data_4IET # _entry.id 4IET # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4IET RCSB RCSB076662 WWPDB D_1000076662 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4IEO . unspecified PDB 4IEP . unspecified PDB 4IEQ . unspecified PDB 4IER . unspecified PDB 4IES . unspecified PDB 4IEU . unspecified PDB 4IEV . unspecified PDB 4IEW . unspecified PDB 4IEX . unspecified PDB 4IEY . unspecified PDB 4IEZ . unspecified PDB 4IF0 . unspecified PDB 4IF1 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4IET _pdbx_database_status.recvd_initial_deposition_date 2012-12-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Driggers, C.M.' 1 'Cooley, R.B.' 2 'Karplus, P.A.' 3 # _citation.id primary _citation.title ;Cysteine dioxygenase structures from pH4 to 9: consistent cys-persulfenate formation at intermediate pH and a Cys-bound enzyme at higher pH. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 425 _citation.page_first 3121 _citation.page_last 3136 _citation.year 2013 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23747973 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2013.05.028 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Driggers, C.M.' 1 primary 'Cooley, R.B.' 2 primary 'Sankaran, B.' 3 primary 'Hirschberger, L.L.' 4 primary 'Stipanuk, M.H.' 5 primary 'Karplus, P.A.' 6 # _cell.entry_id 4IET _cell.length_a 57.600 _cell.length_b 57.600 _cell.length_c 122.400 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4IET _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cysteine dioxygenase type 1' 23058.889 1 1.13.11.20 ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 1 ? ? ? ? 3 non-polymer syn S-HYDROPEROXYCYSTEINE 153.157 1 ? ? ? ? 4 water nat water 18.015 214 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cysteine dioxygenase type I, CDO, CDO-I' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN ; _entity_poly.pdbx_seq_one_letter_code_can ;MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ARG n 1 4 THR n 1 5 GLU n 1 6 LEU n 1 7 LEU n 1 8 LYS n 1 9 PRO n 1 10 ARG n 1 11 THR n 1 12 LEU n 1 13 ALA n 1 14 ASP n 1 15 LEU n 1 16 ILE n 1 17 ARG n 1 18 ILE n 1 19 LEU n 1 20 HIS n 1 21 GLU n 1 22 LEU n 1 23 PHE n 1 24 ALA n 1 25 GLY n 1 26 ASP n 1 27 GLU n 1 28 VAL n 1 29 ASN n 1 30 VAL n 1 31 GLU n 1 32 GLU n 1 33 VAL n 1 34 GLN n 1 35 ALA n 1 36 VAL n 1 37 LEU n 1 38 GLU n 1 39 ALA n 1 40 TYR n 1 41 GLU n 1 42 SER n 1 43 ASN n 1 44 PRO n 1 45 ALA n 1 46 GLU n 1 47 TRP n 1 48 ALA n 1 49 LEU n 1 50 TYR n 1 51 ALA n 1 52 LYS n 1 53 PHE n 1 54 ASP n 1 55 GLN n 1 56 TYR n 1 57 ARG n 1 58 TYR n 1 59 THR n 1 60 ARG n 1 61 ASN n 1 62 LEU n 1 63 VAL n 1 64 ASP n 1 65 GLN n 1 66 GLY n 1 67 ASN n 1 68 GLY n 1 69 LYS n 1 70 PHE n 1 71 ASN n 1 72 LEU n 1 73 MET n 1 74 ILE n 1 75 LEU n 1 76 CYS n 1 77 TRP n 1 78 GLY n 1 79 GLU n 1 80 GLY n 1 81 HIS n 1 82 GLY n 1 83 SER n 1 84 SER n 1 85 ILE n 1 86 HIS n 1 87 ASP n 1 88 HIS n 1 89 THR n 1 90 ASP n 1 91 SER n 1 92 HIS n 1 93 CYS n 1 94 PHE n 1 95 LEU n 1 96 LYS n 1 97 LEU n 1 98 LEU n 1 99 GLN n 1 100 GLY n 1 101 ASN n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 THR n 1 106 LEU n 1 107 PHE n 1 108 ASP n 1 109 TRP n 1 110 PRO n 1 111 ASP n 1 112 LYS n 1 113 LYS n 1 114 SER n 1 115 ASN n 1 116 GLU n 1 117 MET n 1 118 ILE n 1 119 LYS n 1 120 LYS n 1 121 SER n 1 122 GLU n 1 123 ARG n 1 124 THR n 1 125 LEU n 1 126 ARG n 1 127 GLU n 1 128 ASN n 1 129 GLN n 1 130 CYS n 1 131 ALA n 1 132 TYR n 1 133 ILE n 1 134 ASN n 1 135 ASP n 1 136 SER n 1 137 ILE n 1 138 GLY n 1 139 LEU n 1 140 HIS n 1 141 ARG n 1 142 VAL n 1 143 GLU n 1 144 ASN n 1 145 VAL n 1 146 SER n 1 147 HIS n 1 148 THR n 1 149 GLU n 1 150 PRO n 1 151 ALA n 1 152 VAL n 1 153 SER n 1 154 LEU n 1 155 HIS n 1 156 LEU n 1 157 TYR n 1 158 SER n 1 159 PRO n 1 160 PRO n 1 161 PHE n 1 162 ASP n 1 163 THR n 1 164 CYS n 1 165 HIS n 1 166 ALA n 1 167 PHE n 1 168 ASP n 1 169 GLN n 1 170 ARG n 1 171 THR n 1 172 GLY n 1 173 HIS n 1 174 LYS n 1 175 ASN n 1 176 LYS n 1 177 VAL n 1 178 THR n 1 179 MET n 1 180 THR n 1 181 PHE n 1 182 HIS n 1 183 SER n 1 184 LYS n 1 185 PHE n 1 186 GLY n 1 187 ILE n 1 188 ARG n 1 189 THR n 1 190 PRO n 1 191 PHE n 1 192 THR n 1 193 THR n 1 194 SER n 1 195 GLY n 1 196 SER n 1 197 LEU n 1 198 GLU n 1 199 ASN n 1 200 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'brown rat,rat,rats' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Cdo1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDO1_RAT _struct_ref.pdbx_db_accession P21816 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4IET _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 200 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P21816 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 200 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2CO 'L-peptide linking' n S-HYDROPEROXYCYSTEINE ? 'C3 H7 N O4 S' 153.157 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4IET _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_percent_sol 44.13 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;Purified enzyme was concentrated to ~8 mg/mL and then added into a crystallization screen containing 0.1 M tri-sodium citrate pH=5.6, 24-34% PEG 4K, and 0.1-0.25 M ammonium acetate. 1.5L of protein solution was added to each well and mixed with an equivalent volume of reservoir solution., pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2010-12-04 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(220) Asymmetric cut single crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 5.0.1' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 5.0.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.976 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4IET _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 42 _reflns.d_resolution_high 1.40 _reflns.number_obs 39197 _reflns.percent_possible_obs 93.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.number_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4IET _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 38127 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.907 _refine.ls_d_res_high 1.400 _refine.ls_percent_reflns_obs 92.01 _refine.ls_R_factor_obs 0.1576 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1529 _refine.ls_R_factor_R_free 0.2007 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.72 _refine.ls_number_reflns_R_free 3707 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.19 _refine.pdbx_overall_phase_error 24.21 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1504 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 214 _refine_hist.number_atoms_total 1728 _refine_hist.d_res_high 1.400 _refine_hist.d_res_low 33.907 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.012 ? ? 1628 'X-RAY DIFFRACTION' ? f_angle_d 1.259 ? ? 2207 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 13.777 ? ? 600 'X-RAY DIFFRACTION' ? f_chiral_restr 0.078 ? ? 234 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 291 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 1.4000 1.4185 1011 0.3840 70.00 0.4071 . . 83 . . . . 'X-RAY DIFFRACTION' . 1.4185 1.4379 1042 0.3425 74.00 0.4160 . . 107 . . . . 'X-RAY DIFFRACTION' . 1.4379 1.4584 1187 0.3346 84.00 0.3921 . . 129 . . . . 'X-RAY DIFFRACTION' . 1.4584 1.4802 1162 0.3109 82.00 0.3801 . . 126 . . . . 'X-RAY DIFFRACTION' . 1.4802 1.5033 1200 0.2627 85.00 0.3097 . . 117 . . . . 'X-RAY DIFFRACTION' . 1.5033 1.5280 1185 0.2195 85.00 0.3060 . . 134 . . . . 'X-RAY DIFFRACTION' . 1.5280 1.5543 1221 0.2056 85.00 0.3020 . . 120 . . . . 'X-RAY DIFFRACTION' . 1.5543 1.5826 1201 0.1746 87.00 0.2660 . . 147 . . . . 'X-RAY DIFFRACTION' . 1.5826 1.6130 1228 0.1782 87.00 0.2471 . . 145 . . . . 'X-RAY DIFFRACTION' . 1.6130 1.6460 1271 0.1610 88.00 0.2011 . . 120 . . . . 'X-RAY DIFFRACTION' . 1.6460 1.6817 1276 0.1525 92.00 0.2605 . . 153 . . . . 'X-RAY DIFFRACTION' . 1.6817 1.7209 1348 0.1478 95.00 0.2209 . . 153 . . . . 'X-RAY DIFFRACTION' . 1.7209 1.7639 1367 0.1471 96.00 0.2131 . . 140 . . . . 'X-RAY DIFFRACTION' . 1.7639 1.8116 1400 0.1412 96.00 0.2631 . . 141 . . . . 'X-RAY DIFFRACTION' . 1.8116 1.8649 1388 0.1543 97.00 0.2487 . . 144 . . . . 'X-RAY DIFFRACTION' . 1.8649 1.9251 1385 0.2011 96.00 0.2867 . . 142 . . . . 'X-RAY DIFFRACTION' . 1.9251 1.9939 1391 0.1464 98.00 0.2204 . . 161 . . . . 'X-RAY DIFFRACTION' . 1.9939 2.0737 1403 0.1220 99.00 0.1870 . . 171 . . . . 'X-RAY DIFFRACTION' . 2.0737 2.1681 1412 0.1307 99.00 0.1941 . . 157 . . . . 'X-RAY DIFFRACTION' . 2.1681 2.2823 1404 0.1557 96.00 0.2233 . . 136 . . . . 'X-RAY DIFFRACTION' . 2.2823 2.4253 1448 0.1414 99.00 0.2193 . . 140 . . . . 'X-RAY DIFFRACTION' . 2.4253 2.6125 1455 0.1471 100.00 0.2119 . . 169 . . . . 'X-RAY DIFFRACTION' . 2.6125 2.8753 1442 0.1466 100.00 0.1993 . . 173 . . . . 'X-RAY DIFFRACTION' . 2.8753 3.2910 1469 0.1458 100.00 0.1887 . . 166 . . . . 'X-RAY DIFFRACTION' . 3.2910 4.1452 1512 0.1354 100.00 0.1605 . . 160 . . . . 'X-RAY DIFFRACTION' . 4.1452 33.9169 1612 0.1482 100.00 0.1560 . . 173 . . . . # _struct.entry_id 4IET _struct.title 'Cys-persulfenate bound Cysteine Dioxygenase at pH 6.8 in the presence of Cys' _struct.pdbx_descriptor 'Cysteine dioxygenase type 1 (E.C.1.13.11.20)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4IET _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'Cupin fold, catalyzes oxidation, cysteine to cysteine sulfinate, C93-Y157 crosslink, Cytosol, OXIDOREDUCTASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 11 ? PHE A 23 ? THR A 11 PHE A 23 1 ? 13 HELX_P HELX_P2 2 ASN A 29 ? TYR A 40 ? ASN A 29 TYR A 40 1 ? 12 HELX_P HELX_P3 3 ASN A 43 ? ALA A 48 ? ASN A 43 ALA A 48 1 ? 6 HELX_P HELX_P4 4 LEU A 49 ? ALA A 51 ? LEU A 49 ALA A 51 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 86 A FE2 501 1_555 ? ? ? ? ? ? ? 2.019 ? metalc2 metalc ? ? B FE2 . FE ? ? ? 1_555 C 2CO . OD ? ? A FE2 501 A 2CO 502 1_555 ? ? ? ? ? ? ? 2.059 ? metalc3 metalc ? ? A HIS 140 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 140 A FE2 501 1_555 ? ? ? ? ? ? ? 2.133 ? metalc4 metalc ? ? A HIS 88 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 88 A FE2 501 1_555 ? ? ? ? ? ? ? 2.240 ? metalc5 metalc ? ? B FE2 . FE ? ? ? 1_555 C 2CO . N ? ? A FE2 501 A 2CO 502 1_555 ? ? ? ? ? ? ? 2.372 ? metalc6 metalc ? ? B FE2 . FE ? ? ? 1_555 C 2CO . SG ? ? A FE2 501 A 2CO 502 1_555 ? ? ? ? ? ? ? 2.381 ? covale1 covale ? ? A CYS 93 SG ? ? ? 1_555 A TYR 157 CE2 ? ? A CYS 93 A TYR 157 1_555 ? ? ? ? ? ? ? 1.801 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 158 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 158 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 159 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 159 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.72 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 3 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 130 ? ILE A 133 ? CYS A 130 ILE A 133 A 2 HIS A 92 ? GLN A 99 ? HIS A 92 GLN A 99 A 3 ALA A 151 ? SER A 158 ? ALA A 151 SER A 158 A 4 ASN A 71 ? TRP A 77 ? ASN A 71 TRP A 77 A 5 THR A 59 ? ASP A 64 ? THR A 59 ASP A 64 A 6 SER A 183 ? LYS A 184 ? SER A 183 LYS A 184 A 7 ILE A 187 ? ARG A 188 ? ILE A 187 ARG A 188 B 1 ILE A 85 ? HIS A 86 ? ILE A 85 HIS A 86 B 2 THR A 163 ? PHE A 167 ? THR A 163 PHE A 167 B 3 LYS A 174 ? THR A 178 ? LYS A 174 THR A 178 C 1 LYS A 119 ? LEU A 125 ? LYS A 119 LEU A 125 C 2 LEU A 102 ? PHE A 107 ? LEU A 102 PHE A 107 C 3 LEU A 139 ? GLU A 143 ? LEU A 139 GLU A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 131 ? O ALA A 131 N LEU A 95 ? N LEU A 95 A 2 3 N LYS A 96 ? N LYS A 96 O LEU A 154 ? O LEU A 154 A 3 4 O HIS A 155 ? O HIS A 155 N MET A 73 ? N MET A 73 A 4 5 O LEU A 72 ? O LEU A 72 N VAL A 63 ? N VAL A 63 A 5 6 N LEU A 62 ? N LEU A 62 O SER A 183 ? O SER A 183 A 6 7 N LYS A 184 ? N LYS A 184 O ILE A 187 ? O ILE A 187 B 1 2 N ILE A 85 ? N ILE A 85 O PHE A 167 ? O PHE A 167 B 2 3 N CYS A 164 ? N CYS A 164 O VAL A 177 ? O VAL A 177 C 1 2 O LEU A 125 ? O LEU A 125 N LEU A 102 ? N LEU A 102 C 2 3 N LYS A 103 ? N LYS A 103 O GLU A 143 ? O GLU A 143 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FE2 A 501' AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 2CO A 502' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 86 ? HIS A 86 . ? 1_555 ? 2 AC1 4 HIS A 88 ? HIS A 88 . ? 1_555 ? 3 AC1 4 HIS A 140 ? HIS A 140 . ? 1_555 ? 4 AC1 4 2CO C . ? 2CO A 502 . ? 1_555 ? 5 AC2 12 TYR A 58 ? TYR A 58 . ? 1_555 ? 6 AC2 12 ARG A 60 ? ARG A 60 . ? 1_555 ? 7 AC2 12 LEU A 75 ? LEU A 75 . ? 1_555 ? 8 AC2 12 HIS A 86 ? HIS A 86 . ? 1_555 ? 9 AC2 12 HIS A 88 ? HIS A 88 . ? 1_555 ? 10 AC2 12 CYS A 93 ? CYS A 93 . ? 1_555 ? 11 AC2 12 LEU A 95 ? LEU A 95 . ? 1_555 ? 12 AC2 12 HIS A 140 ? HIS A 140 . ? 1_555 ? 13 AC2 12 VAL A 142 ? VAL A 142 . ? 1_555 ? 14 AC2 12 HIS A 155 ? HIS A 155 . ? 1_555 ? 15 AC2 12 TYR A 157 ? TYR A 157 . ? 1_555 ? 16 AC2 12 FE2 B . ? FE2 A 501 . ? 1_555 ? # _database_PDB_matrix.entry_id 4IET _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4IET _atom_sites.fract_transf_matrix[1][1] 0.017361 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017361 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008170 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 CYS 93 93 93 CYS CYS A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 MET 179 179 179 MET MET A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 PHE 181 181 181 PHE PHE A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 PHE 191 191 ? ? ? A . n A 1 192 THR 192 192 ? ? ? A . n A 1 193 THR 193 193 ? ? ? A . n A 1 194 SER 194 194 ? ? ? A . n A 1 195 GLY 195 195 ? ? ? A . n A 1 196 SER 196 196 ? ? ? A . n A 1 197 LEU 197 197 ? ? ? A . n A 1 198 GLU 198 198 ? ? ? A . n A 1 199 ASN 199 199 ? ? ? A . n A 1 200 ASN 200 200 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 501 501 FE2 FE A . C 3 2CO 1 502 502 2CO 2CO A . D 4 HOH 1 601 601 HOH HOH A . D 4 HOH 2 602 602 HOH HOH A . D 4 HOH 3 603 603 HOH HOH A . D 4 HOH 4 604 604 HOH HOH A . D 4 HOH 5 605 605 HOH HOH A . D 4 HOH 6 606 606 HOH HOH A . D 4 HOH 7 607 607 HOH HOH A . D 4 HOH 8 608 608 HOH HOH A . D 4 HOH 9 609 609 HOH HOH A . D 4 HOH 10 610 610 HOH HOH A . D 4 HOH 11 611 611 HOH HOH A . D 4 HOH 12 612 612 HOH HOH A . D 4 HOH 13 613 613 HOH HOH A . D 4 HOH 14 614 614 HOH HOH A . D 4 HOH 15 615 615 HOH HOH A . D 4 HOH 16 616 616 HOH HOH A . D 4 HOH 17 617 617 HOH HOH A . D 4 HOH 18 618 618 HOH HOH A . D 4 HOH 19 619 619 HOH HOH A . D 4 HOH 20 620 620 HOH HOH A . D 4 HOH 21 621 621 HOH HOH A . D 4 HOH 22 622 622 HOH HOH A . D 4 HOH 23 623 623 HOH HOH A . D 4 HOH 24 624 624 HOH HOH A . D 4 HOH 25 625 625 HOH HOH A . D 4 HOH 26 626 626 HOH HOH A . D 4 HOH 27 627 627 HOH HOH A . D 4 HOH 28 628 628 HOH HOH A . D 4 HOH 29 629 629 HOH HOH A . D 4 HOH 30 630 630 HOH HOH A . D 4 HOH 31 631 631 HOH HOH A . D 4 HOH 32 632 632 HOH HOH A . D 4 HOH 33 633 633 HOH HOH A . D 4 HOH 34 634 634 HOH HOH A . D 4 HOH 35 635 635 HOH HOH A . D 4 HOH 36 636 636 HOH HOH A . D 4 HOH 37 637 637 HOH HOH A . D 4 HOH 38 638 638 HOH HOH A . D 4 HOH 39 639 639 HOH HOH A . D 4 HOH 40 640 640 HOH HOH A . D 4 HOH 41 641 641 HOH HOH A . D 4 HOH 42 642 642 HOH HOH A . D 4 HOH 43 643 643 HOH HOH A . D 4 HOH 44 644 644 HOH HOH A . D 4 HOH 45 645 645 HOH HOH A . D 4 HOH 46 646 646 HOH HOH A . D 4 HOH 47 647 647 HOH HOH A . D 4 HOH 48 648 648 HOH HOH A . D 4 HOH 49 649 649 HOH HOH A . D 4 HOH 50 650 650 HOH HOH A . D 4 HOH 51 651 651 HOH HOH A . D 4 HOH 52 652 652 HOH HOH A . D 4 HOH 53 653 653 HOH HOH A . D 4 HOH 54 654 654 HOH HOH A . D 4 HOH 55 655 655 HOH HOH A . D 4 HOH 56 656 656 HOH HOH A . D 4 HOH 57 657 657 HOH HOH A . D 4 HOH 58 658 658 HOH HOH A . D 4 HOH 59 659 659 HOH HOH A . D 4 HOH 60 660 660 HOH HOH A . D 4 HOH 61 661 661 HOH HOH A . D 4 HOH 62 662 662 HOH HOH A . D 4 HOH 63 663 663 HOH HOH A . D 4 HOH 64 664 664 HOH HOH A . D 4 HOH 65 665 665 HOH HOH A . D 4 HOH 66 666 666 HOH HOH A . D 4 HOH 67 667 667 HOH HOH A . D 4 HOH 68 668 668 HOH HOH A . D 4 HOH 69 669 669 HOH HOH A . D 4 HOH 70 670 670 HOH HOH A . D 4 HOH 71 671 671 HOH HOH A . D 4 HOH 72 672 672 HOH HOH A . D 4 HOH 73 673 673 HOH HOH A . D 4 HOH 74 674 674 HOH HOH A . D 4 HOH 75 675 675 HOH HOH A . D 4 HOH 76 676 676 HOH HOH A . D 4 HOH 77 677 677 HOH HOH A . D 4 HOH 78 678 678 HOH HOH A . D 4 HOH 79 679 679 HOH HOH A . D 4 HOH 80 680 680 HOH HOH A . D 4 HOH 81 681 681 HOH HOH A . D 4 HOH 82 682 682 HOH HOH A . D 4 HOH 83 683 683 HOH HOH A . D 4 HOH 84 684 684 HOH HOH A . D 4 HOH 85 685 685 HOH HOH A . D 4 HOH 86 686 686 HOH HOH A . D 4 HOH 87 687 687 HOH HOH A . D 4 HOH 88 688 688 HOH HOH A . D 4 HOH 89 689 689 HOH HOH A . D 4 HOH 90 690 690 HOH HOH A . D 4 HOH 91 691 691 HOH HOH A . D 4 HOH 92 692 692 HOH HOH A . D 4 HOH 93 693 693 HOH HOH A . D 4 HOH 94 694 694 HOH HOH A . D 4 HOH 95 695 695 HOH HOH A . D 4 HOH 96 696 696 HOH HOH A . D 4 HOH 97 697 697 HOH HOH A . D 4 HOH 98 698 698 HOH HOH A . D 4 HOH 99 699 699 HOH HOH A . D 4 HOH 100 700 700 HOH HOH A . D 4 HOH 101 701 701 HOH HOH A . D 4 HOH 102 702 702 HOH HOH A . D 4 HOH 103 703 703 HOH HOH A . D 4 HOH 104 704 704 HOH HOH A . D 4 HOH 105 705 705 HOH HOH A . D 4 HOH 106 706 706 HOH HOH A . D 4 HOH 107 707 707 HOH HOH A . D 4 HOH 108 708 708 HOH HOH A . D 4 HOH 109 709 709 HOH HOH A . D 4 HOH 110 710 710 HOH HOH A . D 4 HOH 111 711 711 HOH HOH A . D 4 HOH 112 712 712 HOH HOH A . D 4 HOH 113 713 713 HOH HOH A . D 4 HOH 114 714 714 HOH HOH A . D 4 HOH 115 715 715 HOH HOH A . D 4 HOH 116 716 716 HOH HOH A . D 4 HOH 117 717 717 HOH HOH A . D 4 HOH 118 718 718 HOH HOH A . D 4 HOH 119 719 719 HOH HOH A . D 4 HOH 120 720 720 HOH HOH A . D 4 HOH 121 721 721 HOH HOH A . D 4 HOH 122 722 722 HOH HOH A . D 4 HOH 123 723 723 HOH HOH A . D 4 HOH 124 724 724 HOH HOH A . D 4 HOH 125 725 725 HOH HOH A . D 4 HOH 126 726 726 HOH HOH A . D 4 HOH 127 727 727 HOH HOH A . D 4 HOH 128 728 728 HOH HOH A . D 4 HOH 129 729 729 HOH HOH A . D 4 HOH 130 730 730 HOH HOH A . D 4 HOH 131 731 731 HOH HOH A . D 4 HOH 132 732 732 HOH HOH A . D 4 HOH 133 733 733 HOH HOH A . D 4 HOH 134 734 734 HOH HOH A . D 4 HOH 135 735 735 HOH HOH A . D 4 HOH 136 736 736 HOH HOH A . D 4 HOH 137 737 737 HOH HOH A . D 4 HOH 138 738 738 HOH HOH A . D 4 HOH 139 739 739 HOH HOH A . D 4 HOH 140 740 740 HOH HOH A . D 4 HOH 141 741 741 HOH HOH A . D 4 HOH 142 742 742 HOH HOH A . D 4 HOH 143 743 743 HOH HOH A . D 4 HOH 144 744 744 HOH HOH A . D 4 HOH 145 745 745 HOH HOH A . D 4 HOH 146 746 746 HOH HOH A . D 4 HOH 147 747 747 HOH HOH A . D 4 HOH 148 748 748 HOH HOH A . D 4 HOH 149 749 749 HOH HOH A . D 4 HOH 150 750 750 HOH HOH A . D 4 HOH 151 751 751 HOH HOH A . D 4 HOH 152 752 752 HOH HOH A . D 4 HOH 153 753 753 HOH HOH A . D 4 HOH 154 754 754 HOH HOH A . D 4 HOH 155 755 755 HOH HOH A . D 4 HOH 156 756 756 HOH HOH A . D 4 HOH 157 757 757 HOH HOH A . D 4 HOH 158 758 758 HOH HOH A . D 4 HOH 159 759 759 HOH HOH A . D 4 HOH 160 760 760 HOH HOH A . D 4 HOH 161 761 761 HOH HOH A . D 4 HOH 162 762 762 HOH HOH A . D 4 HOH 163 763 763 HOH HOH A . D 4 HOH 164 764 764 HOH HOH A . D 4 HOH 165 765 765 HOH HOH A . D 4 HOH 166 766 766 HOH HOH A . D 4 HOH 167 767 767 HOH HOH A . D 4 HOH 168 768 768 HOH HOH A . D 4 HOH 169 769 769 HOH HOH A . D 4 HOH 170 770 770 HOH HOH A . D 4 HOH 171 771 771 HOH HOH A . D 4 HOH 172 772 772 HOH HOH A . D 4 HOH 173 773 773 HOH HOH A . D 4 HOH 174 774 774 HOH HOH A . D 4 HOH 175 775 775 HOH HOH A . D 4 HOH 176 776 776 HOH HOH A . D 4 HOH 177 777 777 HOH HOH A . D 4 HOH 178 778 778 HOH HOH A . D 4 HOH 179 779 779 HOH HOH A . D 4 HOH 180 780 780 HOH HOH A . D 4 HOH 181 781 781 HOH HOH A . D 4 HOH 182 782 782 HOH HOH A . D 4 HOH 183 783 783 HOH HOH A . D 4 HOH 184 784 784 HOH HOH A . D 4 HOH 185 785 785 HOH HOH A . D 4 HOH 186 786 786 HOH HOH A . D 4 HOH 187 787 787 HOH HOH A . D 4 HOH 188 788 788 HOH HOH A . D 4 HOH 189 789 789 HOH HOH A . D 4 HOH 190 790 790 HOH HOH A . D 4 HOH 191 791 791 HOH HOH A . D 4 HOH 192 792 792 HOH HOH A . D 4 HOH 193 793 793 HOH HOH A . D 4 HOH 194 794 794 HOH HOH A . D 4 HOH 195 795 795 HOH HOH A . D 4 HOH 196 796 796 HOH HOH A . D 4 HOH 197 797 797 HOH HOH A . D 4 HOH 198 798 798 HOH HOH A . D 4 HOH 199 799 799 HOH HOH A . D 4 HOH 200 800 800 HOH HOH A . D 4 HOH 201 801 801 HOH HOH A . D 4 HOH 202 802 802 HOH HOH A . D 4 HOH 203 803 803 HOH HOH A . D 4 HOH 204 804 804 HOH HOH A . D 4 HOH 205 805 805 HOH HOH A . D 4 HOH 206 806 806 HOH HOH A . D 4 HOH 207 807 807 HOH HOH A . D 4 HOH 208 808 808 HOH HOH A . D 4 HOH 209 809 809 HOH HOH A . D 4 HOH 210 810 810 HOH HOH A . D 4 HOH 211 811 811 HOH HOH A . D 4 HOH 212 812 812 HOH HOH A . D 4 HOH 213 813 813 HOH HOH A . D 4 HOH 214 814 814 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 OD ? C 2CO . ? A 2CO 502 ? 1_555 139.9 ? 2 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 96.8 ? 3 OD ? C 2CO . ? A 2CO 502 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 108.5 ? 4 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 100.7 ? 5 OD ? C 2CO . ? A 2CO 502 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 109.3 ? 6 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 90.9 ? 7 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 N ? C 2CO . ? A 2CO 502 ? 1_555 89.1 ? 8 OD ? C 2CO . ? A 2CO 502 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 N ? C 2CO . ? A 2CO 502 ? 1_555 64.3 ? 9 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 N ? C 2CO . ? A 2CO 502 ? 1_555 172.7 ? 10 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 N ? C 2CO . ? A 2CO 502 ? 1_555 92.2 ? 11 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 SG ? C 2CO . ? A 2CO 502 ? 1_555 104.3 ? 12 OD ? C 2CO . ? A 2CO 502 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 SG ? C 2CO . ? A 2CO 502 ? 1_555 44.7 ? 13 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 SG ? C 2CO . ? A 2CO 502 ? 1_555 94.3 ? 14 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 SG ? C 2CO . ? A 2CO 502 ? 1_555 153.6 ? 15 N ? C 2CO . ? A 2CO 502 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 SG ? C 2CO . ? A 2CO 502 ? 1_555 80.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-06-26 2 'Structure model' 1 1 2013-08-21 3 'Structure model' 1 2 2013-09-11 4 'Structure model' 1 3 2015-06-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 PHENIX 'model building' '(phenix.refine: 1.8_1069)' ? 2 PHENIX refinement '(phenix.refine: 1.8_1069)' ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 PHENIX phasing 1.8_1069 ? 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 38 ? ? O A HOH 788 ? ? 2.05 2 1 OE1 A GLU 38 ? ? O A HOH 785 ? ? 2.07 3 1 O A GLY 66 ? A O A HOH 674 ? ? 2.15 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 128 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 74.23 _pdbx_validate_torsion.psi -9.61 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 10 ? NE ? A ARG 10 NE 2 1 Y 1 A ARG 10 ? CZ ? A ARG 10 CZ 3 1 Y 1 A ARG 10 ? NH1 ? A ARG 10 NH1 4 1 Y 1 A ARG 10 ? NH2 ? A ARG 10 NH2 5 1 Y 1 A LYS 112 ? CG ? A LYS 112 CG 6 1 Y 1 A LYS 112 ? CD ? A LYS 112 CD 7 1 Y 1 A LYS 112 ? CE ? A LYS 112 CE 8 1 Y 1 A LYS 112 ? NZ ? A LYS 112 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A PHE 191 ? A PHE 191 6 1 Y 1 A THR 192 ? A THR 192 7 1 Y 1 A THR 193 ? A THR 193 8 1 Y 1 A SER 194 ? A SER 194 9 1 Y 1 A GLY 195 ? A GLY 195 10 1 Y 1 A SER 196 ? A SER 196 11 1 Y 1 A LEU 197 ? A LEU 197 12 1 Y 1 A GLU 198 ? A GLU 198 13 1 Y 1 A ASN 199 ? A ASN 199 14 1 Y 1 A ASN 200 ? A ASN 200 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 S-HYDROPEROXYCYSTEINE 2CO 4 water HOH #