45 ALA n 1 46 ASP n 1 47 VAL n 1 48 GLU n 1 49 VAL n 1 50 LEU n 1 51 GLY n 1 52 PRO n 1 53 ALA n 1 54 VAL n 1 55 THR n 1 56 PHE n 1 57 LYS n 1 58 VAL n 1 59 SER n 1 60 ALA n 1 61 ASN n 1 62 VAL n 1 63 GLN n 1 64 ASN n 1 65 VAL n 1 66 THR n 1 67 THR n 1 68 GLU n 1 69 ASP n 1 70 VAL n 1 71 GLU n 1 72 LYS n 1 73 ALA n 1 74 THR n 1 75 VAL n 1 76 ASP n 1 77 ASN n 1 78 LYS n 1 79 ASP n 1 80 LYS n 1 81 LEU n 1 82 GLU n 1 83 GLU n 1 84 THR n 1 85 SER n 1 86 GLY n 1 87 LEU n 1 88 LYS n 1 89 ILE n 1 90 LEU n 1 91 GLN n 1 92 THR n 1 93 GLY n 1 94 VAL n 1 95 GLY n 1 96 SER n 1 97 LYS n 1 98 SER n 1 99 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PTPRN2, KIAA0387' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTPR2_HUMAN _struct_ref.pdbx_db_accession Q92932 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LEVQPSEEEARGYIVTDRDPLRPEEGRRLVEDVARLLQVPSSAFADVEVLGPAVTFKVSANVQNVTTEDVEKATVDNKDK LEETSGLKILQTGVGSKSK ; _struct_ref.pdbx_align_begin 501 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4HTI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q92932 _struct_ref_seq.db_align_beg 501 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 599 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 501 _struct_ref_seq.pdbx_auth_seq_align_end 599 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4HTI _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q92932 _struct_ref_seq_dif.db_mon_id LEU _struct_ref_seq_dif.pdbx_seq_db_seq_num 501 _struct_ref_seq_dif.details CONFLICT _struct_ref_seq_dif.pdbx_auth_seq_num 501 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4HTI _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.01 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 59.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '0.2 M Ammonium sulfate, 30 % w/v Polyethylene glycol 4000, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.pdbx_collection_date 2011-06-16 _diffrn_detector.details 'TOROIDAL FOCUSING MIRROR' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'SI(111) CHANNEL CUT' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.91840 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X6A' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.91840 _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X6A # _reflns.entry_id 4HTI _reflns.d_resolution_high 1.950 _reflns.d_resolution_low 30.000 _reflns.number_obs 10352 _reflns.pdbx_Rmerge_I_obs 0.060 _reflns.pdbx_netI_over_sigmaI 14.300 _reflns.pdbx_chi_squared 1.835 _reflns.pdbx_redundancy 40.500 _reflns.percent_possible_obs 99.600 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 2 _reflns.number_all 10352 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.950 1.980 ? ? ? 0.993 ? ? 1.635 41.400 ? 500 100.000 1 1 1.980 2.020 ? ? ? 0.863 ? ? 1.627 42.400 ? 495 100.000 2 1 2.020 2.060 ? ? ? 0.738 ? ? 1.620 41.800 ? 490 100.000 3 1 2.060 2.100 ? ? ? 0.553 ? ? 1.647 41.700 ? 513 100.000 4 1 2.100 2.150 ? ? ? 0.440 ? ? 1.654 41.600 ? 496 100.000 5 1 2.150 2.200 ? ? ? 0.356 ? ? 1.696 41.900 ? 513 100.000 6 1 2.200 2.250 ? ? ? 0.323 ? ? 1.739 41.700 ? 491 100.000 7 1 2.250 2.310 ? ? ? 0.240 ? ? 1.629 41.500 ? 512 100.000 8 1 2.310 2.380 ? ? ? 0.219 ? ? 1.670 41.600 ? 512 100.000 9 1 2.380 2.460 ? ? ? 0.166 ? ? 1.681 41.700 ? 495 100.000 10 1 2.460 2.540 ? ? ? 0.133 ? ? 1.702 41.300 ? 513 100.000 11 1 2.540 2.650 ? ? ? 0.117 ? ? 1.699 41.200 ? 520 100.000 12 1 2.650 2.770 ? ? ? 0.091 ? ? 1.742 41.400 ? 513 100.000 13 1 2.770 2.910 ? ? ? 0.071 ? ? 1.908 41.200 ? 513 100.000 14 1 2.910 3.090 ? ? ? 0.058 ? ? 2.053 40.500 ? 527 100.000 15 1 3.090 3.330 ? ? ? 0.052 ? ? 2.211 40.700 ? 513 100.000 16 1 3.330 3.670 ? ? ? 0.044 ? ? 2.478 39.700 ? 544 100.000 17 1 3.670 4.200 ? ? ? 0.039 ? ? 2.358 39.100 ? 538 100.000 18 1 4.200 5.280 ? ? ? 0.034 ? ? 2.136 37.200 ? 554 99.500 19 1 5.280 30.000 ? ? ? 0.032 ? ? 1.792 32.600 ? 600 94.600 20 1 # _refine.entry_id 4HTI _refine.ls_d_res_high 1.9540 _refine.ls_d_res_low 29.2900 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.4500 _refine.ls_number_reflns_obs 10292 _refine.ls_number_reflns_all 10352 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES : WITH TLS ADDED' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2223 _refine.ls_R_factor_R_work 0.2214 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2427 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_number_reflns_R_free 498 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 48.3448 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 1.2700 _refine.aniso_B[2][2] 1.2700 _refine.aniso_B[3][3] -1.9000 _refine.aniso_B[1][2] 0.6300 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] -0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9530 _refine.correlation_coeff_Fo_to_Fc_free 0.9480 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.1410 _refine.pdbx_overall_ESU_R_Free 0.1300 _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 'PDB ENTRY 2QT7' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 106.650 _refine.B_iso_min 25.280 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.500 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 670 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 710 _refine_hist.d_res_high 1.9540 _refine_hist.d_res_low 29.2900 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 681 0.021 0.019 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 925 1.563 1.989 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 89 5.037 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 30 34.138 25.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 123 19.177 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 6 22.058 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 114 0.113 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 504 0.007 0.021 ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 1.9540 _refine_ls_shell.d_res_low 2.0050 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 97.8300 _refine_ls_shell.number_reflns_R_work 692 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.3280 _refine_ls_shell.R_factor_R_free 0.3630 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 31 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 723 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4HTI _struct.title 'Crystallographic structure of the membrane-proximal ectodomain of the human receptor-type protein-tyrosine phosphatase phogrin' _struct.pdbx_descriptor 'Receptor-type tyrosine-protein phosphatase N2 (E.C.3.1.3.48)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4HTI _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;phogrin, IA-2beta, protein-tyrosine phosphatase, transmembrane protein, diabetes, autoimmunity, Glycoprotein, Receptor, HYDROLASE, ferredoxin-like fold ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 22 ? LEU A 37 ? ARG A 522 LEU A 537 1 ? 16 HELX_P HELX_P2 2 PRO A 40 ? SER A 42 ? PRO A 540 SER A 542 5 ? 3 HELX_P HELX_P3 3 THR A 66 ? ASN A 77 ? THR A 566 ASN A 577 1 ? 12 HELX_P HELX_P4 4 ASN A 77 ? GLY A 86 ? ASN A 577 GLY A 586 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 19 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 519 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 20 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 520 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.38 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 44 ? LEU A 50 ? PHE A 544 LEU A 550 A 2 ALA A 53 ? VAL A 58 ? ALA A 553 VAL A 558 A 3 GLY A 12 ? THR A 16 ? GLY A 512 THR A 516 A 4 ILE A 89 ? VAL A 94 ? ILE A 589 VAL A 594 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 45 ? N ALA A 545 O LYS A 57 ? O LYS A 557 A 2 3 O PHE A 56 ? O PHE A 556 N GLY A 12 ? N GLY A 512 A 3 4 N VAL A 15 ? N VAL A 515 O LEU A 90 ? O LEU A 590 # _atom_sites.entry_id 4HTI _atom_sites.fract_transf_matrix[1][1] 0.018138 _atom_sites.fract_transf_matrix[1][2] 0.010472 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020944 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006739 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 501 ? ? ? A . n A 1 2 GLU 2 502 ? ? ? A . n A 1 3 VAL 3 503 ? ? ? A . n A 1 4 GLN 4 504 ? ? ? A . n A 1 5 PRO 5 505 ? ? ? A . n A 1 6 SER 6 506 ? ? ? A . n A 1 7 GLU 7 507 ? ? ? A . n A 1 8 GLU 8 508 ? ? ? A . n A 1 9 GLU 9 509 ? ? ? A . n A 1 10 ALA 10 510 510 ALA ALA A . n A 1 11 ARG 11 511 511 ARG ARG A . n A 1 12 GLY 12 512 512 GLY GLY A . n A 1 13 TYR 13 513 513 TYR TYR A . n A 1 14 ILE 14 514 514 ILE ILE A . n A 1 15 VAL 15 515 515 VAL VAL A . n A 1 16 THR 16 516 516 THR THR A . n A 1 17 ASP 17 517 517 ASP ASP A . n A 1 18 ARG 18 518 518 ARG ARG A . n A 1 19 ASP 19 519 519 ASP ASP A . n A 1 20 PRO 20 520 520 PRO PRO A . n A 1 21 LEU 21 521 521 LEU LEU A . n A 1 22 ARG 22 522 522 ARG ARG A . n A 1 23 PRO 23 523 523 PRO PRO A . n A 1 24 GLU 24 524 524 GLU GLU A . n A 1 25 GLU 25 525 525 GLU GLU A . n A 1 26 GLY 26 526 526 GLY GLY A . n A 1 27 ARG 27 527 527 ARG ARG A . n A 1 28 ARG 28 528 528 ARG ARG A . n A 1 29 LEU 29 529 529 LEU LEU A . n A 1 30 VAL 30 530 530 VAL VAL A . n A 1 31 GLU 31 531 531 GLU GLU A . n A 1 32 ASP 32 532 532 ASP ASP A . n A 1 33 VAL 33 533 533 VAL VAL A . n A 1 34 ALA 34 534 534 ALA ALA A . n A 1 35 ARG 35 535 535 ARG ARG A . n A 1 36 LEU 36 536 536 LEU LEU A . n A 1 37 LEU 37 537 537 LEU LEU A . n A 1 38 GLN 38 538 538 GLN GLN A . n A 1 39 VAL 39 539 539 VAL VAL A . n A 1 40 PRO 40 540 540 PRO PRO A . n A 1 41 SER 41 541 541 SER SER A . n A 1 42 SER 42 542 542 SER SER A . n A 1 43 ALA 43 543 543 ALA ALA A . n A 1 44 PHE 44 544 544 PHE PHE A . n A 1 45 ALA 45 545 545 ALA ALA A . n A 1 46 ASP 46 546 546 ASP ASP A . n A 1 47 VAL 47 547 547 VAL VAL A . n A 1 48 GLU 48 548 548 GLU GLU A . n A 1 49 VAL 49 549 549 VAL VAL A . n A 1 50 LEU 50 550 550 LEU LEU A . n A 1 51 GLY 51 551 551 GLY GLY A . n A 1 52 PRO 52 552 552 PRO PRO A . n A 1 53 ALA 53 553 553 ALA ALA A . n A 1 54 VAL 54 554 554 VAL VAL A . n A 1 55 THR 55 555 555 THR THR A . n A 1 56 PHE 56 556 556 PHE PHE A . n A 1 57 LYS 57 557 557 LYS LYS A . n A 1 58 VAL 58 558 558 VAL VAL A . n A 1 59 SER 59 559 559 SER SER A . n A 1 60 ALA 60 560 560 ALA ALA A . n A 1 61 ASN 61 561 561 ASN ASN A . n A 1 62 VAL 62 562 562 VAL VAL A . n A 1 63 GLN 63 563 563 GLN GLN A . n A 1 64 ASN 64 564 564 ASN ASN A . n A 1 65 VAL 65 565 565 VAL VAL A . n A 1 66 THR 66 566 566 THR THR A . n A 1 67 THR 67 567 567 THR THR A . n A 1 68 GLU 68 568 568 GLU GLU A . n A 1 69 ASP 69 569 569 ASP ASP A . n A 1 70 VAL 70 570 570 VAL VAL A . n A 1 71 GLU 71 571 571 GLU GLU A . n A 1 72 LYS 72 572 572 LYS LYS A . n A 1 73 ALA 73 573 573 ALA ALA A . n A 1 74 THR 74 574 574 THR THR A . n A 1 75 VAL 75 575 575 VAL VAL A . n A 1 76 ASP 76 576 576 ASP ASP A . n A 1 77 ASN 77 577 577 ASN ASN A . n A 1 78 LYS 78 578 578 LYS LYS A . n A 1 79 ASP 79 579 579 ASP ASP A . n A 1 80 LYS 80 580 580 LYS LYS A . n A 1 81 LEU 81 581 581 LEU LEU A . n A 1 82 GLU 82 582 582 GLU GLU A . n A 1 83 GLU 83 583 583 GLU GLU A . n A 1 84 THR 84 584 584 THR THR A . n A 1 85 SER 85 585 585 SER SER A . n A 1 86 GLY 86 586 586 GLY GLY A . n A 1 87 LEU 87 587 587 LEU LEU A . n A 1 88 LYS 88 588 588 LYS LYS A . n A 1 89 ILE 89 589 589 ILE ILE A . n A 1 90 LEU 90 590 590 LEU LEU A . n A 1 91 GLN 91 591 591 GLN GLN A . n A 1 92 THR 92 592 592 THR THR A . n A 1 93 GLY 93 593 593 GLY GLY A . n A 1 94 VAL 94 594 594 VAL VAL A . n A 1 95 GLY 95 595 595 GLY GLY A . n A 1 96 SER 96 596 596 SER SER A . n A 1 97 LYS 97 597 597 LYS LYS A . n A 1 98 SER 98 598 ? ? ? A . n A 1 99 LYS 99 599 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 601 1 HOH HOH A . B 2 HOH 2 602 2 HOH HOH A . B 2 HOH 3 603 3 HOH HOH A . B 2 HOH 4 604 4 HOH HOH A . B 2 HOH 5 605 5 HOH HOH A . B 2 HOH 6 606 6 HOH HOH A . B 2 HOH 7 607 7 HOH HOH A . B 2 HOH 8 608 8 HOH HOH A . B 2 HOH 9 609 9 HOH HOH A . B 2 HOH 10 610 10 HOH HOH A . B 2 HOH 11 611 11 HOH HOH A . B 2 HOH 12 612 12 HOH HOH A . B 2 HOH 13 613 13 HOH HOH A . B 2 HOH 14 614 14 HOH HOH A . B 2 HOH 15 615 15 HOH HOH A . B 2 HOH 16 616 16 HOH HOH A . B 2 HOH 17 617 17 HOH HOH A . B 2 HOH 18 618 18 HOH HOH A . B 2 HOH 19 619 19 HOH HOH A . B 2 HOH 20 620 20 HOH HOH A . B 2 HOH 21 621 21 HOH HOH A . B 2 HOH 22 622 22 HOH HOH A . B 2 HOH 23 623 23 HOH HOH A . B 2 HOH 24 624 24 HOH HOH A . B 2 HOH 25 625 25 HOH HOH A . B 2 HOH 26 626 26 HOH HOH A . B 2 HOH 27 627 27 HOH HOH A . B 2 HOH 28 628 28 HOH HOH A . B 2 HOH 29 629 29 HOH HOH A . B 2 HOH 30 630 30 HOH HOH A . B 2 HOH 31 631 31 HOH HOH A . B 2 HOH 32 632 32 HOH HOH A . B 2 HOH 33 633 33 HOH HOH A . B 2 HOH 34 634 34 HOH HOH A . B 2 HOH 35 635 35 HOH HOH A . B 2 HOH 36 636 36 HOH HOH A . B 2 HOH 37 637 37 HOH HOH A . B 2 HOH 38 638 38 HOH HOH A . B 2 HOH 39 639 39 HOH HOH A . B 2 HOH 40 640 40 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 617 ? B HOH . 2 1 A HOH 618 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-11-28 2 'Structure model' 1 1 2012-12-19 3 'Structure model' 1 2 2013-03-20 4 'Structure model' 1 3 2013-07-24 5 'Structure model' 1 4 2015-03-18 6 'Structure model' 1 5 2017-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' 5 6 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 6 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -8.3950 _pdbx_refine_tls.origin_y -20.3280 _pdbx_refine_tls.origin_z -1.9750 _pdbx_refine_tls.T[1][1] 0.0294 _pdbx_refine_tls.T[2][2] 0.2741 _pdbx_refine_tls.T[3][3] 0.0906 _pdbx_refine_tls.T[1][2] 0.0105 _pdbx_refine_tls.T[1][3] 0.0015 _pdbx_refine_tls.T[2][3] -0.0543 _pdbx_refine_tls.L[1][1] 7.9888 _pdbx_refine_tls.L[2][2] 2.3455 _pdbx_refine_tls.L[3][3] 7.8186 _pdbx_refine_tls.L[1][2] -1.9278 _pdbx_refine_tls.L[1][3] 4.0959 _pdbx_refine_tls.L[2][3] -1.6715 _pdbx_refine_tls.S[1][1] -0.0465 _pdbx_refine_tls.S[2][2] -0.1593 _pdbx_refine_tls.S[3][3] 0.2059 _pdbx_refine_tls.S[1][2] -0.8414 _pdbx_refine_tls.S[1][3] 0.2788 _pdbx_refine_tls.S[2][3] -0.2120 _pdbx_refine_tls.S[2][1] 0.0717 _pdbx_refine_tls.S[3][1] -0.2905 _pdbx_refine_tls.S[3][2] -0.1054 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 510 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 597 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id . _pdbx_refine_tls_group.beg_label_seq_id . _pdbx_refine_tls_group.end_label_asym_id . _pdbx_refine_tls_group.end_label_seq_id . _pdbx_refine_tls_group.selection ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 MOLREP . ? program 'Alexei Vaguine' alexei@ysbl.york.ac.uk phasing http://www.ccp4.ac.uk/dist/html/molrep.html Fortran_77 ? 4 REFMAC 5.6.0117 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 5 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 HKL-2000 . ? ? ? ? 'data collection' ? ? ? 7 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 8 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 625 ? ? O A HOH 630 ? ? 1.70 2 1 NH2 A ARG 527 ? ? O A HOH 640 ? ? 1.90 3 1 OE1 A GLU 525 ? ? NH1 A ARG 528 ? ? 1.99 4 1 OG A SER 596 ? ? O A HOH 633 ? ? 2.17 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 630 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 630 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 10_444 _pdbx_validate_symm_contact.dist 2.01 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 501 ? A MET 1 2 1 Y 1 A GLU 502 ? A GLU 2 3 1 Y 1 A VAL 503 ? A VAL 3 4 1 Y 1 A GLN 504 ? A GLN 4 5 1 Y 1 A PRO 505 ? A PRO 5 6 1 Y 1 A SER 506 ? A SER 6 7 1 Y 1 A GLU 507 ? A GLU 7 8 1 Y 1 A GLU 508 ? A GLU 8 9 1 Y 1 A GLU 509 ? A GLU 9 10 1 Y 1 A SER 598 ? A SER 98 11 1 Y 1 A LYS 599 ? A LYS 99 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #