data_4IA7 # _entry.id 4IA7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4IA7 RCSB RCSB076498 WWPDB D_1000076498 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3O1D . unspecified PDB 3O1E . unspecified PDB 2HCD . unspecified PDB 4IA1 . unspecified PDB 4IA2 . unspecified PDB 4IA3 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4IA7 _pdbx_database_status.recvd_initial_deposition_date 2012-12-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Maehr, H.' 1 'Rochel, N.' 2 'Suh, N.' 3 'Uskokovic, M.' 4 # _citation.id primary _citation.title 'Diastereotopic and deuterium effects in gemini.' _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 56 _citation.page_first 3878 _citation.page_last 3888 _citation.year 2013 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23566225 _citation.pdbx_database_id_DOI 10.1021/jm400032t # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Maehr, H.' 1 primary 'Rochel, N.' 2 primary 'Lee, H.J.' 3 primary 'Suh, N.' 4 primary 'Uskokovic, M.R.' 5 # _cell.entry_id 4IA7 _cell.length_a 66.178 _cell.length_b 66.178 _cell.length_c 266.412 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4IA7 _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Vitamin D3 receptor A' 33916.543 1 ? ? 'Ligand binding domain (unp residues 156-453)' ? 2 polymer syn 'Nuclear receptor coactivator 2' 1579.866 1 ? ? 'LXXLL peptide (unp residues 686-698)' ? 3 non-polymer syn '21-NOR-9,10-SECOCHOLESTA-5,7,10(19)-TRIENE-1,3,25-TRIOL, 20-(4-HYDROXY-4-METHYLPENTYL)-, (1A,3B,5Z,7E)' 502.769 1 ? ? ? ? 4 water nat water 18.015 71 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'VDR-A, 1,25-dihydroxyvitamin D3 receptor A, Nuclear receptor subfamily 1 group I member 1-A' 2 'NCoA-2, Class E basic helix-loop-helix protein 75, bHLHe75, Transcriptional intermediary factor 2, hTIF2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLM MYQDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMS WSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQA YIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; ;HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLM MYQDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMS WSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQA YIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; A ? 2 'polypeptide(L)' no no KHKILHRLLQDSS KHKILHRLLQDSS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 LEU n 1 4 SER n 1 5 ASP n 1 6 GLU n 1 7 GLN n 1 8 MET n 1 9 GLN n 1 10 ILE n 1 11 ILE n 1 12 ASN n 1 13 SER n 1 14 LEU n 1 15 VAL n 1 16 GLU n 1 17 ALA n 1 18 HIS n 1 19 HIS n 1 20 LYS n 1 21 THR n 1 22 TYR n 1 23 ASP n 1 24 ASP n 1 25 SER n 1 26 TYR n 1 27 SER n 1 28 ASP n 1 29 PHE n 1 30 VAL n 1 31 ARG n 1 32 PHE n 1 33 ARG n 1 34 PRO n 1 35 PRO n 1 36 VAL n 1 37 ARG n 1 38 GLU n 1 39 GLY n 1 40 PRO n 1 41 VAL n 1 42 THR n 1 43 ARG n 1 44 SER n 1 45 ALA n 1 46 SER n 1 47 ARG n 1 48 ALA n 1 49 ALA n 1 50 SER n 1 51 LEU n 1 52 HIS n 1 53 SER n 1 54 LEU n 1 55 SER n 1 56 ASP n 1 57 ALA n 1 58 SER n 1 59 SER n 1 60 ASP n 1 61 SER n 1 62 PHE n 1 63 ASN n 1 64 HIS n 1 65 SER n 1 66 PRO n 1 67 GLU n 1 68 SER n 1 69 VAL n 1 70 ASP n 1 71 THR n 1 72 LYS n 1 73 LEU n 1 74 ASN n 1 75 PHE n 1 76 SER n 1 77 ASN n 1 78 LEU n 1 79 LEU n 1 80 MET n 1 81 MET n 1 82 TYR n 1 83 GLN n 1 84 ASP n 1 85 SER n 1 86 GLY n 1 87 SER n 1 88 PRO n 1 89 ASP n 1 90 SER n 1 91 SER n 1 92 GLU n 1 93 GLU n 1 94 ASP n 1 95 GLN n 1 96 GLN n 1 97 SER n 1 98 ARG n 1 99 LEU n 1 100 SER n 1 101 MET n 1 102 LEU n 1 103 PRO n 1 104 HIS n 1 105 LEU n 1 106 ALA n 1 107 ASP n 1 108 LEU n 1 109 VAL n 1 110 SER n 1 111 TYR n 1 112 SER n 1 113 ILE n 1 114 GLN n 1 115 LYS n 1 116 VAL n 1 117 ILE n 1 118 GLY n 1 119 PHE n 1 120 ALA n 1 121 LYS n 1 122 MET n 1 123 ILE n 1 124 PRO n 1 125 GLY n 1 126 PHE n 1 127 ARG n 1 128 ASP n 1 129 LEU n 1 130 THR n 1 131 ALA n 1 132 GLU n 1 133 ASP n 1 134 GLN n 1 135 ILE n 1 136 ALA n 1 137 LEU n 1 138 LEU n 1 139 LYS n 1 140 SER n 1 141 SER n 1 142 ALA n 1 143 ILE n 1 144 GLU n 1 145 ILE n 1 146 ILE n 1 147 MET n 1 148 LEU n 1 149 ARG n 1 150 SER n 1 151 ASN n 1 152 GLN n 1 153 SER n 1 154 PHE n 1 155 SER n 1 156 LEU n 1 157 GLU n 1 158 ASP n 1 159 MET n 1 160 SER n 1 161 TRP n 1 162 SER n 1 163 CYS n 1 164 GLY n 1 165 GLY n 1 166 PRO n 1 167 ASP n 1 168 PHE n 1 169 LYS n 1 170 TYR n 1 171 CYS n 1 172 ILE n 1 173 ASN n 1 174 ASP n 1 175 VAL n 1 176 THR n 1 177 LYS n 1 178 ALA n 1 179 GLY n 1 180 HIS n 1 181 THR n 1 182 LEU n 1 183 GLU n 1 184 LEU n 1 185 LEU n 1 186 GLU n 1 187 PRO n 1 188 LEU n 1 189 VAL n 1 190 LYS n 1 191 PHE n 1 192 GLN n 1 193 VAL n 1 194 GLY n 1 195 LEU n 1 196 LYS n 1 197 LYS n 1 198 LEU n 1 199 LYS n 1 200 LEU n 1 201 HIS n 1 202 GLU n 1 203 GLU n 1 204 GLU n 1 205 HIS n 1 206 VAL n 1 207 LEU n 1 208 LEU n 1 209 MET n 1 210 ALA n 1 211 ILE n 1 212 CYS n 1 213 LEU n 1 214 LEU n 1 215 SER n 1 216 PRO n 1 217 ASP n 1 218 ARG n 1 219 PRO n 1 220 GLY n 1 221 VAL n 1 222 GLN n 1 223 ASP n 1 224 HIS n 1 225 VAL n 1 226 ARG n 1 227 ILE n 1 228 GLU n 1 229 ALA n 1 230 LEU n 1 231 GLN n 1 232 ASP n 1 233 ARG n 1 234 LEU n 1 235 CYS n 1 236 ASP n 1 237 VAL n 1 238 LEU n 1 239 GLN n 1 240 ALA n 1 241 TYR n 1 242 ILE n 1 243 ARG n 1 244 ILE n 1 245 GLN n 1 246 HIS n 1 247 PRO n 1 248 GLY n 1 249 GLY n 1 250 ARG n 1 251 LEU n 1 252 LEU n 1 253 TYR n 1 254 ALA n 1 255 LYS n 1 256 MET n 1 257 ILE n 1 258 GLN n 1 259 LYS n 1 260 LEU n 1 261 ALA n 1 262 ASP n 1 263 LEU n 1 264 ARG n 1 265 SER n 1 266 LEU n 1 267 ASN n 1 268 GLU n 1 269 GLU n 1 270 HIS n 1 271 SER n 1 272 LYS n 1 273 GLN n 1 274 TYR n 1 275 ARG n 1 276 SER n 1 277 LEU n 1 278 SER n 1 279 PHE n 1 280 GLN n 1 281 PRO n 1 282 GLU n 1 283 HIS n 1 284 SER n 1 285 MET n 1 286 GLN n 1 287 LEU n 1 288 THR n 1 289 PRO n 1 290 LEU n 1 291 VAL n 1 292 LEU n 1 293 GLU n 1 294 VAL n 1 295 PHE n 1 296 GLY n 1 297 SER n 1 298 GLU n 1 299 VAL n 1 300 SER n 2 1 LYS n 2 2 HIS n 2 3 LYS n 2 4 ILE n 2 5 LEU n 2 6 HIS n 2 7 ARG n 2 8 LEU n 2 9 LEU n 2 10 GLN n 2 11 ASP n 2 12 SER n 2 13 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'leopard danio,zebra danio,zebra fish' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'vdra, nr1i1a, vdr' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Danio rerio' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7955 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP VDRA_DANRE Q9PTN2 1 ;LSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLMMY QDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWS CGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQAYI RIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; 156 ? 2 UNP NCOA2_HUMAN Q15596 2 KHKILHRLLQDSS 686 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4IA7 A 3 ? 300 ? Q9PTN2 156 ? 453 ? 156 453 2 2 4IA7 B 1 ? 13 ? Q15596 686 ? 698 ? 687 699 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4IA7 HIS A 1 ? UNP Q9PTN2 ? ? 'EXPRESSION TAG' 154 1 1 4IA7 MET A 2 ? UNP Q9PTN2 ? ? 'EXPRESSION TAG' 155 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BIV non-polymer . '21-NOR-9,10-SECOCHOLESTA-5,7,10(19)-TRIENE-1,3,25-TRIOL, 20-(4-HYDROXY-4-METHYLPENTYL)-, (1A,3B,5Z,7E)' GEMINI 'C32 H54 O4' 502.769 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4IA7 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_percent_sol 48.15 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details 'Bis-Tris 0.1 M, lithium sulfate 1.6 M and magnesium sulfate 50 mM , pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4r' _diffrn_detector.pdbx_collection_date 2012-05-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-1' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 4IA7 _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 25 _reflns.d_resolution_high 2.7 _reflns.number_obs 10345 _reflns.number_all 10345 _reflns.percent_possible_obs 100 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.8 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4IA7 _refine.ls_number_reflns_obs 9592 _refine.ls_number_reflns_all 10279 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 25 _refine.ls_d_res_high 2.7 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs .210 _refine.ls_R_factor_all .210 _refine.ls_R_factor_R_work .210 _refine.ls_R_factor_R_free .255 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 501 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1985 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 36 _refine_hist.number_atoms_solvent 71 _refine_hist.number_atoms_total 2092 _refine_hist.d_res_high 2.7 _refine_hist.d_res_low 25 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id c_angle_deg 1.19 ? ? ? ? 'X-RAY DIFFRACTION' c_bond_d 0.0066 ? ? ? ? 'X-RAY DIFFRACTION' # _struct.entry_id 4IA7 _struct.title 'Diastereotopic and Deuterium Effects in Gemini' _struct.pdbx_descriptor 'Vitamin D3 receptor A, Nuclear receptor coactivator 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4IA7 _struct_keywords.pdbx_keywords 'TRANSCRIPTION/TRANSCRIPTION ACTIVATOR' _struct_keywords.text ;VDR-agonist complex, alpha helical sandwich, transcription regulation, DNA, RXR, phosphorylation, nucleus, TRANSCRIPTION-TRANSCRIPTION ACTIVATOR complex ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 4 ? TYR A 22 ? SER A 157 TYR A 175 1 ? 19 HELX_P HELX_P2 2 TYR A 26 ? PHE A 32 ? TYR A 179 PHE A 185 5 ? 7 HELX_P HELX_P3 3 MET A 101 ? MET A 122 ? MET A 254 MET A 275 1 ? 22 HELX_P HELX_P4 4 GLY A 125 ? LEU A 129 ? GLY A 278 LEU A 282 5 ? 5 HELX_P HELX_P5 5 THR A 130 ? SER A 150 ? THR A 283 SER A 303 1 ? 21 HELX_P HELX_P6 6 CYS A 171 ? LYS A 177 ? CYS A 324 LYS A 330 1 ? 7 HELX_P HELX_P7 7 THR A 181 ? LYS A 197 ? THR A 334 LYS A 350 1 ? 17 HELX_P HELX_P8 8 HIS A 201 ? LEU A 214 ? HIS A 354 LEU A 367 1 ? 14 HELX_P HELX_P9 9 ASP A 223 ? HIS A 246 ? ASP A 376 HIS A 399 1 ? 24 HELX_P HELX_P10 10 LEU A 251 ? GLN A 280 ? LEU A 404 GLN A 433 1 ? 30 HELX_P HELX_P11 11 GLN A 280 ? MET A 285 ? GLN A 433 MET A 438 1 ? 6 HELX_P HELX_P12 12 THR A 288 ? PHE A 295 ? THR A 441 PHE A 448 1 ? 8 HELX_P HELX_P13 13 HIS B 2 ? LEU B 9 ? HIS B 688 LEU B 695 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 154 ? SER A 155 ? PHE A 307 SER A 308 A 2 SER A 160 ? SER A 162 ? SER A 313 SER A 315 A 3 LYS A 169 ? TYR A 170 ? LYS A 322 TYR A 323 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 155 ? N SER A 308 O SER A 160 ? O SER A 313 A 2 3 N TRP A 161 ? N TRP A 314 O TYR A 170 ? O TYR A 323 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE BIV A 501' AC2 Software ? ? ? ? 17 'BINDING SITE FOR CHAIN B OF NUCLEAR RECEPTOR COACTIVATOR 2' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 TYR A 22 ? TYR A 175 . ? 1_555 ? 2 AC1 15 LEU A 105 ? LEU A 258 . ? 1_555 ? 3 AC1 15 VAL A 109 ? VAL A 262 . ? 1_555 ? 4 AC1 15 SER A 112 ? SER A 265 . ? 1_555 ? 5 AC1 15 MET A 147 ? MET A 300 . ? 1_555 ? 6 AC1 15 ARG A 149 ? ARG A 302 . ? 1_555 ? 7 AC1 15 SER A 150 ? SER A 303 . ? 1_555 ? 8 AC1 15 SER A 153 ? SER A 306 . ? 1_555 ? 9 AC1 15 TRP A 161 ? TRP A 314 . ? 1_555 ? 10 AC1 15 CYS A 163 ? CYS A 316 . ? 1_555 ? 11 AC1 15 VAL A 175 ? VAL A 328 . ? 1_555 ? 12 AC1 15 HIS A 180 ? HIS A 333 . ? 1_555 ? 13 AC1 15 LEU A 184 ? LEU A 337 . ? 1_555 ? 14 AC1 15 LEU A 266 ? LEU A 419 . ? 1_555 ? 15 AC1 15 HIS A 270 ? HIS A 423 . ? 1_555 ? 16 AC2 17 ILE A 117 ? ILE A 270 . ? 1_555 ? 17 AC2 17 LYS A 121 ? LYS A 274 . ? 1_555 ? 18 AC2 17 ARG A 127 ? ARG A 280 . ? 1_555 ? 19 AC2 17 ILE A 135 ? ILE A 288 . ? 1_555 ? 20 AC2 17 LYS A 139 ? LYS A 292 . ? 1_555 ? 21 AC2 17 PRO A 281 ? PRO A 434 . ? 10_665 ? 22 AC2 17 GLU A 282 ? GLU A 435 . ? 10_665 ? 23 AC2 17 MET A 285 ? MET A 438 . ? 10_665 ? 24 AC2 17 GLU A 293 ? GLU A 446 . ? 1_555 ? 25 AC2 17 GLU A 298 ? GLU A 451 . ? 1_555 ? 26 AC2 17 VAL A 299 ? VAL A 452 . ? 1_555 ? 27 AC2 17 HOH D . ? HOH A 608 . ? 6_654 ? 28 AC2 17 HOH D . ? HOH A 616 . ? 1_555 ? 29 AC2 17 HOH E . ? HOH B 702 . ? 1_555 ? 30 AC2 17 HOH E . ? HOH B 703 . ? 1_555 ? 31 AC2 17 HOH E . ? HOH B 704 . ? 1_555 ? 32 AC2 17 HOH E . ? HOH B 706 . ? 1_555 ? # _database_PDB_matrix.entry_id 4IA7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4IA7 _atom_sites.fract_transf_matrix[1][1] 0.015111 _atom_sites.fract_transf_matrix[1][2] 0.008724 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017448 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003754 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 154 ? ? ? A . n A 1 2 MET 2 155 155 MET MET A . n A 1 3 LEU 3 156 156 LEU LEU A . n A 1 4 SER 4 157 157 SER SER A . n A 1 5 ASP 5 158 158 ASP ASP A . n A 1 6 GLU 6 159 159 GLU GLU A . n A 1 7 GLN 7 160 160 GLN GLN A . n A 1 8 MET 8 161 161 MET MET A . n A 1 9 GLN 9 162 162 GLN GLN A . n A 1 10 ILE 10 163 163 ILE ILE A . n A 1 11 ILE 11 164 164 ILE ILE A . n A 1 12 ASN 12 165 165 ASN ASN A . n A 1 13 SER 13 166 166 SER SER A . n A 1 14 LEU 14 167 167 LEU LEU A . n A 1 15 VAL 15 168 168 VAL VAL A . n A 1 16 GLU 16 169 169 GLU GLU A . n A 1 17 ALA 17 170 170 ALA ALA A . n A 1 18 HIS 18 171 171 HIS HIS A . n A 1 19 HIS 19 172 172 HIS HIS A . n A 1 20 LYS 20 173 173 LYS LYS A . n A 1 21 THR 21 174 174 THR THR A . n A 1 22 TYR 22 175 175 TYR TYR A . n A 1 23 ASP 23 176 176 ASP ASP A . n A 1 24 ASP 24 177 177 ASP ASP A . n A 1 25 SER 25 178 178 SER SER A . n A 1 26 TYR 26 179 179 TYR TYR A . n A 1 27 SER 27 180 180 SER SER A . n A 1 28 ASP 28 181 181 ASP ASP A . n A 1 29 PHE 29 182 182 PHE PHE A . n A 1 30 VAL 30 183 183 VAL VAL A . n A 1 31 ARG 31 184 184 ARG ARG A . n A 1 32 PHE 32 185 185 PHE PHE A . n A 1 33 ARG 33 186 186 ARG ARG A . n A 1 34 PRO 34 187 187 PRO PRO A . n A 1 35 PRO 35 188 188 PRO PRO A . n A 1 36 VAL 36 189 189 VAL VAL A . n A 1 37 ARG 37 190 190 ARG ARG A . n A 1 38 GLU 38 191 ? ? ? A . n A 1 39 GLY 39 192 ? ? ? A . n A 1 40 PRO 40 193 ? ? ? A . n A 1 41 VAL 41 194 ? ? ? A . n A 1 42 THR 42 195 ? ? ? A . n A 1 43 ARG 43 196 ? ? ? A . n A 1 44 SER 44 197 ? ? ? A . n A 1 45 ALA 45 198 ? ? ? A . n A 1 46 SER 46 199 ? ? ? A . n A 1 47 ARG 47 200 ? ? ? A . n A 1 48 ALA 48 201 ? ? ? A . n A 1 49 ALA 49 202 ? ? ? A . n A 1 50 SER 50 203 ? ? ? A . n A 1 51 LEU 51 204 ? ? ? A . n A 1 52 HIS 52 205 ? ? ? A . n A 1 53 SER 53 206 ? ? ? A . n A 1 54 LEU 54 207 ? ? ? A . n A 1 55 SER 55 208 ? ? ? A . n A 1 56 ASP 56 209 ? ? ? A . n A 1 57 ALA 57 210 ? ? ? A . n A 1 58 SER 58 211 ? ? ? A . n A 1 59 SER 59 212 ? ? ? A . n A 1 60 ASP 60 213 ? ? ? A . n A 1 61 SER 61 214 ? ? ? A . n A 1 62 PHE 62 215 ? ? ? A . n A 1 63 ASN 63 216 ? ? ? A . n A 1 64 HIS 64 217 ? ? ? A . n A 1 65 SER 65 218 ? ? ? A . n A 1 66 PRO 66 219 ? ? ? A . n A 1 67 GLU 67 220 ? ? ? A . n A 1 68 SER 68 221 ? ? ? A . n A 1 69 VAL 69 222 ? ? ? A . n A 1 70 ASP 70 223 ? ? ? A . n A 1 71 THR 71 224 ? ? ? A . n A 1 72 LYS 72 225 ? ? ? A . n A 1 73 LEU 73 226 ? ? ? A . n A 1 74 ASN 74 227 ? ? ? A . n A 1 75 PHE 75 228 ? ? ? A . n A 1 76 SER 76 229 ? ? ? A . n A 1 77 ASN 77 230 ? ? ? A . n A 1 78 LEU 78 231 ? ? ? A . n A 1 79 LEU 79 232 ? ? ? A . n A 1 80 MET 80 233 ? ? ? A . n A 1 81 MET 81 234 ? ? ? A . n A 1 82 TYR 82 235 ? ? ? A . n A 1 83 GLN 83 236 ? ? ? A . n A 1 84 ASP 84 237 ? ? ? A . n A 1 85 SER 85 238 ? ? ? A . n A 1 86 GLY 86 239 ? ? ? A . n A 1 87 SER 87 240 ? ? ? A . n A 1 88 PRO 88 241 ? ? ? A . n A 1 89 ASP 89 242 ? ? ? A . n A 1 90 SER 90 243 ? ? ? A . n A 1 91 SER 91 244 ? ? ? A . n A 1 92 GLU 92 245 ? ? ? A . n A 1 93 GLU 93 246 ? ? ? A . n A 1 94 ASP 94 247 ? ? ? A . n A 1 95 GLN 95 248 ? ? ? A . n A 1 96 GLN 96 249 ? ? ? A . n A 1 97 SER 97 250 ? ? ? A . n A 1 98 ARG 98 251 251 ARG ARG A . n A 1 99 LEU 99 252 252 LEU LEU A . n A 1 100 SER 100 253 253 SER SER A . n A 1 101 MET 101 254 254 MET MET A . n A 1 102 LEU 102 255 255 LEU LEU A . n A 1 103 PRO 103 256 256 PRO PRO A . n A 1 104 HIS 104 257 257 HIS HIS A . n A 1 105 LEU 105 258 258 LEU LEU A . n A 1 106 ALA 106 259 259 ALA ALA A . n A 1 107 ASP 107 260 260 ASP ASP A . n A 1 108 LEU 108 261 261 LEU LEU A . n A 1 109 VAL 109 262 262 VAL VAL A . n A 1 110 SER 110 263 263 SER SER A . n A 1 111 TYR 111 264 264 TYR TYR A . n A 1 112 SER 112 265 265 SER SER A . n A 1 113 ILE 113 266 266 ILE ILE A . n A 1 114 GLN 114 267 267 GLN GLN A . n A 1 115 LYS 115 268 268 LYS LYS A . n A 1 116 VAL 116 269 269 VAL VAL A . n A 1 117 ILE 117 270 270 ILE ILE A . n A 1 118 GLY 118 271 271 GLY GLY A . n A 1 119 PHE 119 272 272 PHE PHE A . n A 1 120 ALA 120 273 273 ALA ALA A . n A 1 121 LYS 121 274 274 LYS LYS A . n A 1 122 MET 122 275 275 MET MET A . n A 1 123 ILE 123 276 276 ILE ILE A . n A 1 124 PRO 124 277 277 PRO PRO A . n A 1 125 GLY 125 278 278 GLY GLY A . n A 1 126 PHE 126 279 279 PHE PHE A . n A 1 127 ARG 127 280 280 ARG ARG A . n A 1 128 ASP 128 281 281 ASP ASP A . n A 1 129 LEU 129 282 282 LEU LEU A . n A 1 130 THR 130 283 283 THR THR A . n A 1 131 ALA 131 284 284 ALA ALA A . n A 1 132 GLU 132 285 285 GLU GLU A . n A 1 133 ASP 133 286 286 ASP ASP A . n A 1 134 GLN 134 287 287 GLN GLN A . n A 1 135 ILE 135 288 288 ILE ILE A . n A 1 136 ALA 136 289 289 ALA ALA A . n A 1 137 LEU 137 290 290 LEU LEU A . n A 1 138 LEU 138 291 291 LEU LEU A . n A 1 139 LYS 139 292 292 LYS LYS A . n A 1 140 SER 140 293 293 SER SER A . n A 1 141 SER 141 294 294 SER SER A . n A 1 142 ALA 142 295 295 ALA ALA A . n A 1 143 ILE 143 296 296 ILE ILE A . n A 1 144 GLU 144 297 297 GLU GLU A . n A 1 145 ILE 145 298 298 ILE ILE A . n A 1 146 ILE 146 299 299 ILE ILE A . n A 1 147 MET 147 300 300 MET MET A . n A 1 148 LEU 148 301 301 LEU LEU A . n A 1 149 ARG 149 302 302 ARG ARG A . n A 1 150 SER 150 303 303 SER SER A . n A 1 151 ASN 151 304 304 ASN ASN A . n A 1 152 GLN 152 305 305 GLN GLN A . n A 1 153 SER 153 306 306 SER SER A . n A 1 154 PHE 154 307 307 PHE PHE A . n A 1 155 SER 155 308 308 SER SER A . n A 1 156 LEU 156 309 309 LEU LEU A . n A 1 157 GLU 157 310 310 GLU GLU A . n A 1 158 ASP 158 311 311 ASP ASP A . n A 1 159 MET 159 312 312 MET MET A . n A 1 160 SER 160 313 313 SER SER A . n A 1 161 TRP 161 314 314 TRP TRP A . n A 1 162 SER 162 315 315 SER SER A . n A 1 163 CYS 163 316 316 CYS CYS A . n A 1 164 GLY 164 317 317 GLY GLY A . n A 1 165 GLY 165 318 318 GLY GLY A . n A 1 166 PRO 166 319 319 PRO PRO A . n A 1 167 ASP 167 320 320 ASP ASP A . n A 1 168 PHE 168 321 321 PHE PHE A . n A 1 169 LYS 169 322 322 LYS LYS A . n A 1 170 TYR 170 323 323 TYR TYR A . n A 1 171 CYS 171 324 324 CYS CYS A . n A 1 172 ILE 172 325 325 ILE ILE A . n A 1 173 ASN 173 326 326 ASN ASN A . n A 1 174 ASP 174 327 327 ASP ASP A . n A 1 175 VAL 175 328 328 VAL VAL A . n A 1 176 THR 176 329 329 THR THR A . n A 1 177 LYS 177 330 330 LYS LYS A . n A 1 178 ALA 178 331 331 ALA ALA A . n A 1 179 GLY 179 332 332 GLY GLY A . n A 1 180 HIS 180 333 333 HIS HIS A . n A 1 181 THR 181 334 334 THR THR A . n A 1 182 LEU 182 335 335 LEU LEU A . n A 1 183 GLU 183 336 336 GLU GLU A . n A 1 184 LEU 184 337 337 LEU LEU A . n A 1 185 LEU 185 338 338 LEU LEU A . n A 1 186 GLU 186 339 339 GLU GLU A . n A 1 187 PRO 187 340 340 PRO PRO A . n A 1 188 LEU 188 341 341 LEU LEU A . n A 1 189 VAL 189 342 342 VAL VAL A . n A 1 190 LYS 190 343 343 LYS LYS A . n A 1 191 PHE 191 344 344 PHE PHE A . n A 1 192 GLN 192 345 345 GLN GLN A . n A 1 193 VAL 193 346 346 VAL VAL A . n A 1 194 GLY 194 347 347 GLY GLY A . n A 1 195 LEU 195 348 348 LEU LEU A . n A 1 196 LYS 196 349 349 LYS LYS A . n A 1 197 LYS 197 350 350 LYS LYS A . n A 1 198 LEU 198 351 351 LEU LEU A . n A 1 199 LYS 199 352 352 LYS LYS A . n A 1 200 LEU 200 353 353 LEU LEU A . n A 1 201 HIS 201 354 354 HIS HIS A . n A 1 202 GLU 202 355 355 GLU GLU A . n A 1 203 GLU 203 356 356 GLU GLU A . n A 1 204 GLU 204 357 357 GLU GLU A . n A 1 205 HIS 205 358 358 HIS HIS A . n A 1 206 VAL 206 359 359 VAL VAL A . n A 1 207 LEU 207 360 360 LEU LEU A . n A 1 208 LEU 208 361 361 LEU LEU A . n A 1 209 MET 209 362 362 MET MET A . n A 1 210 ALA 210 363 363 ALA ALA A . n A 1 211 ILE 211 364 364 ILE ILE A . n A 1 212 CYS 212 365 365 CYS CYS A . n A 1 213 LEU 213 366 366 LEU LEU A . n A 1 214 LEU 214 367 367 LEU LEU A . n A 1 215 SER 215 368 368 SER SER A . n A 1 216 PRO 216 369 369 PRO PRO A . n A 1 217 ASP 217 370 370 ASP ASP A . n A 1 218 ARG 218 371 371 ARG ARG A . n A 1 219 PRO 219 372 372 PRO PRO A . n A 1 220 GLY 220 373 373 GLY GLY A . n A 1 221 VAL 221 374 374 VAL VAL A . n A 1 222 GLN 222 375 375 GLN GLN A . n A 1 223 ASP 223 376 376 ASP ASP A . n A 1 224 HIS 224 377 377 HIS HIS A . n A 1 225 VAL 225 378 378 VAL VAL A . n A 1 226 ARG 226 379 379 ARG ARG A . n A 1 227 ILE 227 380 380 ILE ILE A . n A 1 228 GLU 228 381 381 GLU GLU A . n A 1 229 ALA 229 382 382 ALA ALA A . n A 1 230 LEU 230 383 383 LEU LEU A . n A 1 231 GLN 231 384 384 GLN GLN A . n A 1 232 ASP 232 385 385 ASP ASP A . n A 1 233 ARG 233 386 386 ARG ARG A . n A 1 234 LEU 234 387 387 LEU LEU A . n A 1 235 CYS 235 388 388 CYS CYS A . n A 1 236 ASP 236 389 389 ASP ASP A . n A 1 237 VAL 237 390 390 VAL VAL A . n A 1 238 LEU 238 391 391 LEU LEU A . n A 1 239 GLN 239 392 392 GLN GLN A . n A 1 240 ALA 240 393 393 ALA ALA A . n A 1 241 TYR 241 394 394 TYR TYR A . n A 1 242 ILE 242 395 395 ILE ILE A . n A 1 243 ARG 243 396 396 ARG ARG A . n A 1 244 ILE 244 397 397 ILE ILE A . n A 1 245 GLN 245 398 398 GLN GLN A . n A 1 246 HIS 246 399 399 HIS HIS A . n A 1 247 PRO 247 400 400 PRO PRO A . n A 1 248 GLY 248 401 401 GLY GLY A . n A 1 249 GLY 249 402 402 GLY GLY A . n A 1 250 ARG 250 403 403 ARG ARG A . n A 1 251 LEU 251 404 404 LEU LEU A . n A 1 252 LEU 252 405 405 LEU LEU A . n A 1 253 TYR 253 406 406 TYR TYR A . n A 1 254 ALA 254 407 407 ALA ALA A . n A 1 255 LYS 255 408 408 LYS LYS A . n A 1 256 MET 256 409 409 MET MET A . n A 1 257 ILE 257 410 410 ILE ILE A . n A 1 258 GLN 258 411 411 GLN GLN A . n A 1 259 LYS 259 412 412 LYS LYS A . n A 1 260 LEU 260 413 413 LEU LEU A . n A 1 261 ALA 261 414 414 ALA ALA A . n A 1 262 ASP 262 415 415 ASP ASP A . n A 1 263 LEU 263 416 416 LEU LEU A . n A 1 264 ARG 264 417 417 ARG ARG A . n A 1 265 SER 265 418 418 SER SER A . n A 1 266 LEU 266 419 419 LEU LEU A . n A 1 267 ASN 267 420 420 ASN ASN A . n A 1 268 GLU 268 421 421 GLU GLU A . n A 1 269 GLU 269 422 422 GLU GLU A . n A 1 270 HIS 270 423 423 HIS HIS A . n A 1 271 SER 271 424 424 SER SER A . n A 1 272 LYS 272 425 425 LYS LYS A . n A 1 273 GLN 273 426 426 GLN GLN A . n A 1 274 TYR 274 427 427 TYR TYR A . n A 1 275 ARG 275 428 428 ARG ARG A . n A 1 276 SER 276 429 429 SER SER A . n A 1 277 LEU 277 430 430 LEU LEU A . n A 1 278 SER 278 431 431 SER SER A . n A 1 279 PHE 279 432 432 PHE PHE A . n A 1 280 GLN 280 433 433 GLN GLN A . n A 1 281 PRO 281 434 434 PRO PRO A . n A 1 282 GLU 282 435 435 GLU GLU A . n A 1 283 HIS 283 436 436 HIS HIS A . n A 1 284 SER 284 437 437 SER SER A . n A 1 285 MET 285 438 438 MET MET A . n A 1 286 GLN 286 439 439 GLN GLN A . n A 1 287 LEU 287 440 440 LEU LEU A . n A 1 288 THR 288 441 441 THR THR A . n A 1 289 PRO 289 442 442 PRO PRO A . n A 1 290 LEU 290 443 443 LEU LEU A . n A 1 291 VAL 291 444 444 VAL VAL A . n A 1 292 LEU 292 445 445 LEU LEU A . n A 1 293 GLU 293 446 446 GLU GLU A . n A 1 294 VAL 294 447 447 VAL VAL A . n A 1 295 PHE 295 448 448 PHE PHE A . n A 1 296 GLY 296 449 449 GLY GLY A . n A 1 297 SER 297 450 450 SER SER A . n A 1 298 GLU 298 451 451 GLU ALA A . n A 1 299 VAL 299 452 452 VAL ALA A . n A 1 300 SER 300 453 ? ? ? A . n B 2 1 LYS 1 687 687 LYS GLY B . n B 2 2 HIS 2 688 688 HIS HIS B . n B 2 3 LYS 3 689 689 LYS LYS B . n B 2 4 ILE 4 690 690 ILE ILE B . n B 2 5 LEU 5 691 691 LEU LEU B . n B 2 6 HIS 6 692 692 HIS HIS B . n B 2 7 ARG 7 693 693 ARG ARG B . n B 2 8 LEU 8 694 694 LEU LEU B . n B 2 9 LEU 9 695 695 LEU LEU B . n B 2 10 GLN 10 696 696 GLN ALA B . n B 2 11 ASP 11 697 ? ? ? B . n B 2 12 SER 12 698 ? ? ? B . n B 2 13 SER 13 699 ? ? ? B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6310 ? 1 MORE -39 ? 1 'SSA (A^2)' 21790 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 33.0890000000 -0.8660254038 -0.5000000000 0.0000000000 57.3118291716 0.0000000000 0.0000000000 -1.0000000000 44.4020000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-04-24 2 'Structure model' 1 1 2013-07-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement . ? 1 HKL-2000 'data reduction' . ? 2 HKL-2000 'data scaling' . ? 3 CNS phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 330 ? ? -77.32 22.53 2 1 LYS A 352 ? ? 29.59 45.12 3 1 LEU A 367 ? ? -97.15 35.63 4 1 GLN A 375 ? ? -105.40 -83.95 5 1 ASP A 376 ? ? -67.56 65.49 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 451 ? CG ? A GLU 298 CG 2 1 Y 1 A GLU 451 ? CD ? A GLU 298 CD 3 1 Y 1 A GLU 451 ? OE1 ? A GLU 298 OE1 4 1 Y 1 A GLU 451 ? OE2 ? A GLU 298 OE2 5 1 Y 1 A VAL 452 ? CG1 ? A VAL 299 CG1 6 1 Y 1 A VAL 452 ? CG2 ? A VAL 299 CG2 7 1 Y 1 B LYS 687 ? CB ? B LYS 1 CB 8 1 Y 1 B LYS 687 ? CG ? B LYS 1 CG 9 1 Y 1 B LYS 687 ? CD ? B LYS 1 CD 10 1 Y 1 B LYS 687 ? CE ? B LYS 1 CE 11 1 Y 1 B LYS 687 ? NZ ? B LYS 1 NZ 12 1 Y 0 B LYS 689 ? CG ? B LYS 3 CG 13 1 Y 0 B LYS 689 ? CD ? B LYS 3 CD 14 1 Y 0 B LYS 689 ? CE ? B LYS 3 CE 15 1 Y 0 B LYS 689 ? NZ ? B LYS 3 NZ 16 1 Y 1 B GLN 696 ? CG ? B GLN 10 CG 17 1 Y 1 B GLN 696 ? CD ? B GLN 10 CD 18 1 Y 1 B GLN 696 ? OE1 ? B GLN 10 OE1 19 1 Y 1 B GLN 696 ? NE2 ? B GLN 10 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 154 ? A HIS 1 2 1 Y 1 A GLU 191 ? A GLU 38 3 1 Y 1 A GLY 192 ? A GLY 39 4 1 Y 1 A PRO 193 ? A PRO 40 5 1 Y 1 A VAL 194 ? A VAL 41 6 1 Y 1 A THR 195 ? A THR 42 7 1 Y 1 A ARG 196 ? A ARG 43 8 1 Y 1 A SER 197 ? A SER 44 9 1 Y 1 A ALA 198 ? A ALA 45 10 1 Y 1 A SER 199 ? A SER 46 11 1 Y 1 A ARG 200 ? A ARG 47 12 1 Y 1 A ALA 201 ? A ALA 48 13 1 Y 1 A ALA 202 ? A ALA 49 14 1 Y 1 A SER 203 ? A SER 50 15 1 Y 1 A LEU 204 ? A LEU 51 16 1 Y 1 A HIS 205 ? A HIS 52 17 1 Y 1 A SER 206 ? A SER 53 18 1 Y 1 A LEU 207 ? A LEU 54 19 1 Y 1 A SER 208 ? A SER 55 20 1 Y 1 A ASP 209 ? A ASP 56 21 1 Y 1 A ALA 210 ? A ALA 57 22 1 Y 1 A SER 211 ? A SER 58 23 1 Y 1 A SER 212 ? A SER 59 24 1 Y 1 A ASP 213 ? A ASP 60 25 1 Y 1 A SER 214 ? A SER 61 26 1 Y 1 A PHE 215 ? A PHE 62 27 1 Y 1 A ASN 216 ? A ASN 63 28 1 Y 1 A HIS 217 ? A HIS 64 29 1 Y 1 A SER 218 ? A SER 65 30 1 Y 1 A PRO 219 ? A PRO 66 31 1 Y 1 A GLU 220 ? A GLU 67 32 1 Y 1 A SER 221 ? A SER 68 33 1 Y 1 A VAL 222 ? A VAL 69 34 1 Y 1 A ASP 223 ? A ASP 70 35 1 Y 1 A THR 224 ? A THR 71 36 1 Y 1 A LYS 225 ? A LYS 72 37 1 Y 1 A LEU 226 ? A LEU 73 38 1 Y 1 A ASN 227 ? A ASN 74 39 1 Y 1 A PHE 228 ? A PHE 75 40 1 Y 1 A SER 229 ? A SER 76 41 1 Y 1 A ASN 230 ? A ASN 77 42 1 Y 1 A LEU 231 ? A LEU 78 43 1 Y 1 A LEU 232 ? A LEU 79 44 1 Y 1 A MET 233 ? A MET 80 45 1 Y 1 A MET 234 ? A MET 81 46 1 Y 1 A TYR 235 ? A TYR 82 47 1 Y 1 A GLN 236 ? A GLN 83 48 1 Y 1 A ASP 237 ? A ASP 84 49 1 Y 1 A SER 238 ? A SER 85 50 1 Y 1 A GLY 239 ? A GLY 86 51 1 Y 1 A SER 240 ? A SER 87 52 1 Y 1 A PRO 241 ? A PRO 88 53 1 Y 1 A ASP 242 ? A ASP 89 54 1 Y 1 A SER 243 ? A SER 90 55 1 Y 1 A SER 244 ? A SER 91 56 1 Y 1 A GLU 245 ? A GLU 92 57 1 Y 1 A GLU 246 ? A GLU 93 58 1 Y 1 A ASP 247 ? A ASP 94 59 1 Y 1 A GLN 248 ? A GLN 95 60 1 Y 1 A GLN 249 ? A GLN 96 61 1 Y 1 A SER 250 ? A SER 97 62 1 Y 1 A SER 453 ? A SER 300 63 1 Y 1 B ASP 697 ? B ASP 11 64 1 Y 1 B SER 698 ? B SER 12 65 1 Y 1 B SER 699 ? B SER 13 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '21-NOR-9,10-SECOCHOLESTA-5,7,10(19)-TRIENE-1,3,25-TRIOL, 20-(4-HYDROXY-4-METHYLPENTYL)-, (1A,3B,5Z,7E)' BIV 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 BIV 1 501 525 BIV LI8 A . D 4 HOH 1 601 1 HOH TIP A . D 4 HOH 2 602 2 HOH TIP A . D 4 HOH 3 603 3 HOH TIP A . D 4 HOH 4 604 4 HOH TIP A . D 4 HOH 5 605 5 HOH TIP A . D 4 HOH 6 606 6 HOH TIP A . D 4 HOH 7 607 7 HOH TIP A . D 4 HOH 8 608 8 HOH TIP A . D 4 HOH 9 609 9 HOH TIP A . D 4 HOH 10 610 10 HOH TIP A . D 4 HOH 11 611 12 HOH TIP A . D 4 HOH 12 612 13 HOH TIP A . D 4 HOH 13 613 14 HOH TIP A . D 4 HOH 14 614 15 HOH TIP A . D 4 HOH 15 615 16 HOH TIP A . D 4 HOH 16 616 17 HOH TIP A . D 4 HOH 17 617 18 HOH TIP A . D 4 HOH 18 618 19 HOH TIP A . D 4 HOH 19 619 20 HOH TIP A . D 4 HOH 20 620 21 HOH TIP A . D 4 HOH 21 621 22 HOH TIP A . D 4 HOH 22 622 23 HOH TIP A . D 4 HOH 23 623 24 HOH TIP A . D 4 HOH 24 624 25 HOH TIP A . D 4 HOH 25 625 26 HOH TIP A . D 4 HOH 26 626 27 HOH TIP A . D 4 HOH 27 627 28 HOH TIP A . D 4 HOH 28 628 30 HOH TIP A . D 4 HOH 29 629 31 HOH TIP A . D 4 HOH 30 630 32 HOH TIP A . D 4 HOH 31 631 33 HOH TIP A . D 4 HOH 32 632 34 HOH TIP A . D 4 HOH 33 633 36 HOH TIP A . D 4 HOH 34 634 37 HOH TIP A . D 4 HOH 35 635 38 HOH TIP A . D 4 HOH 36 636 39 HOH TIP A . D 4 HOH 37 637 40 HOH TIP A . D 4 HOH 38 638 41 HOH TIP A . D 4 HOH 39 639 42 HOH TIP A . D 4 HOH 40 640 43 HOH TIP A . D 4 HOH 41 641 44 HOH TIP A . D 4 HOH 42 642 45 HOH TIP A . D 4 HOH 43 643 46 HOH TIP A . D 4 HOH 44 644 47 HOH TIP A . D 4 HOH 45 645 48 HOH TIP A . D 4 HOH 46 646 50 HOH TIP A . D 4 HOH 47 647 51 HOH TIP A . D 4 HOH 48 648 52 HOH TIP A . D 4 HOH 49 649 53 HOH TIP A . D 4 HOH 50 650 54 HOH TIP A . D 4 HOH 51 651 55 HOH TIP A . D 4 HOH 52 652 57 HOH TIP A . D 4 HOH 53 653 58 HOH TIP A . D 4 HOH 54 654 59 HOH TIP A . D 4 HOH 55 655 60 HOH TIP A . D 4 HOH 56 656 62 HOH TIP A . D 4 HOH 57 657 63 HOH TIP A . D 4 HOH 58 658 64 HOH TIP A . D 4 HOH 59 659 65 HOH TIP A . D 4 HOH 60 660 66 HOH TIP A . D 4 HOH 61 661 67 HOH TIP A . D 4 HOH 62 662 68 HOH TIP A . D 4 HOH 63 663 69 HOH TIP A . D 4 HOH 64 664 70 HOH TIP A . D 4 HOH 65 665 71 HOH TIP A . E 4 HOH 1 701 11 HOH TIP B . E 4 HOH 2 702 29 HOH TIP B . E 4 HOH 3 703 35 HOH TIP B . E 4 HOH 4 704 49 HOH TIP B . E 4 HOH 5 705 56 HOH TIP B . E 4 HOH 6 706 61 HOH TIP B . #