data_4IOH # _entry.id 4IOH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4IOH RCSB RCSB077008 WWPDB D_1000077008 # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.db_id NESG-TeR258 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 4IOH _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-01-07 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vorobiev, S.' 1 'Su, M.' 2 'Seetharaman, J.' 3 'Maglaqui, M.' 4 'Xiao, X.' 5 'Kohan, E.' 6 'Wang, D.' 7 'Everett, J.K.' 8 'Acton, T.B.' 9 'Montelione, G.T.' 10 'Tong, L.' 11 'Hunt, J.F.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title 'Crystal Structure of the Tll1086 protein from Thermosynechococcus elongatus.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Vorobiev, S.' 1 primary 'Su, M.' 2 primary 'Seetharaman, J.' 3 primary 'Maglaqui, M.' 4 primary 'Xiao, X.' 5 primary 'Kohan, E.' 6 primary 'Wang, D.' 7 primary 'Everett, J.K.' 8 primary 'Acton, T.B.' 9 primary 'Montelione, G.T.' 10 primary 'Tong, L.' 11 primary 'Hunt, J.F.' 12 # _cell.entry_id 4IOH _cell.length_a 87.768 _cell.length_b 87.768 _cell.length_c 76.080 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 12 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4IOH _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.Int_Tables_number 178 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tll1086 protein' 14908.289 1 ? ? ? ? 2 water nat water 18.015 17 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)(MSE)TT(MSE)NVLGTPLECCCQNPLTGFYRDGFCRTGAGDVGAHVVCAQ(MSE)TAEFLTFTRSRGNDLSTPV PAYQFPGLKPGDRWCLCASRWREALEAGVAPPVILEATHASALEYVSLEDLKAHALGGNQQRLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MMTTMNVLGTPLECCCQNPLTGFYRDGFCRTGAGDVGAHVVCAQMTAEFLTFTRSRGNDLSTPVPAYQFPGLKPGDRWCL CASRWREALEAGVAPPVILEATHASALEYVSLEDLKAHALGGNQQRLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-TeR258 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 MSE n 1 3 THR n 1 4 THR n 1 5 MSE n 1 6 ASN n 1 7 VAL n 1 8 LEU n 1 9 GLY n 1 10 THR n 1 11 PRO n 1 12 LEU n 1 13 GLU n 1 14 CYS n 1 15 CYS n 1 16 CYS n 1 17 GLN n 1 18 ASN n 1 19 PRO n 1 20 LEU n 1 21 THR n 1 22 GLY n 1 23 PHE n 1 24 TYR n 1 25 ARG n 1 26 ASP n 1 27 GLY n 1 28 PHE n 1 29 CYS n 1 30 ARG n 1 31 THR n 1 32 GLY n 1 33 ALA n 1 34 GLY n 1 35 ASP n 1 36 VAL n 1 37 GLY n 1 38 ALA n 1 39 HIS n 1 40 VAL n 1 41 VAL n 1 42 CYS n 1 43 ALA n 1 44 GLN n 1 45 MSE n 1 46 THR n 1 47 ALA n 1 48 GLU n 1 49 PHE n 1 50 LEU n 1 51 THR n 1 52 PHE n 1 53 THR n 1 54 ARG n 1 55 SER n 1 56 ARG n 1 57 GLY n 1 58 ASN n 1 59 ASP n 1 60 LEU n 1 61 SER n 1 62 THR n 1 63 PRO n 1 64 VAL n 1 65 PRO n 1 66 ALA n 1 67 TYR n 1 68 GLN n 1 69 PHE n 1 70 PRO n 1 71 GLY n 1 72 LEU n 1 73 LYS n 1 74 PRO n 1 75 GLY n 1 76 ASP n 1 77 ARG n 1 78 TRP n 1 79 CYS n 1 80 LEU n 1 81 CYS n 1 82 ALA n 1 83 SER n 1 84 ARG n 1 85 TRP n 1 86 ARG n 1 87 GLU n 1 88 ALA n 1 89 LEU n 1 90 GLU n 1 91 ALA n 1 92 GLY n 1 93 VAL n 1 94 ALA n 1 95 PRO n 1 96 PRO n 1 97 VAL n 1 98 ILE n 1 99 LEU n 1 100 GLU n 1 101 ALA n 1 102 THR n 1 103 HIS n 1 104 ALA n 1 105 SER n 1 106 ALA n 1 107 LEU n 1 108 GLU n 1 109 TYR n 1 110 VAL n 1 111 SER n 1 112 LEU n 1 113 GLU n 1 114 ASP n 1 115 LEU n 1 116 LYS n 1 117 ALA n 1 118 HIS n 1 119 ALA n 1 120 LEU n 1 121 GLY n 1 122 GLY n 1 123 ASN n 1 124 GLN n 1 125 GLN n 1 126 ARG n 1 127 LEU n 1 128 GLU n 1 129 HIS n 1 130 HIS n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene tll1086 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain BP-1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermosynechococcus elongatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 197221 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector pET21_NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name TeR258-21.4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8DJY4_THEEB _struct_ref.pdbx_db_accession Q8DJY4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MMTTMNVLGTPLECCCQNPLTGFYRDGFCRTGAGDVGAHVVCAQMTAEFLTFTRSRGNDLSTPVPAYQFPGLKPGDRWCL CASRWREALEAGVAPPVILEATHASALEYVSLEDLKAHALGGNQQR ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4IOH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 126 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8DJY4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 126 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 126 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4IOH LEU A 127 ? UNP Q8DJY4 ? ? 'EXPRESSION TAG' 127 1 1 4IOH GLU A 128 ? UNP Q8DJY4 ? ? 'EXPRESSION TAG' 128 2 1 4IOH HIS A 129 ? UNP Q8DJY4 ? ? 'EXPRESSION TAG' 129 3 1 4IOH HIS A 130 ? UNP Q8DJY4 ? ? 'EXPRESSION TAG' 130 4 1 4IOH HIS A 131 ? UNP Q8DJY4 ? ? 'EXPRESSION TAG' 131 5 1 4IOH HIS A 132 ? UNP Q8DJY4 ? ? 'EXPRESSION TAG' 132 6 1 4IOH HIS A 133 ? UNP Q8DJY4 ? ? 'EXPRESSION TAG' 133 7 1 4IOH HIS A 134 ? UNP Q8DJY4 ? ? 'EXPRESSION TAG' 134 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4IOH _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.84 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 56.64 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'Microbatch crystallization under oil' _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.temp 291 _exptl_crystal_grow.pdbx_details '1.11M sodium phosphate, 0.1M Tris-HCl, pH 8.0, Microbatch crystallization under oil, temperature 291K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2012-12-19 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97923 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.pdbx_wavelength_list 0.97923 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 24-ID-E # _reflns.entry_id 4IOH _reflns.B_iso_Wilson_estimate ? _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 0.0 _reflns.d_resolution_high 2.53 _reflns.d_resolution_low 50 _reflns.number_all 10991 _reflns.number_obs 10905 _reflns.percent_possible_obs 99.2 _reflns.pdbx_Rmerge_I_obs 0.054 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 30.5 _reflns.pdbx_redundancy 13.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.53 _reflns_shell.d_res_low 2.65 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 99.2 _reflns_shell.Rmerge_I_obs 0.0127 _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 14.3 _reflns_shell.number_unique_all 1422 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4IOH _refine.ls_d_res_high 2.530 _refine.ls_d_res_low 33.999 _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.450 _refine.ls_number_reflns_obs 10899 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'Cys15 makes a disulfide bond with Cys42 form symmetry-related mate (x,x-y,-z+1/6 + (0 0 0))' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.243 _refine.ls_R_factor_R_work 0.240 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.292 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.450 _refine.ls_number_reflns_R_free 485 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 91.813 _refine.solvent_model_param_bsol 71.871 _refine.solvent_model_param_ksol 0.332 _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 1.604 _refine.aniso_B[2][2] 1.604 _refine.aniso_B[3][3] -3.207 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.690 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.730 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 155.41 _refine.B_iso_min 39.61 _refine.pdbx_overall_phase_error 29.510 _refine.occupancy_max 1.00 _refine.occupancy_min 0.47 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 902 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 919 _refine_hist.d_res_high 2.530 _refine_hist.d_res_low 33.999 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 928 0.010 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 1259 1.399 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 141 0.082 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 165 0.006 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 328 18.884 ? ? ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 2.5297 2.5711 3 99.000 3459 . 0.356 0.358 . 154 . 3613 . . 'X-RAY DIFFRACTION' 2.895 3.647 3 100.000 3487 . 0.265 0.316 . 179 . 3666 . . 'X-RAY DIFFRACTION' 3.647 34.002 3 99.000 3468 . 0.215 0.270 . 152 . 3620 . . 'X-RAY DIFFRACTION' # _struct.entry_id 4IOH _struct.title 'Crystal Structure of the Tll1086 protein from Thermosynechococcus elongatus, Northeast Structural Genomics Consortium Target TeR258' _struct.pdbx_descriptor 'Tll1086 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4IOH _struct_keywords.text 'Structural Genomics, PSI-Biology, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details 'dimer,35.35 kD,91.5%, heptamer,109.8 kD,4.5%' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 46 ? GLY A 57 ? THR A 46 GLY A 57 1 ? 12 HELX_P HELX_P2 2 ALA A 82 ? ALA A 91 ? ALA A 82 ALA A 91 1 ? 10 HELX_P HELX_P3 3 ILE A 98 ? THR A 102 ? ILE A 98 THR A 102 5 ? 5 HELX_P HELX_P4 4 HIS A 103 ? TYR A 109 ? HIS A 103 TYR A 109 5 ? 7 HELX_P HELX_P5 5 SER A 111 ? HIS A 118 ? SER A 111 HIS A 118 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 14 A CYS 16 1_555 ? ? ? ? ? ? ? 2.023 ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 15 A CYS 42 12_555 ? ? ? ? ? ? ? 2.070 ? disulf3 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 79 SG ? ? A CYS 29 A CYS 79 1_555 ? ? ? ? ? ? ? 2.042 ? covale1 covale ? ? A MSE 2 C ? ? ? 1_555 A THR 3 N ? ? A MSE 2 A THR 3 1_555 ? ? ? ? ? ? ? 1.333 ? covale2 covale ? ? A THR 4 C ? ? ? 1_555 A MSE 5 N ? ? A THR 4 A MSE 5 1_555 ? ? ? ? ? ? ? 1.338 ? covale3 covale ? ? A MSE 5 C ? ? ? 1_555 A ASN 6 N ? ? A MSE 5 A ASN 6 1_555 ? ? ? ? ? ? ? 1.333 ? covale4 covale ? ? A GLN 44 C ? ? ? 1_555 A MSE 45 N ? ? A GLN 44 A MSE 45 1_555 ? ? ? ? ? ? ? 1.324 ? covale5 covale ? ? A MSE 45 C ? ? ? 1_555 A THR 46 N ? ? A MSE 45 A THR 46 1_555 ? ? ? ? ? ? ? 1.338 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 18 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 18 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 19 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 19 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 10.23 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 39 ? GLN A 44 ? HIS A 39 GLN A 44 A 2 ARG A 77 ? CYS A 81 ? ARG A 77 CYS A 81 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ALA _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 43 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 43 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TRP _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 78 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TRP _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 78 # _atom_sites.entry_id 4IOH _atom_sites.fract_transf_matrix[1][1] 0.011394 _atom_sites.fract_transf_matrix[1][2] 0.006578 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013156 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013144 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 MSE 2 2 2 MSE MSE A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 MSE 5 5 5 MSE MSE A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 MSE 45 45 45 MSE MSE A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 TRP 85 85 85 TRP TRP A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 GLY 122 122 ? ? ? A . n A 1 123 ASN 123 123 ? ? ? A . n A 1 124 GLN 124 124 ? ? ? A . n A 1 125 GLN 125 125 ? ? ? A . n A 1 126 ARG 126 126 ? ? ? A . n A 1 127 LEU 127 127 ? ? ? A . n A 1 128 GLU 128 128 ? ? ? A . n A 1 129 HIS 129 129 ? ? ? A . n A 1 130 HIS 130 130 ? ? ? A . n A 1 131 HIS 131 131 ? ? ? A . n A 1 132 HIS 132 132 ? ? ? A . n A 1 133 HIS 133 133 ? ? ? A . n A 1 134 HIS 134 134 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 2 A MSE 2 ? MET SELENOMETHIONINE 2 A MSE 5 A MSE 5 ? MET SELENOMETHIONINE 3 A MSE 45 A MSE 45 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2960 ? 1 MORE -25 ? 1 'SSA (A^2)' 11950 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_555 x,x-y,-z+1/6 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 12.6800000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 213 ? B HOH . 2 1 A HOH 216 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-01-30 2 'Structure model' 1 1 2013-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Data collection' # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 PHENIX 1.7.2_869 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 2 PDB_EXTRACT 3.100 'Jan. 22, 2010' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 3 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 4 XDS . ? ? ? ? 'data reduction' ? ? ? 5 XSCALE . ? ? ? ? 'data scaling' ? ? ? 6 AutoSol . ? ? ? ? phasing ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 29 ? ? -77.23 49.03 2 1 VAL A 64 ? ? -163.13 96.52 3 1 PRO A 65 ? ? -79.78 43.37 4 1 GLN A 68 ? ? 57.47 70.22 5 1 HIS A 118 ? ? -105.61 45.52 6 1 ALA A 119 ? ? -75.30 -154.40 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A GLY 122 ? A GLY 122 3 1 Y 1 A ASN 123 ? A ASN 123 4 1 Y 1 A GLN 124 ? A GLN 124 5 1 Y 1 A GLN 125 ? A GLN 125 6 1 Y 1 A ARG 126 ? A ARG 126 7 1 Y 1 A LEU 127 ? A LEU 127 8 1 Y 1 A GLU 128 ? A GLU 128 9 1 Y 1 A HIS 129 ? A HIS 129 10 1 Y 1 A HIS 130 ? A HIS 130 11 1 Y 1 A HIS 131 ? A HIS 131 12 1 Y 1 A HIS 132 ? A HIS 132 13 1 Y 1 A HIS 133 ? A HIS 133 14 1 Y 1 A HIS 134 ? A HIS 134 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 201 HOH WAT A . B 2 HOH 2 202 202 HOH WAT A . B 2 HOH 3 203 203 HOH WAT A . B 2 HOH 4 204 204 HOH WAT A . B 2 HOH 5 205 205 HOH WAT A . B 2 HOH 6 206 206 HOH WAT A . B 2 HOH 7 207 208 HOH WAT A . B 2 HOH 8 208 209 HOH WAT A . B 2 HOH 9 209 211 HOH WAT A . B 2 HOH 10 210 212 HOH WAT A . B 2 HOH 11 211 214 HOH WAT A . B 2 HOH 12 212 215 HOH WAT A . B 2 HOH 13 213 216 HOH WAT A . B 2 HOH 14 214 217 HOH WAT A . B 2 HOH 15 215 218 HOH WAT A . B 2 HOH 16 216 219 HOH WAT A . B 2 HOH 17 217 220 HOH WAT A . #